Query         psy15639
Match_columns 135
No_of_seqs    11 out of 13
Neff          1.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:49:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15639.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15639hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02318 FYVE_2:  FYVE-type zin  97.9 5.3E-06 1.2E-10   59.1   1.7   54   10-68     54-108 (118)
  2 PF01363 FYVE:  FYVE zinc finge  96.4  0.0011 2.3E-08   42.3   0.5   61    5-65      4-68  (69)
  3 PF00628 PHD:  PHD-finger;  Int  95.7  0.0026 5.6E-08   38.3  -0.1   50   13-63      2-51  (51)
  4 PF13639 zf-RING_2:  Ring finge  94.8  0.0023   5E-08   38.0  -2.3   44   11-61      1-44  (44)
  5 PF13920 zf-C3HC4_3:  Zinc fing  94.8  0.0035 7.5E-08   38.2  -1.6   45   11-65      3-48  (50)
  6 cd00065 FYVE FYVE domain; Zinc  94.6   0.025 5.4E-07   34.6   1.9   51   10-60      2-54  (57)
  7 smart00064 FYVE Protein presen  94.1   0.061 1.3E-06   34.1   2.9   60    6-65      6-67  (68)
  8 KOG2177|consensus               93.5   0.034 7.3E-07   38.2   1.0   43   10-62     13-55  (386)
  9 smart00249 PHD PHD zinc finger  93.5   0.057 1.2E-06   30.1   1.8   47   12-60      1-47  (47)
 10 PF14634 zf-RING_5:  zinc-RING   93.1   0.026 5.7E-07   33.9  -0.0   43   13-62      2-44  (44)
 11 cd00162 RING RING-finger (Real  91.6   0.019   4E-07   31.5  -1.8   44   12-63      1-44  (45)
 12 KOG3799|consensus               91.6   0.082 1.8E-06   42.5   1.1   53   10-64     65-117 (169)
 13 PF07649 C1_3:  C1-like domain;  84.9    0.26 5.6E-06   28.0  -0.1   29   12-41      2-30  (30)
 14 PLN03208 E3 ubiquitin-protein   82.2    0.31 6.7E-06   39.4  -0.8   52   10-65     18-79  (193)
 15 smart00396 ZnF_UBR1 Putative z  81.2     0.5 1.1E-05   31.7   0.1   31   14-44      1-35  (71)
 16 PHA02929 N1R/p28-like protein;  81.0     0.4 8.6E-06   39.3  -0.5   52    9-66    173-228 (238)
 17 PF14446 Prok-RING_1:  Prokaryo  78.6    0.84 1.8E-05   30.7   0.5   32   10-41      5-36  (54)
 18 cd00350 rubredoxin_like Rubred  76.3    0.99 2.1E-05   26.4   0.3   10   53-62     16-25  (33)
 19 KOG1729|consensus               72.3     4.1 8.9E-05   34.4   3.2   62    5-66    163-226 (288)
 20 PF00097 zf-C3HC4:  Zinc finger  72.2    0.85 1.8E-05   26.1  -0.7   28   13-43      1-28  (41)
 21 PF13923 zf-C3HC4_2:  Zinc fing  72.0     0.5 1.1E-05   27.5  -1.7   39   13-60      1-39  (39)
 22 PF05715 zf-piccolo:  Piccolo Z  71.2     2.8 6.1E-05   29.2   1.6   51   11-62      3-57  (61)
 23 PF04810 zf-Sec23_Sec24:  Sec23  71.1     1.7 3.7E-05   26.3   0.5   28   36-63      4-33  (40)
 24 TIGR00622 ssl1 transcription f  70.5     2.4 5.2E-05   31.9   1.2   37    9-45     54-100 (112)
 25 PF01155 HypA:  Hydrogenase exp  68.9       1 2.2E-05   32.2  -1.0   23   11-33     71-93  (113)
 26 PF12874 zf-met:  Zinc-finger o  68.7       1 2.2E-05   23.6  -0.7   14   55-68      1-14  (25)
 27 PF10497 zf-4CXXC_R1:  Zinc-fin  66.9     1.7 3.7E-05   31.3  -0.2   52    9-62      6-69  (105)
 28 KOG0320|consensus               66.4     1.2 2.5E-05   36.5  -1.2   50   11-68    132-181 (187)
 29 TIGR00100 hypA hydrogenase nic  66.3     2.3 4.9E-05   30.7   0.4   23   11-33     71-93  (115)
 30 PF03107 C1_2:  C1 domain;  Int  66.1     2.3 5.1E-05   24.3   0.3   29   12-41      2-30  (30)
 31 PRK14559 putative protein seri  65.2     6.1 0.00013   36.4   3.0   25   53-77     40-64  (645)
 32 smart00336 BBOX B-Box-type zin  65.0     2.8 6.2E-05   23.6   0.6   30   10-43      3-32  (42)
 33 PF00301 Rubredoxin:  Rubredoxi  63.3     2.4 5.3E-05   27.2   0.0   13   50-62     30-42  (47)
 34 PRK12380 hydrogenase nickel in  63.2     2.8   6E-05   30.2   0.3   23   11-33     71-93  (113)
 35 COG1571 Predicted DNA-binding   63.2     3.7 8.1E-05   36.7   1.2   59   34-99    350-408 (421)
 36 PF12773 DZR:  Double zinc ribb  60.5     4.6 9.9E-05   24.3   0.9   42   13-67      1-42  (50)
 37 smart00661 RPOL9 RNA polymeras  60.2       5 0.00011   24.0   1.1   29   36-64      2-30  (52)
 38 TIGR00570 cdk7 CDK-activating   59.6     2.5 5.4E-05   36.3  -0.5   60   11-78      4-65  (309)
 39 PTZ00303 phosphatidylinositol   59.5     7.1 0.00015   39.1   2.4   56   10-65    460-530 (1374)
 40 PF13831 PHD_2:  PHD-finger; PD  58.1       3 6.4E-05   25.2  -0.2   32   27-61      5-36  (36)
 41 PRK10422 lipopolysaccharide co  56.0       7 0.00015   31.0   1.5   25   76-100    16-40  (352)
 42 PF09889 DUF2116:  Uncharacteri  55.4     5.8 0.00013   26.8   0.8   14   11-24      4-17  (59)
 43 KOG1985|consensus               55.3     4.5 9.7E-05   39.4   0.4   28   36-63    220-249 (887)
 44 smart00109 C1 Protein kinase C  54.4     8.2 0.00018   21.9   1.3   33    8-40      9-41  (49)
 45 TIGR01053 LSD1 zinc finger dom  54.1     5.9 0.00013   23.7   0.6   26   34-61      1-26  (31)
 46 PRK00564 hypA hydrogenase nick  53.9     5.7 0.00012   28.7   0.7   23   11-33     72-95  (117)
 47 PRK10964 ADP-heptose:LPS hepto  53.4     6.6 0.00014   30.6   0.9   24   77-100    12-35  (322)
 48 TIGR02193 heptsyl_trn_I lipopo  53.1     6.3 0.00014   30.4   0.8   24   77-100    11-34  (319)
 49 PF00643 zf-B_box:  B-box zinc   52.2     3.3 7.1E-05   24.0  -0.7   30   11-44      4-33  (42)
 50 PF07975 C1_4:  TFIIH C1-like d  51.8     4.8  0.0001   26.6  -0.0   32   13-44      2-39  (51)
 51 TIGR03826 YvyF flagellar opero  51.6     5.5 0.00012   30.4   0.3   24   11-35      4-27  (137)
 52 TIGR02201 heptsyl_trn_III lipo  51.6     9.4  0.0002   29.9   1.6   24   77-100    11-34  (344)
 53 PF06718 DUF1203:  Protein of u  51.1       7 0.00015   29.1   0.7   16   11-26      2-17  (117)
 54 cd00730 rubredoxin Rubredoxin;  49.9     7.6 0.00016   25.2   0.7   13   50-62     30-42  (50)
 55 PF00096 zf-C2H2:  Zinc finger,  49.4       6 0.00013   20.2   0.1   11   12-22      2-12  (23)
 56 KOG1813|consensus               49.4     6.8 0.00015   34.3   0.5   51    8-68    239-289 (313)
 57 PRK10916 ADP-heptose:LPS hepto  49.3     8.1 0.00018   30.5   0.9   24   77-100    12-35  (348)
 58 PF12760 Zn_Tnp_IS1595:  Transp  49.1       6 0.00013   24.2   0.1   24   36-62     20-45  (46)
 59 PF13465 zf-H2C2_2:  Zinc-finge  48.3     6.1 0.00013   21.7   0.0   14    8-21     12-25  (26)
 60 TIGR00270 conserved hypothetic  47.5     6.2 0.00013   30.1  -0.0   34   12-46      2-36  (154)
