Diaphorina citri psyllid: psy15622


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MKRLIKRDIIVERPDVQWSDIANQVKAKKLLQEAVILPLEKPSYFQHIRKPWKGVLMVGPPGTGKTMLAKAVAIVYNQVHCGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGYSASDIVVVCRDAAFMAMRAAIRGKSVPQIQAIPMAQLKRPVTKADFEMAIAKCRKTVTAADIRQFEEWNEKFGSSV
cHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccEEEEEccccccccHHHHHHHHHHccEEEccccccccccHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccc
**RLIKRDIIVERPDVQWSDIANQVKAKKLLQEAVILPLEKPSYFQHIRKPWKGVLMVGPPGTGKTMLAKAVAIVYNQVHCGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGYSASDIVVVCRDAAFMAMRAAIRGKSVPQIQAIPMAQLKRPVTKADFEMAIAKCRKTVTAADIRQFEEWNEKFGS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRLIKRDIIVERPDVQWSDIANQVKAKKLLQEAVILPLEKPSYFQHIRKPWKGVLMVGPPGTGKTMLAKAVAIVYNQVHCGASNFPWNIDDAFLRRLEKRIYVPLPSSSGRQELLRLILRQVDLASDLDLELVSDQLEGYSASDIVVVCRDAAFMAMRAAIRGKSVPQIQAIPMAQLKRPVTKADFEMAIAKCRKTVTAADIRQFEEWNEKFGSSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Katanin p60 ATPase-containing subunit A1 Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays, such as that seen during disassembly of interphase microtubules at the G2-M transition. May also be required for microtubule release from the centrosome after nucleation. In mitotic spindles this could allow depolymerization of the microtubule end proximal to the centrosome, and subsequent poleward microtubule flux. In neurons, microtubule release within the cell body allows their subsequent transport into neuronal processes by microtubule dependent motor proteins. This transport is required for axonal growth.confidentQ6E0V2
Katanin p60 ATPase-containing subunit A-like 1 Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.confidentQ9BW62
Katanin p60 ATPase-containing subunit A-like 1 Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.confidentQ5U3S1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0008568 [MF]microtubule-severing ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051013 [BP]microtubule severingprobableGO:0008150, GO:0009987, GO:0007017, GO:0044763, GO:0044699
GO:0022402 [BP]cell cycle processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0045502 [MF]dynein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031122 [BP]cytoplasmic microtubule organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0071840, GO:0044763, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0010977 [BP]negative regulation of neuron projection developmentprobableGO:0010975, GO:0030154, GO:0051129, GO:0051128, GO:0031345, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0044763, GO:0048523
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005694 [CC]chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QP9, chain X
Confidence level:very confident
Coverage over the Query: 15-214
View the alignment between query and template
View the model in PyMOL