Query         psy15631
Match_columns 213
No_of_seqs    111 out of 237
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:39:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15631.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15631hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0527|consensus               99.5 5.9E-15 1.3E-19  134.1   5.4   37    2-38    108-144 (331)
  2 cd01389 MATA_HMG-box MATA_HMG-  98.4 1.2E-07 2.6E-12   67.7   2.8   31    2-32     47-77  (77)
  3 KOG0528|consensus               98.2 8.1E-07 1.8E-11   85.5   2.7   37    1-37    370-406 (511)
  4 cd01388 SOX-TCF_HMG-box SOX-TC  97.7 2.2E-05 4.7E-10   55.6   2.2   26    2-27     47-72  (72)
  5 KOG3248|consensus               91.6    0.19 4.1E-06   48.1   3.6   28    2-29    237-264 (421)
  6 smart00398 HMG high mobility g  91.6     0.1 2.3E-06   34.9   1.4   24    2-25     47-70  (70)
  7 PF00505 HMG_box:  HMG (high mo  89.8   0.066 1.4E-06   36.4  -0.8   24    2-25     46-69  (69)
  8 cd00084 HMG-box High Mobility   85.5    0.57 1.2E-05   30.9   1.7   21    2-22     46-66  (66)
  9 PF12336 SOXp:  SOX transcripti  70.7     1.6 3.5E-05   33.9   0.4   13   26-38      1-13  (84)
 10 cd01390 HMGB-UBF_HMG-box HMGB-  48.8      13 0.00028   24.7   1.7   19    2-20     46-64  (66)
 11 PF09011 HMG_box_2:  HMG-box do  41.7      18 0.00039   25.5   1.6   19    2-20     50-68  (73)
 12 PF12108 SF3a60_bindingd:  Spli  35.5      36 0.00079   21.7   2.1   18    5-23     11-28  (28)

No 1  
>KOG0527|consensus
Probab=99.54  E-value=5.9e-15  Score=134.05  Aligned_cols=37  Identities=73%  Similarity=1.137  Sum_probs=34.9

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCcccCCCCCCCCCCC
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQS   38 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYKYrPRRK~k~~~~~   38 (213)
                      ||+||||||||||++||++|||||||||||+|+....
T Consensus       108 EKrPFi~EAeRLR~~HmkehPdYKYRPRRKkk~~~~~  144 (331)
T KOG0527|consen  108 EKRPFVDEAERLRAQHMKEYPDYKYRPRRKKKKRPKL  144 (331)
T ss_pred             hhccHHHHHHHHHHHHHHhCCCccccccccccccccc
Confidence            8999999999999999999999999999999887764


No 2  
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include the fungal mating type gene products MC, MATA1 and Ste11.
Probab=98.45  E-value=1.2e-07  Score=67.72  Aligned_cols=31  Identities=35%  Similarity=0.629  Sum_probs=29.4

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCcccCCCCC
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYKYRPRRKP   32 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYKYrPRRK~   32 (213)
                      ||.+|.++|++++++|+++||+|+|+|||+.
T Consensus        47 eK~~y~~~A~~~k~~~~~~~p~Yky~p~~~~   77 (77)
T cd01389          47 VKAYYKELAEEEKERHAREYPDYKYTPRKSS   77 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCcccCCCCC
Confidence            6899999999999999999999999999974


No 3  
>KOG0528|consensus
Probab=98.19  E-value=8.1e-07  Score=85.49  Aligned_cols=37  Identities=38%  Similarity=0.790  Sum_probs=33.7

Q ss_pred             CCcchhHHHHHHHHHHHHhhCCCCcccCCCCCCCCCC
Q psy15631          1 MEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTPGQ   37 (213)
Q Consensus         1 ~EK~PyideAkrLKa~H~k~YPdYKYrPRRK~k~~~~   37 (213)
                      .||+||++|-.||..+|+++|||||||||-|+.|..+
T Consensus       370 ~eKQPYYEEQaRLSk~HlEk~PdYrYkPRPKRTCvvd  406 (511)
T KOG0528|consen  370 TEKQPYYEEQARLSKLHLEKYPDYRYKPRPKRTCVVD  406 (511)
T ss_pred             ccccchHHHHHHHHHhhhccCcccccCCCCCceeeec
Confidence            3899999999999999999999999999988877553


No 4  
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif.
Probab=97.70  E-value=2.2e-05  Score=55.62  Aligned_cols=26  Identities=58%  Similarity=1.088  Sum_probs=24.9