 61 PF10058 DUF2296:  Predicted in  47.3     7.3 0.00016   25.5   0.3   28   35-62     23-52  (54)
 62 cd02335 ZZ_ADA2 Zinc finger, Z  47.3      14  0.0003   23.0   1.6   34   12-46      2-36  (49)
 63 PF13445 zf-RING_UBOX:  RING-ty  46.4     5.5 0.00012   24.8  -0.4   28   13-41      1-28  (43)
 64 TIGR02195 heptsyl_trn_II lipop  45.2     9.7 0.00021   29.6   0.8   24   77-100    11-34  (334)
 65 PF13842 Tnp_zf-ribbon_2:  DDE_  45.1     9.3  0.0002   22.6   0.5   26   12-37      2-27  (32)
 66 TIGR00599 rad18 DNA repair pro  44.8     4.9 0.00011   35.3  -1.1   50    7-66     23-72  (397)
 67 COG5028 Vesicle coat complex C  44.7     6.6 0.00014   38.2  -0.3   35   35-69    200-236 (861)
 68 PRK14890 putative Zn-ribbon RN  44.6      12 0.00025   25.8   1.0   36   11-63      8-45  (59)
 69 PLN02189 cellulose synthase     43.9      52  0.0011   32.8   5.5   50   11-65     35-87  (1040)
 70 PRK06424 transcription factor;  43.9     7.2 0.00016   29.7  -0.1   35   13-48      3-37  (144)
 71 KOG2169|consensus               43.2       7 0.00015   35.5  -0.3   36   28-65    321-356 (636)
 72 PF13894 zf-C2H2_4:  C2H2-type   43.0     5.8 0.00013   19.4  -0.5   14   55-68      1-14  (24)
 73 PF02207 zf-UBR:  Putative zinc  43.0     6.8 0.00015   25.8  -0.3   26   15-40      2-31  (71)
 74 PF05810 NinF:  NinF protein;    42.8     6.4 0.00014   27.3  -0.5   24    7-32     15-38  (58)
 75 PF09334 tRNA-synt_1g:  tRNA sy  42.0     8.6 0.00019   32.5   0.0   53   12-67    122-179 (391)
 76 PRK03824 hypA hydrogenase nick  41.6     9.5 0.00021   28.2   0.2   13   11-23     71-83  (135)
 77 PF14569 zf-UDP:  Zinc-binding   41.1     8.5 0.00018   28.0  -0.1   48    9-61      8-58  (80)
 78 PRK13267 archaemetzincin-like   39.9      12 0.00027   29.0   0.6   28   40-67    147-176 (179)
 79 PRK03670 competence damage-ind  39.8      18 0.00038   29.4   1.5   19   83-102   197-215 (252)
 80 COG0859 RfaF ADP-heptose:LPS h  39.7      14 0.00031   29.6   1.0   24   77-100    13-36  (334)
 81 KOG4739|consensus               39.6      14  0.0003   30.8   0.9   45   12-66      5-49  (233)
 82 PRK08222 hydrogenase 4 subunit  39.0      11 0.00024   28.8   0.2   16    9-24    113-128 (181)
 83 PRK01343 zinc-binding protein;  38.9      22 0.00048   24.1   1.6   25    5-30      4-28  (57)
 84 PF14599 zinc_ribbon_6:  Zinc-r  37.4     9.1  0.0002   25.9  -0.4   24   22-45     21-59  (61)
 85 cd03789 GT1_LPS_heptosyltransf  36.7      17 0.00036   27.6   0.8   24   77-100    11-34  (279)
 86 PF02891 zf-MIZ:  MIZ/SP-RING z  36.3     3.3 7.3E-05   26.2  -2.5   31   30-62     19-49  (50)
 87 KOG1245|consensus               35.6      18  0.0004   36.4   1.2   55    6-65   1104-1160(1404)
 88 PHA02926 zinc finger-like prot  35.5      11 0.00024   32.0  -0.2   59    7-65    167-230 (242)
 89 PLN02436 cellulose synthase A   35.3      21 0.00045   35.7   1.4   50   11-65     37-89  (1094)
 90 PF13901 DUF4206:  Domain of un  35.1      24 0.00053   27.4   1.6   34   28-61    144-179 (202)
 91 smart00184 RING Ring finger. E  35.1      12 0.00027   19.2  -0.0   26   13-42      1-26  (39)
 92 PRK04023 DNA polymerase II lar  34.8      28 0.00061   35.0   2.3   69   22-97    622-695 (1121)
 93 PF08271 TF_Zn_Ribbon:  TFIIB z  34.8      12 0.00027   22.4  -0.1   32   36-68      2-33  (43)
 94 COG0675 Transposase and inacti  33.9      15 0.00032   27.2   0.2   24   26-64    309-332 (364)
 95 cd04476 RPA1_DBD_C RPA1_DBD_C:  33.7      15 0.00032   26.7   0.2   12   53-64     50-61  (166)
 96 PRK00398 rpoP DNA-directed RNA  33.6      14 0.00029   22.5  -0.1   28   36-65      5-32  (46)
 97 TIGR02605 CxxC_CxxC_SSSS putat  33.4      11 0.00024   22.8  -0.5   27   36-62      7-34  (52)
 98 cd02249 ZZ Zinc finger, ZZ typ  33.0      27 0.00059   21.2   1.3   32   12-45      2-34  (46)
 99 PF10217 DUF2039:  Uncharacteri  32.8      11 0.00025   27.5  -0.5   15   20-34     49-63  (92)
100 cd00029 C1 Protein kinase C co  32.8      20 0.00044   20.6   0.6   28    9-36     10-38  (50)
101 smart00834 CxxC_CXXC_SSSS Puta  32.7      12 0.00026   21.3  -0.3   27   37-63      8-35  (41)
102 PF00645 zf-PARP:  Poly(ADP-rib  32.6      23 0.00049   23.2   0.9   50    6-68      4-53  (82)
103 PRK06260 threonine synthase; V  31.7      20 0.00044   29.8   0.7   23   12-34      5-27  (397)
104 KOG4275|consensus               31.3      21 0.00045   31.8   0.7   53    6-65     40-92  (350)
105 PRK03681 hypA hydrogenase nick  31.0      19 0.00042   25.9   0.4   16   11-26     71-86  (114)
106 PF04981 NMD3:  NMD3 family ;    31.0      39 0.00085   26.5   2.1   74   13-97      1-81  (236)
107 COG5152 Uncharacterized conser  30.9      18 0.00039   31.0   0.2   47   10-68    196-244 (259)
108 KOG0311|consensus               30.5      10 0.00022   34.0  -1.3   49   12-68     45-93  (381)
109 PRK04023 DNA polymerase II lar  30.3      20 0.00043   36.0   0.5   46   11-68    627-677 (1121)
110 PRK14284 chaperone protein Dna  30.1      25 0.00055   29.7   1.0   49    8-62    156-219 (391)
111 KOG4628|consensus               30.0      24 0.00053   30.9   0.9   48   11-66    230-279 (348)
112 PRK08197 threonine synthase; V  29.7      23 0.00049   29.5   0.6   22   11-33      8-29  (394)
113 PF13912 zf-C2H2_6:  C2H2-type   29.6      19 0.00041   18.9   0.1   11   12-22      3-13  (27)
114 PF13945 NST1:  Salt tolerance   29.1      21 0.00045   28.9   0.3   18   53-75    140-157 (190)
115 COG1997 RPL43A Ribosomal prote  28.9      20 0.00042   26.5   0.1   31   36-68     37-67  (89)
116 COG1773 Rubredoxin [Energy pro  28.8      22 0.00049   24.0   0.4    9   54-62      3-11  (55)
117 PF01258 zf-dskA_traR:  Prokary  28.8      12 0.00026   21.8  -0.8   26   10-35      3-33  (36)
118 COG5533 UBP5 Ubiquitin C-termi  28.8      16 0.00035   33.0  -0.4   30   43-72    273-302 (415)
119 PF12251 zf-SNAP50_C:  snRNA-ac  28.7      36 0.00078   26.7   1.6   33    5-37    134-176 (196)
120 KOG1311|consensus               28.4      23  0.0005   28.1   0.5   29   34-68    113-141 (299)
121 PF11523 DUF3223:  Protein of u  28.4      32 0.00069   23.5   1.1   19   83-101    20-40  (76)
122 KOG3214|consensus               28.3      18 0.00039   27.7  -0.2   12   11-22     48-59  (109)
123 cd08430 PBP2_IlvY The C-termin  28.2      39 0.00085   21.8   1.4   20   81-100    14-33  (199)
124 cd08471 PBP2_CrgA_like_2 The C  28.1      40 0.00086   21.9   1.5   18   83-100    17-34  (201)
125 PF13719 zinc_ribbon_5:  zinc-r  27.9      19 0.00041   21.4  -0.1   27   36-62      4-33  (37)
126 PF14260 zf-C4pol:  C4-type zin  27.9      40 0.00088   21.7   1.5   20   13-33      1-20  (73)
127 PF15379 DUF4606:  Domain of un  27.8      30 0.00065   26.2   0.9   37   48-86     25-62  (104)
128 cd08448 PBP2_LTTR_aromatics_li  27.7      43 0.00093   21.5   1.5   20   80-99     13-32  (197)
129 PF05605 zf-Di19:  Drought indu  27.5      19 0.00041   22.4  -0.2   37   11-62      3-39  (54)
130 cd08450 PBP2_HcaR The C-termin  27.4      41 0.00088   21.8   1.4   22   79-100    12-33  (196)
131 cd08452 PBP2_AlsR The C-termin  27.3      41 0.00089   22.3   1.5   17   83-99     16-32  (197)
132 KOG4477|consensus               27.3      24 0.00053   29.7   0.4   14   48-61     18-31  (228)
133 cd08451 PBP2_BudR The C-termin  27.1      42 0.00091   21.7   1.4   20   81-100    15-34  (199)
134 PF09963 DUF2197:  Uncharacteri  27.1      21 0.00045   24.2  -0.0   15   12-26      4-18  (56)
135 cd08431 PBP2_HupR The C-termin  27.0      45 0.00098   21.7   1.6   20   81-100    14-33  (195)
136 PF09723 Zn-ribbon_8:  Zinc rib  26.9      15 0.00032   22.3  -0.7   32   36-67      7-39  (42)
137 smart00132 LIM Zinc-binding do  26.7      24 0.00052   18.8   0.2   14   52-65     25-38  (39)
138 KOG4443|consensus               26.6      22 0.00047   34.1  -0.0   55    7-61    142-200 (694)
139 cd00021 BBOX B-Box-type zinc f  26.3      23  0.0005   19.6   0.1   20   24-43     10-29  (39)
140 PF05191 ADK_lid:  Adenylate ki  26.1      20 0.00043   21.7  -0.2   16   52-67     19-34  (36)
141 PF14447 Prok-RING_4:  Prokaryo  26.0      38 0.00082   23.0   1.1   21    6-26     35-55  (55)
142 PLN02638 cellulose synthase A   25.9      31 0.00067   34.4   0.9   49   11-64     18-69  (1079)
143 PF09082 DUF1922:  Domain of un  25.9      62  0.0013   22.8   2.2   56   39-104     7-64  (68)
144 PF08274 PhnA_Zn_Ribbon:  PhnA   25.0      30 0.00066   20.6   0.4   24   36-62      4-27  (30)
145 PRK14554 putative pseudouridyl  24.7      46   0.001   29.6   1.7   49   43-102   197-245 (422)
146 PF13834 DUF4193:  Domain of un  24.5      21 0.00045   26.7  -0.4    9   33-41     91-99  (99)
147 TIGR00155 pqiA_fam integral me  24.5      39 0.00084   29.2   1.1   33   36-68     15-47  (403)
148 KOG1571|consensus               24.4      26 0.00056   31.1   0.1   44   10-67    305-349 (355)
149 cd08437 PBP2_MleR The substrat  24.4      48  0.0011   21.7   1.4   20   81-100    14-33  (198)
150 smart00868 zf-AD Zinc-finger a  24.3      31 0.00068   19.8   0.4   10   12-21      1-10  (73)
151 PRK14298 chaperone protein Dna  24.1      39 0.00085   28.5   1.1   47    9-61    140-205 (377)
152 COG1813 Predicted transcriptio  24.0      38 0.00083   27.0   0.9   40   11-51      4-43  (165)
153 cd08427 PBP2_LTTR_like_2 The C  23.8      54  0.0012   21.1   1.5   20   81-100    14-33  (195)
154 COG3880 Modulator of heat shoc  23.7      29 0.00064   28.3   0.3    9   35-43     27-35  (176)
155 PRK14282 chaperone protein Dna  23.6      37  0.0008   28.4   0.8   49    8-62    150-217 (369)
156 PRK12268 methionyl-tRNA synthe  23.6      35 0.00077   29.3   0.7   46   12-57    127-177 (556)
157 cd08478 PBP2_CrgA The C-termin  23.5      53  0.0011   21.5   1.4   18   83-100    19-36  (199)
158 PF13913 zf-C2HC_2:  zinc-finge  23.5      16 0.00036   20.3  -0.9   17   11-27      3-19  (25)
159 cd08481 PBP2_GcdR_like The C-t  23.4      45 0.00097   21.4   1.0   17   83-99     16-32  (194)
160 PF12171 zf-C2H2_jaz:  Zinc-fin  23.3      41  0.0009   18.1   0.7   13   12-24      3-15  (27)
161 cd08434 PBP2_GltC_like The sub  23.2      54  0.0012   20.9   1.4   20   81-100    14-33  (195)
162 PF13240 zinc_ribbon_2:  zinc-r  23.2      46   0.001   18.4   0.9   20   13-34      2-21  (23)
163 TIGR03290 CoB_CoM_SS_C CoB--Co  23.1      34 0.00074   24.7   0.5   13   50-62     41-53  (144)
164 COG4068 Uncharacterized protei  22.8      37 0.00081   24.0   0.6   18   11-30      9-26  (64)
165 PRK11595 DNA utilization prote  22.6      51  0.0011   25.5   1.4   30   11-41      6-41  (227)
166 PRK08359 transcription factor;  22.5      25 0.00054   27.9  -0.3   34   11-45      7-42  (176)
167 TIGR00398 metG methionyl-tRNA   22.2      35 0.00077   29.1   0.5   50   13-65    123-177 (530)
168 PF10367 Vps39_2:  Vacuolar sor  22.0      32 0.00069   22.3   0.1   31    9-41     77-107 (109)
169 cd08476 PBP2_CrgA_like_7 The C  21.6      62  0.0014   20.7   1.4   18   83-100    15-32  (197)
170 cd08449 PBP2_XapR The C-termin  21.5      61  0.0013   20.9   1.4   20   81-100    14-33  (197)
171 PF05502 Dynactin_p62:  Dynacti  21.4      38 0.00083   30.0   0.5   45   26-70      5-68  (483)
172 KOG3576|consensus               21.1      29 0.00063   29.9  -0.3  110    8-124   115-246 (267)
173 PF06943 zf-LSD1:  LSD1 zinc fi  21.1      38 0.00083   19.7   0.3   12   50-61     12-23  (25)
174 cd08470 PBP2_CrgA_like_1 The C  21.0      64  0.0014   21.0   1.4   19   82-100    16-34  (197)
175 KOG2041|consensus               20.9      72  0.0016   32.1   2.3   56    4-65   1111-1167(1189)
176 PLN02195 cellulose synthase A   20.9      40 0.00087   33.3   0.6   51   10-65      6-59  (977)
177 cd08444 PBP2_Cbl The C-termina  20.8      64  0.0014   21.4   1.4   20   81-100    14-33  (198)
178 PF15261 DUF4591:  Domain of un  20.4      79  0.0017   24.0   2.0   21   75-95    100-120 (134)
179 PF00641 zf-RanBP:  Zn-finger i  20.4      55  0.0012   18.2   0.9   10   53-62      3-12  (30)
180 PF04640 PLATZ:  PLATZ transcri  20.2      73  0.0016   22.2   1.6   27    2-30     41-67  (72)
181 PF00130 C1_1:  Phorbol esters/  20.2      58  0.0013   19.4   1.0   34    8-41      9-43  (53)
182 cd00729 rubredoxin_SM Rubredox  20.1      41  0.0009   19.9   0.3    9   13-21      5-13  (34)
183 PF01586 Basic:  Myogenic Basic  20.1      32 0.00069   24.9  -0.2   12   54-65     72-83  (86)
184 PLN02400 cellulose synthase     20.1      46 0.00099   33.3   0.8   49   10-63     36-87  (1085)
185 PLN02569 threonine synthase     20.1      45 0.00097   29.5   0.7   23   10-33     49-71  (484)
186 PF06827 zf-FPG_IleRS:  Zinc fi  20.0      28  0.0006   19.4  -0.4   22   12-33      3-28  (30)