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCccc
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYKYR   27 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYKYr   27 (213)
                      ||.+|.++|++++++|+++||||||+
T Consensus        47 eK~~y~~~a~~~k~~y~~~~p~y~y~   72 (72)
T cd01388          47 EKQPYYEEAKKLKELHMKLYPDYKWR   72 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHCcCCCCC
Confidence            68999999999999999999999996


No 5  
>KOG3248|consensus
Probab=91.58  E-value=0.19  Score=48.07  Aligned_cols=28  Identities=25%  Similarity=0.492  Sum_probs=24.8

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCcccCC
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYKYRPR   29 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYKYrPR   29 (213)
                      |..-|+|.|++.|+.||+.||+|.-|-+
T Consensus       237 EQAKYyElArKerqlH~qlYP~WSARdN  264 (421)
T KOG3248|consen  237 EQAKYYELARKERQLHMQLYPGWSARDN  264 (421)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCcchhhh
Confidence            5678999999999999999999986665


No 6  
>smart00398 HMG high mobility group.
Probab=91.56  E-value=0.1  Score=34.89  Aligned_cols=24  Identities=38%  Similarity=0.639  Sum_probs=22.6

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCc
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYK   25 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYK   25 (213)
                      ||.+|.++|++.+++|.+++++|+
T Consensus        47 ek~~y~~~a~~~~~~y~~~~~~y~   70 (70)
T smart00398       47 EKAPYEEKAKKDKERYEEEMPEYK   70 (70)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcC
Confidence            689999999999999999999985


No 7  
>PF00505 HMG_box:  HMG (high mobility group) box;  InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin. HMG1 (also called HMG-T in fish) and HMG2 are two highly related proteins that bind single-stranded DNA preferentially and unwind double-stranded DNA. Although they have no sequence specificity, they have a high affinity for bent or distorted DNA, and bend linear DNA. HMG1 and HMG2 contain two DNA-binding HMG-box domains (A and B) that show structural and functional differences, and have a long acidic C-terminal domain rich in aspartic and glutamic acid residues. The acidic tail modulates the affinity of the tandem HMG boxes in HMG1 and 2 for a variety of DNA targets. HMG1 and 2 appear to play important architectural roles in the assembly of nucleoprotein complexes in a variety of biological processes, for example V(D)J recombination, the initiation of transcription, and DNA repair []. The profile in this entry describing the HMG-domains is much more general than the signature. In addition to the HMG1 and HMG2 proteins, HMG-domains occur in single or multiple copies in the following protein classes; the SOX family of transcription factors; SRY sex determining region Y protein and related proteins []; LEF1 lymphoid enhancer binding factor 1 []; SSRP recombination signal recognition protein; MTF1 mitochondrial transcription factor 1; UBF1/2 nucleolar transcription factors; Abf2 yeast ARS-binding factor []; and Saccharomyces cerevisiae transcription factors Ixr1, Rox1, Nhp6a, Nhp6b and Spp41.; GO: 0003677 DNA binding; PDB: 1I11_A 1J3C_A 1J3D_A 1WZ6_A 1WGF_A 2D7L_A 1GT0_D 3U2B_C 2CRJ_A 2CS1_A ....
Probab=89.76  E-value=0.066  Score=36.35  Aligned_cols=24  Identities=42%  Similarity=0.666  Sum_probs=22.3

Q ss_pred             CcchhHHHHHHHHHHHHhhCCCCc
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHPDYK   25 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YPdYK   25 (213)
                      ||.+|.++|++.+++|.+++++|+
T Consensus        46 eK~~y~~~a~~~~~~y~~~~~~y~   69 (69)
T PF00505_consen   46 EKAPYKEEAEEEKERYEKEMPEYK   69 (69)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcC
Confidence            689999999999999999998885


No 8  
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors. HMGs bind to the minor groove of DNA and have been classified by DNA binding preferences. Two phylogenically distinct groups of Class I proteins bind DNA in a sequence specific fashion and contain a single HMG box. One group (SOX-TCF) includes transcription factors, TCF-1, -3, -4; and also SRY and LEF-1, which bind four-way DNA junctions and duplex DNA targets. The second group (MATA) includes fungal mating type gene products MC, MATA1 and Ste11. Class II and III proteins (HMGB-UBF) bind DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III member
Probab=85.46  E-value=0.57  Score=30.92  Aligned_cols=21  Identities=29%  Similarity=0.436  Sum_probs=19.2

Q ss_pred             CcchhHHHHHHHHHHHHhhCC
Q psy15631          2 EKRPFIDEAKRLRAMHMKEHP   22 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~YP   22 (213)
                      ||.+|+++|++.+++|.+.+|
T Consensus        46 ~k~~y~~~a~~~~~~y~~~~~   66 (66)
T cd00084          46 EKKKYEEKAEKDKERYEKEMP   66 (66)
T ss_pred             HHHHHHHHHHHHHHHHHHhhC
Confidence            689999999999999998875


No 9  
>PF12336 SOXp:  SOX transcription factor;  InterPro: IPR022097  This domain family is found in eukaryotes, and is approximately 80 amino acids in length. The family is found in association with PF00505 from PFAM. There are two conserved sequence motifs: KKDK and LPG. This family is made up of SOX transcription factors. These are involved in upregulation of nestin, a neural promoter. ; PDB: 2LE4_A.
Probab=70.71  E-value=1.6  Score=33.89  Aligned_cols=13  Identities=62%  Similarity=0.856  Sum_probs=3.8

Q ss_pred             ccCCCCCCCCCCC
Q psy15631         26 YRPRRKPKTPGQS   38 (213)
Q Consensus        26 YrPRRK~k~~~~~   38 (213)
                      ||||||.|.+++.
T Consensus         1 YRPRRKtKtLlKK   13 (84)
T PF12336_consen    1 YRPRRKTKTLLKK   13 (84)
T ss_dssp             S-SS--S------
T ss_pred             CCCcccchhhhcc
Confidence            8999999988774


No 10 
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins. These proteins bind the minor groove of DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III members include nucleolar and mitochondrial transcription factors, UBF and mtTF1, which bind four-way DNA junctions.
Probab=48.78  E-value=13  Score=24.72  Aligned_cols=19  Identities=26%  Similarity=0.372  Sum_probs=16.5

Q ss_pred             CcchhHHHHHHHHHHHHhh
Q psy15631          2 EKRPFIDEAKRLRAMHMKE   20 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~   20 (213)
                      ||.+|.++|++.+++..++
T Consensus        46 eK~~y~~~a~~~~~~y~~e   64 (66)
T cd01390          46 EKKKYEEKAEKDKERYEKE   64 (66)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            6899999999999988654


No 11 
>PF09011 HMG_box_2:  HMG-box domain;  InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins. It has no known function. ; GO: 0005634 nucleus; PDB: 2EQZ_A 1V64_A 2CTO_A 1H5P_A 3TQ6_A 3FGH_A 3TMM_A 1J3X_A 2YRQ_A 1AAB_A ....
Probab=41.71  E-value=18  Score=25.47  Aligned_cols=19  Identities=32%  Similarity=0.447  Sum_probs=16.7

Q ss_pred             CcchhHHHHHHHHHHHHhh
Q psy15631          2 EKRPFIDEAKRLRAMHMKE   20 (213)
Q Consensus         2 EK~PyideAkrLKa~H~k~   20 (213)
                      ||.+|.++|+.+|++..++
T Consensus        50 EK~~Y~~~A~~~k~~y~~e   68 (73)
T PF09011_consen   50 EKEPYEERAKEDKERYERE   68 (73)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            7899999999999987665


No 12 
>PF12108 SF3a60_bindingd:  Splicing factor SF3a60 binding domain;  InterPro: IPR021966  This domain is found in eukaryotes. This domain is about 30 amino acids in length. This domain has a single completely conserved residue Y that may be functionally important. SF3a60 makes up the SF3a complex with SF3a66 and SF3a120. This domain is the binding site of SF3a60 for SF3a120. The SF3a complex is part of the spliceosome, a protein complex involved in splicing mRNA after transcription. ; PDB: 2DT7_A.
Probab=35.53  E-value=36  Score=21.67  Aligned_cols=18  Identities=22%  Similarity=0.617  Sum_probs=12.9

Q ss_pred             hhHHHHHHHHHHHHhhCCC
Q psy15631          5 PFIDEAKRLRAMHMKEHPD   23 (213)
Q Consensus         5 PyideAkrLKa~H~k~YPd   23 (213)
                      -|+++-+++|+-| ++||+
T Consensus        11 eFY~rlk~Ike~H-rr~Pn   28 (28)
T PF12108_consen   11 EFYERLKEIKEYH-RRYPN   28 (28)
T ss_dssp             HHHHHHHHHHHHH-HS--S
T ss_pred             HHHHHHHHHHHHH-HhCCC
Confidence            4788888999988 67775


Done!