No 1  
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=97.89  E-value=5.3e-06  Score=59.15  Aligned_cols=54  Identities=33%  Similarity=0.823  Sum_probs=41.7

Q ss_pred             CCCchhhccccCCCC-ccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         10 LGNCRVCLKSFKPDD-YSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        10 ~g~CRVClKsfkP~e-~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      ...|-.|.+.|..-. ..+.|.+|+++||-.|..|++     ....|.|.+|......+.
T Consensus        54 ~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~~~-----~~~~WlC~vC~k~rel~~  108 (118)
T PF02318_consen   54 ERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVYSK-----KEPIWLCKVCQKQRELKK  108 (118)
T ss_dssp             CSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEETS-----SSCCEEEHHHHHHHHHHH
T ss_pred             CcchhhhCCcccccCCCCCcCCcCCccccCccCCcCC-----CCCCEEChhhHHHHHHHH
Confidence            347999999987553 579999999999999999932     356899999998765443


No 2  
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=96.40  E-value=0.0011  Score=42.33  Aligned_cols=61  Identities=30%  Similarity=0.544  Sum_probs=37.9

Q ss_pred             CCCCCCCCchhhccccCCCCccchhhhhhhhhhcccccccCCCC----CCCCCceeehhhhhhhh
Q psy15639          5 KPAARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDE----NQDENTWRCSICRRKLQ   65 (135)
Q Consensus         5 kp~~r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~----~ed~~~WrCSvCRRK~~   65 (135)
                      +|......|.+|.|.|.--.-.|.|--|.+.||.+|.++.....    ......--|..|-.+++
T Consensus         4 ~~d~~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~Cs~~~~~~~~~~~~~~~~~RvC~~C~~~~~   68 (69)
T PF01363_consen    4 VPDSEASNCMICGKKFSLFRRRHHCRNCGRVVCSSCSSQRIPLPTPSSGSGEPVRVCDSCYSKLQ   68 (69)
T ss_dssp             SSGGG-SB-TTT--B-BSSS-EEE-TTT--EEECCCS-EEEEET--GGTESEEEEE-HHHHHHHH
T ss_pred             CCCCCCCcCcCcCCcCCCceeeEccCCCCCEECCchhCCEEcccccccCCCCcCEECHHHHHHhc
Confidence            45667889999999998888889999999999999999876533    44445566777766654


No 3  
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=95.73  E-value=0.0026  Score=38.33  Aligned_cols=50  Identities=26%  Similarity=0.591  Sum_probs=42.1

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhh
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRK   63 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK   63 (135)
                      |.||.+ ...++..-.|..|.+-+=..|..++..........|.|..|++|
T Consensus         2 C~vC~~-~~~~~~~i~C~~C~~~~H~~C~~~~~~~~~~~~~~w~C~~C~~~   51 (51)
T PF00628_consen    2 CPVCGQ-SDDDGDMIQCDSCNRWYHQECVGPPEKAEEIPSGDWYCPNCRPK   51 (51)
T ss_dssp             BTTTTS-SCTTSSEEEBSTTSCEEETTTSTSSHSHHSHHSSSBSSHHHHHC
T ss_pred             CcCCCC-cCCCCCeEEcCCCChhhCcccCCCChhhccCCCCcEECcCCcCc
Confidence            789998 67777788899999888889999988766665669999999986


No 4  
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=94.81  E-value=0.0023  Score=37.99  Aligned_cols=44  Identities=20%  Similarity=0.519  Sum_probs=32.3

Q ss_pred             CCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICR   61 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCR   61 (135)
                      +.|-||+..|.+++...... |.|..|.+|..---..+      .+|.+||
T Consensus         1 d~C~IC~~~~~~~~~~~~l~-C~H~fh~~Ci~~~~~~~------~~CP~CR   44 (44)
T PF13639_consen    1 DECPICLEEFEDGEKVVKLP-CGHVFHRSCIKEWLKRN------NSCPVCR   44 (44)
T ss_dssp             -CETTTTCBHHTTSCEEEET-TSEEEEHHHHHHHHHHS------SB-TTTH
T ss_pred             CCCcCCChhhcCCCeEEEcc-CCCeeCHHHHHHHHHhC------CcCCccC
Confidence            46999999999888777777 99999999964322111      2899987


No 5  
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=94.80  E-value=0.0035  Score=38.23  Aligned_cols=45  Identities=27%  Similarity=0.720  Sum_probs=33.2

Q ss_pred             CCchhhccccCCCCccchhhhhhhh-hhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQK-VCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqk-VCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      ..|.||+..++.    .+-..|.|. +|.+|+.-...      +..+|.+||+++.
T Consensus         3 ~~C~iC~~~~~~----~~~~pCgH~~~C~~C~~~~~~------~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    3 EECPICFENPRD----VVLLPCGHLCFCEECAERLLK------RKKKCPICRQPIE   48 (50)
T ss_dssp             SB-TTTSSSBSS----EEEETTCEEEEEHHHHHHHHH------TTSBBTTTTBB-S
T ss_pred             CCCccCCccCCc----eEEeCCCChHHHHHHhHHhcc------cCCCCCcCChhhc
Confidence            579999997543    455679999 99999865433      6789999998875


No 6  
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=94.63  E-value=0.025  Score=34.55  Aligned_cols=51  Identities=22%  Similarity=0.481  Sum_probs=39.5

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhhcccccccCCCCC--CCCCceeehhh
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDEN--QDENTWRCSIC   60 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~--ed~~~WrCSvC   60 (135)
                      ...|.+|.|.|..-.-.+.|.-|...+|.+|+.+-..-..  ......-|..|
T Consensus         2 ~~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~C~~~~~~~~~~~~~~~~rvC~~C   54 (57)
T cd00065           2 ASSCMGCGKPFTLTRRRHHCRNCGRIFCSKCSSNRIPLPSMGGGKPVRVCDSC   54 (57)
T ss_pred             cCcCcccCccccCCccccccCcCcCCcChHHcCCeeecCcccCCCccEeChHH
Confidence            3579999999999888999999999999999998755332  22344556555


No 7  
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG2177|consensus
Probab=93.54  E-value=0.034  Score=38.20  Aligned_cols=43  Identities=28%  Similarity=0.708  Sum_probs=36.3

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhh
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      .-.|.||+--|+.-    +...|.|.+|..|.-..-.      ...+|.+||.
T Consensus        13 ~~~C~iC~~~~~~p----~~l~C~H~~c~~C~~~~~~------~~~~Cp~cr~   55 (386)
T KOG2177|consen   13 ELTCPICLEYFREP----VLLPCGHNFCRACLTRSWE------GPLSCPVCRP   55 (386)
T ss_pred             cccChhhHHHhhcC----ccccccchHhHHHHHHhcC------CCcCCcccCC
Confidence            45799999999876    7788999999999877665      5599999993


No 9  
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF14634 zf-RING_5:  zinc-RING finger domain
Probab=93.07  E-value=0.026  Score=33.95  Aligned_cols=43  Identities=28%  Similarity=0.859  Sum_probs=32.8

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhh
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      |.||.+.|.+++...+ -.|.|..|+.|+.-..      ...-.|.+||+
T Consensus         2 C~~C~~~~~~~~~~~l-~~CgH~~C~~C~~~~~------~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRL-TSCGHIFCEKCLKKLK------GKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEE-cccCCHHHHHHHHhhc------CCCCCCcCCCC
Confidence            8899999955544333 6899999999998776      45567888874


No 11 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=91.64  E-value=0.019  Score=31.48  Aligned_cols=44  Identities=25%  Similarity=0.668  Sum_probs=29.7

Q ss_pred             CchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhh
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRK   63 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK   63 (135)
                      .|.||+..|  .+. .+-..|.|..|.+|.......     ...+|.+|+..
T Consensus         1 ~C~iC~~~~--~~~-~~~~~C~H~~c~~C~~~~~~~-----~~~~Cp~C~~~   44 (45)
T cd00162           1 ECPICLEEF--REP-VVLLPCGHVFCRSCIDKWLKS-----GKNTCPLCRTP   44 (45)
T ss_pred             CCCcCchhh--hCc-eEecCCCChhcHHHHHHHHHh-----CcCCCCCCCCc
Confidence            488999888  222 233459999999998532211     46789999864


No 12 
>KOG3799|consensus
Probab=91.60  E-value=0.082  Score=42.52  Aligned_cols=53  Identities=26%  Similarity=0.738  Sum_probs=45.4

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhh
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKL   64 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~   64 (135)
                      .-.|-||.|.=-+|-.-|+|.-|+-+.|--|..--.+-.+  --.|-|+.|+...
T Consensus        65 datC~IC~KTKFADG~GH~C~YCq~r~CARCGGrv~lrsN--Kv~wvcnlc~k~q  117 (169)
T KOG3799|consen   65 DATCGICHKTKFADGCGHNCSYCQTRFCARCGGRVSLRSN--KVMWVCNLCRKQQ  117 (169)
T ss_pred             CcchhhhhhcccccccCcccchhhhhHHHhcCCeeeeccC--ceEEeccCCcHHH
Confidence            4579999999889999999999999999999887666543  6789999998753


No 13 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=84.87  E-value=0.26  Score=27.97  Aligned_cols=29  Identities=31%  Similarity=0.730  Sum_probs=13.3

Q ss_pred             CchhhccccCCCCccchhhhhhhhhhcccc
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQKVCEDCA   41 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqqkVCEDCA   41 (135)
                      .|.+|.+.... ++...|.+|+--+.+.||
T Consensus         2 ~C~~C~~~~~~-~~~Y~C~~Cdf~lH~~Ca   30 (30)
T PF07649_consen    2 RCDACGKPIDG-GWFYRCSECDFDLHEECA   30 (30)
T ss_dssp             --TTTS----S---EEE-TTT-----HHHH
T ss_pred             cCCcCCCcCCC-CceEECccCCCccChhcC
Confidence            58999999888 889999999988888876


No 14 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=82.24  E-value=0.31  Score=39.37  Aligned_cols=52  Identities=17%  Similarity=0.452  Sum_probs=35.7

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhhccccccc-C------CCC---CCCCCceeehhhhhhhh
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYS-K------LDE---NQDENTWRCSICRRKLQ   65 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYS-k------l~~---~ed~~~WrCSvCRRK~~   65 (135)
                      .-.|.||+..|+  +...  ..|.|..|..|.... .      ...   ....+..+|.+||.++.
T Consensus        18 ~~~CpICld~~~--dPVv--T~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is   79 (193)
T PLN03208         18 DFDCNICLDQVR--DPVV--TLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVS   79 (193)
T ss_pred             ccCCccCCCcCC--CcEE--cCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCC
Confidence            357999999875  4444  379999999998521 1      000   11345689999999874


No 15 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=81.17  E-value=0.5  Score=31.72  Aligned_cols=31  Identities=26%  Similarity=0.594  Sum_probs=26.7

Q ss_pred             hhhccccCCCCccchhhhhhh----hhhccccccc
Q psy15639         14 RVCLKSFKPDDYSRVCYECHQ----KVCEDCASYS   44 (135)
Q Consensus        14 RVClKsfkP~e~~~tC~eCqq----kVCEDCASYS   44 (135)
                      .+|.+.|+.+|+...|..|+.    .+|.+|+--+
T Consensus         1 ~~C~~~~~~~~~~y~C~tC~~~~~~~iC~~Cf~~~   35 (71)
T smart00396        1 DVCTYKFTGGEVIYRCKTCGLDPTCVLCSDCFRSN   35 (71)
T ss_pred             CCCCCccCCCCEEEECcCCCCCCCEeEChHHCCCC
Confidence            379999999999999999985    6899998633


No 16 
>PHA02929 N1R/p28-like protein; Provisional
Probab=80.97  E-value=0.4  Score=39.28  Aligned_cols=52  Identities=19%  Similarity=0.586  Sum_probs=36.9

Q ss_pred             CCCCchhhccccCCCCcc----chhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhc
Q psy15639          9 RLGNCRVCLKSFKPDDYS----RVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQS   66 (135)
Q Consensus         9 r~g~CRVClKsfkP~e~~----~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~s   66 (135)
                      ....|-||+-.|...++.    .+=..|+|..|.+|-.--...      .=+|.+||..+++
T Consensus       173 ~~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~------~~tCPlCR~~~~~  228 (238)
T PHA02929        173 KDKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKE------KNTCPVCRTPFIS  228 (238)
T ss_pred             CCCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhc------CCCCCCCCCEeeE
Confidence            357899999988755532    234589999999998543211      2279999998764


No 17 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=78.63  E-value=0.84  Score=30.70  Aligned_cols=32  Identities=41%  Similarity=0.644  Sum_probs=25.4

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhhcccc
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVCEDCA   41 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCA   41 (135)
                      ...|-+|+|-|+++|---+|.+|.--.=-+|+
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            46799999999999999999999744433443


No 18 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=76.33  E-value=0.99  Score=26.36  Aligned_cols=10  Identities=30%  Similarity=1.228  Sum_probs=8.0

Q ss_pred             Cceeehhhhh
Q psy15639         53 NTWRCSICRR   62 (135)
Q Consensus        53 ~~WrCSvCRR   62 (135)
                      ..|+|.+|+.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            6788888875


No 19 
>KOG1729|consensus
Probab=72.34  E-value=4.1  Score=34.35  Aligned_cols=62  Identities=24%  Similarity=0.520  Sum_probs=50.1

Q ss_pred             CCCCCCCCchhhcc-ccCCCCccchhhhhhhhhhcccccc-cCCCCCCCCCceeehhhhhhhhc
Q psy15639          5 KPAARLGNCRVCLK-SFKPDDYSRVCYECHQKVCEDCASY-SKLDENQDENTWRCSICRRKLQS   66 (135)
Q Consensus         5 kp~~r~g~CRVClK-sfkP~e~~~tC~eCqqkVCEDCASY-Skl~~~ed~~~WrCSvCRRK~~s   66 (135)
                      .|.+.+--|++|.| -|..-+=-|.|..|..-||.-|.+- --++...+...--|+.|=..|+.
T Consensus       163 ~PD~ea~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~~Cs~n~~~l~~~~~k~~rvC~~CF~el~~  226 (288)
T KOG1729|consen  163 LPDSEATECMVCGCTEFTLSERRHHCRNCGDIVCAPCSRNRFLLPNLSTKPIRVCDICFEELEK  226 (288)
T ss_pred             cCcccceecccCCCccccHHHHHHHHHhcchHhhhhhhcCcccccccCCCCceecHHHHHHHhc
Confidence            57778889999999 7888888899999999999999876 23444444555589999999975


No 20 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=72.25  E-value=0.85  Score=26.11  Aligned_cols=28  Identities=29%  Similarity=0.855  Sum_probs=21.8

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccccc
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCASY   43 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCASY   43 (135)
                      |.||+..|....   +=..|.|.+|.+|..-
T Consensus         1 C~iC~~~~~~~~---~~~~C~H~fC~~C~~~   28 (41)
T PF00097_consen    1 CPICLEPFEDPV---ILLPCGHSFCRDCLRK   28 (41)
T ss_dssp             ETTTSSBCSSEE---EETTTSEEEEHHHHHH
T ss_pred             CCcCCccccCCC---EEecCCCcchHHHHHH
Confidence            778888776655   5578999999999753


No 21 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=71.96  E-value=0.5  Score=27.47  Aligned_cols=39  Identities=23%  Similarity=0.750  Sum_probs=25.5

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhh
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSIC   60 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvC   60 (135)
                      |.||.+.+.-   ..+-..|.|..|.+|+.-....+      .+|.+|
T Consensus         1 C~iC~~~~~~---~~~~~~CGH~fC~~C~~~~~~~~------~~CP~C   39 (39)
T PF13923_consen    1 CPICLDELRD---PVVVTPCGHSFCKECIEKYLEKN------PKCPVC   39 (39)
T ss_dssp             ETTTTSB-SS---EEEECTTSEEEEHHHHHHHHHCT------SB-TTT
T ss_pred             CCCCCCcccC---cCEECCCCCchhHHHHHHHHHCc------CCCcCC
Confidence            6788876654   33578899999999976443221      577665


No 22 
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=71.20  E-value=2.8  Score=29.23  Aligned_cols=51  Identities=24%  Similarity=0.679  Sum_probs=37.1

Q ss_pred             CCchhhcccc----CCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhh
Q psy15639         11 GNCRVCLKSF----KPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        11 g~CRVClKsf----kP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      ..|.+|....    |----+.+|-+|++.||--|. ++-.++-.+-..|-|=-|.-
T Consensus         3 ~~CPlCkt~~n~gsk~~pNyntCT~Ck~~VCnlCG-FNP~Phl~E~~eWLCLnCQ~   57 (61)
T PF05715_consen    3 SLCPLCKTTLNVGSKDPPNYNTCTECKSQVCNLCG-FNPTPHLTEVKEWLCLNCQM   57 (61)
T ss_pred             ccCCcccchhhcCCCCCCCccHHHHHhhhhhcccC-CCCCccccccceeeeecchh
Confidence            4577776543    211135799999999999995 56667766789999988864


No 23 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=71.09  E-value=1.7  Score=26.34  Aligned_cols=28  Identities=29%  Similarity=0.746  Sum_probs=14.4

Q ss_pred             hhcccccccCCCC--CCCCCceeehhhhhh
Q psy15639         36 VCEDCASYSKLDE--NQDENTWRCSICRRK   63 (135)
Q Consensus        36 VCEDCASYSkl~~--~ed~~~WrCSvCRRK   63 (135)
                      .|..|.+|--.--  +++..+|+|..|..+
T Consensus         4 rC~~C~aylNp~~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen    4 RCRRCRAYLNPFCQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             B-TTT--BS-TTSEEETTTTEEEETTT--E
T ss_pred             ccCCCCCEECCcceEcCCCCEEECcCCCCc
Confidence            4667777654332  234679999999864


No 24 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=70.45  E-value=2.4  Score=31.87  Aligned_cols=37  Identities=24%  Similarity=0.538  Sum_probs=28.9

Q ss_pred             CCCCchhhccccCCC----------CccchhhhhhhhhhcccccccC
Q psy15639          9 RLGNCRVCLKSFKPD----------DYSRVCYECHQKVCEDCASYSK   45 (135)
Q Consensus         9 r~g~CRVClKsfkP~----------e~~~tC~eCqqkVCEDCASYSk   45 (135)
                      +...|.-|++.|...          .--..|..|+|..|.||-.|--
T Consensus        54 ~~~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiH  100 (112)
T TIGR00622        54 GSRFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDVFVH  100 (112)
T ss_pred             CCCcccCcCCCCCCcccccccccccccceeCCCCCCccccccchhhh
Confidence            445799999999642          2235699999999999998853


No 25 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=68.85  E-value=1  Score=32.18  Aligned_cols=23  Identities=35%  Similarity=0.948  Sum_probs=17.0

Q ss_pred             CCchhhccccCCCCccchhhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECH   33 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCq   33 (135)
                      ..|+.|++-|.++++...|..|+
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cg   93 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFDFSCPRCG   93 (113)
T ss_dssp             EEETTTS-EEECHHCCHH-SSSS
T ss_pred             EECCCCCCEEecCCCCCCCcCCc
Confidence            46999999999999986655554


No 26 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=68.71  E-value=1  Score=23.57  Aligned_cols=14  Identities=29%  Similarity=0.878  Sum_probs=11.7

Q ss_pred             eeehhhhhhhhccc
Q psy15639         55 WRCSICRRKLQSRA   68 (135)
Q Consensus        55 WrCSvCRRK~~sr~   68 (135)
                      |.|++|.+.+.+..
T Consensus         1 ~~C~~C~~~f~s~~   14 (25)
T PF12874_consen    1 FYCDICNKSFSSEN   14 (25)
T ss_dssp             EEETTTTEEESSHH
T ss_pred             CCCCCCCCCcCCHH
Confidence            89999998887764


No 27 
>PF10497 zf-4CXXC_R1:  Zinc-finger domain of monoamine-oxidase A repressor R1;  InterPro: IPR018866  R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression. This domain is a four-CXXC zinc finger putative DNA-binding domain found at the C-terminal end of R1. The domain carries 12 cysteines of which four pairs are of the CXXC type []. 
Probab=66.86  E-value=1.7  Score=31.33  Aligned_cols=52  Identities=27%  Similarity=0.797  Sum_probs=32.5

Q ss_pred             CCCCchhhccccCCCCccchh------hhh---hhhhhccccc--ccCC-CCCCCCCceeehhhhh
Q psy15639          9 RLGNCRVCLKSFKPDDYSRVC------YEC---HQKVCEDCAS--YSKL-DENQDENTWRCSICRR   62 (135)
Q Consensus         9 r~g~CRVClKsfkP~e~~~tC------~eC---qqkVCEDCAS--YSkl-~~~ed~~~WrCSvCRR   62 (135)
                      .+..|-.|++--  -++..+|      ..|   .-+.|.+|-.  |... .+--....|.|..||-
T Consensus         6 ~g~~CHqCrqKt--~~~~~~C~~~~~~~~C~~~~~~fC~~CL~~ryge~~~ev~~~~~W~CP~Crg   69 (105)
T PF10497_consen    6 NGKTCHQCRQKT--LDFKTICTGHWKNSSCRGCRGKFCGGCLRNRYGENVEEVLEDPNWKCPKCRG   69 (105)
T ss_pred             CCCCchhhcCCC--CCCceEcCCCCCCCCCccCcceehHhHHHHHHhhhHHHHhcCCceECCCCCC
Confidence            456788898733  3666677      777   8889999932  3321 1222345799876653


No 28 
>KOG0320|consensus
Probab=66.38  E-value=1.2  Score=36.47  Aligned_cols=50  Identities=26%  Similarity=0.636  Sum_probs=38.1

Q ss_pred             CCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      -.|.||+-+|.-...+-  .+|.|..|--|+--.-      .++-.|.+||.|+--+.
T Consensus       132 ~~CPiCl~~~sek~~vs--TkCGHvFC~~Cik~al------k~~~~CP~C~kkIt~k~  181 (187)
T KOG0320|consen  132 YKCPICLDSVSEKVPVS--TKCGHVFCSQCIKDAL------KNTNKCPTCRKKITHKQ  181 (187)
T ss_pred             cCCCceecchhhccccc--cccchhHHHHHHHHHH------HhCCCCCCcccccchhh
Confidence            57999999998777533  4899999999985432      34568999999886543


No 29 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=66.34  E-value=2.3  Score=30.66  Aligned_cols=23  Identities=26%  Similarity=0.635  Sum_probs=17.1

Q ss_pred             CCchhhccccCCCCccchhhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECH   33 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCq   33 (135)
                      ..|+.|.+-|.++++...|..|+
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cg   93 (115)
T TIGR00100        71 CECEDCSEEVSPEIDLYRCPKCH   93 (115)
T ss_pred             EEcccCCCEEecCCcCccCcCCc
Confidence            56999999999998855444443


No 30 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=66.10  E-value=2.3  Score=24.29  Aligned_cols=29  Identities=28%  Similarity=0.486  Sum_probs=21.8

Q ss_pred             CchhhccccCCCCccchhhhhhhhhhcccc
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQKVCEDCA   41 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqqkVCEDCA   41 (135)
                      .|.||+|...+.. ...|.+|.-.+--.||
T Consensus         2 ~C~~C~~~~~~~~-~Y~C~~c~f~lh~~Ca   30 (30)
T PF03107_consen    2 WCDVCRRKIDGFY-FYHCSECCFTLHVRCA   30 (30)
T ss_pred             CCCCCCCCcCCCE-eEEeCCCCCeEcCccC
Confidence            5899999888877 8889888755544443


No 31 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=65.24  E-value=6.1  Score=36.43  Aligned_cols=25  Identities=16%  Similarity=0.292  Sum_probs=20.8

Q ss_pred             Cceeehhhhhhhhcccccccccccc
Q psy15639         53 NTWRCSICRRKLQSRAQPVLSQNST   77 (135)
Q Consensus        53 ~~WrCSvCRRK~~sr~qp~~~q~st   77 (135)
                      +.=.|..|+.++..+-+-+|++...
T Consensus        40 ~~~fC~~CG~~~~~~~~~~~~~~~~   64 (645)
T PRK14559         40 DEAHCPNCGAETGTIWWAIIAQASP   64 (645)
T ss_pred             ccccccccCCcccchhhhhcccccc
Confidence            3447999999999999999998743


No 32 
>smart00336 BBOX B-Box-type zinc finger.
Probab=65.05  E-value=2.8  Score=23.62  Aligned_cols=30  Identities=20%  Similarity=0.466  Sum_probs=21.0

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhhcccccc
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASY   43 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASY   43 (135)
                      ...|+.+.+    +.....|.+|+..+|..|..-
T Consensus         3 ~~~C~~h~~----~~~~~~C~~c~~~iC~~C~~~   32 (42)
T smart00336        3 PPKCDSHGD----EPAEFFCEECGALLCRTCDEA   32 (42)
T ss_pred             CCcCCCCCC----CceEEECCCCCcccccccChh
Confidence            445655543    334567999999999999854


No 33 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=63.27  E-value=2.4  Score=27.23  Aligned_cols=13  Identities=23%  Similarity=0.915  Sum_probs=7.6

Q ss_pred             CCCCceeehhhhh
Q psy15639         50 QDENTWRCSICRR   62 (135)
Q Consensus        50 ed~~~WrCSvCRR   62 (135)
                      +-+..|+|.+|+.
T Consensus        30 ~Lp~~w~CP~C~a   42 (47)
T PF00301_consen   30 DLPDDWVCPVCGA   42 (47)
T ss_dssp             GS-TT-B-TTTSS
T ss_pred             HCCCCCcCcCCCC
Confidence            3467899999974


No 34 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=63.23  E-value=2.8  Score=30.20  Aligned_cols=23  Identities=22%  Similarity=0.527  Sum_probs=17.9

Q ss_pred             CCchhhccccCCCCccchhhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECH   33 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCq   33 (135)
                      ..|+.|.+-|.++++...|..|+
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cg   93 (113)
T PRK12380         71 AWCWDCSQVVEIHQHDAQCPHCH   93 (113)
T ss_pred             EEcccCCCEEecCCcCccCcCCC
Confidence            46999999999988777666554


No 35 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=63.22  E-value=3.7  Score=36.69  Aligned_cols=59  Identities=22%  Similarity=0.486  Sum_probs=41.7

Q ss_pred             hhhhcccccccCCCCCCCCCceeehhhhhhhhccccccccccccccccchHHHHHHHhhccccccc
Q psy15639         34 QKVCEDCASYSKLDENQDENTWRCSICRRKLQSRAQPVLSQNSTDSLLDVPVLEALQRRHSDVKIG   99 (135)
Q Consensus        34 qkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~qp~~~q~stds~l~vpvlealqrrhsd~klg   99 (135)
                      .-+|..|----|   +---+-|||.-|++++.+....-++-+-.--+ |||.-.   |||=-.-|+
T Consensus       350 ~p~Cp~Cg~~m~---S~G~~g~rC~kCg~~~~~~~~~~v~r~l~~g~-evp~~a---rRHLskP~~  408 (421)
T COG1571         350 NPVCPRCGGRMK---SAGRNGFRCKKCGTRARETLIKEVPRDLEPGV-EVPPVA---RRHLSKPLV  408 (421)
T ss_pred             CCCCCccCCchh---hcCCCCcccccccccCCcccccccccccCCCC-cCCchh---hhhccCCcc
Confidence            346777754333   33344899999999999988777777777777 999854   688544443


No 36 
>PF12773 DZR:  Double zinc ribbon
Probab=60.48  E-value=4.6  Score=24.29  Aligned_cols=42  Identities=19%  Similarity=0.461  Sum_probs=24.4

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhcc
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSR   67 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr   67 (135)
                      |..|.+.+.++  .+.|..|...+        .   .++...+.|+.|+..+...
T Consensus         1 Cp~Cg~~~~~~--~~fC~~CG~~l--------~---~~~~~~~~C~~Cg~~~~~~   42 (50)
T PF12773_consen    1 CPHCGTPNPDD--AKFCPHCGTPL--------P---PPDQSKKICPNCGAENPPN   42 (50)
T ss_pred             CCCcCCcCCcc--ccCChhhcCCh--------h---hccCCCCCCcCCcCCCcCC
Confidence            45566655544  34455554432        2   4557788888888865443


No 37 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=60.18  E-value=5  Score=24.01  Aligned_cols=29  Identities=17%  Similarity=0.526  Sum_probs=19.0

Q ss_pred             hhcccccccCCCCCCCCCceeehhhhhhh
Q psy15639         36 VCEDCASYSKLDENQDENTWRCSICRRKL   64 (135)
Q Consensus        36 VCEDCASYSkl~~~ed~~~WrCSvCRRK~   64 (135)
                      .|.+|.+.-...+.++.+.|.|+.|+...
T Consensus         2 FCp~Cg~~l~~~~~~~~~~~vC~~Cg~~~   30 (52)
T smart00661        2 FCPKCGNMLIPKEGKEKRRFVCRKCGYEE   30 (52)
T ss_pred             CCCCCCCccccccCCCCCEEECCcCCCeE
Confidence            46677665544444444589999999754


No 38 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=59.60  E-value=2.5  Score=36.32  Aligned_cols=60  Identities=22%  Similarity=0.409  Sum_probs=39.3

Q ss_pred             CCchhhccc--cCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhccccccccccccc
Q psy15639         11 GNCRVCLKS--FKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRAQPVLSQNSTD   78 (135)
Q Consensus        11 g~CRVClKs--fkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~qp~~~q~std   78 (135)
                      ..|.+|...  +.|+--..+= +|.|+.|+-|..---.     ...-.|.+|+..+..+.  +-+|.-.|
T Consensus         4 ~~CP~Ck~~~y~np~~kl~i~-~CGH~~C~sCv~~l~~-----~~~~~CP~C~~~lrk~~--fr~q~F~D   65 (309)
T TIGR00570         4 QGCPRCKTTKYRNPSLKLMVN-VCGHTLCESCVDLLFV-----RGSGSCPECDTPLRKNN--FRVQLFED   65 (309)
T ss_pred             CCCCcCCCCCccCcccccccC-CCCCcccHHHHHHHhc-----CCCCCCCCCCCccchhh--cccccccc
Confidence            369999984  7777433333 8999999999764311     11238999998777665  44444334


No 39 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=59.46  E-value=7.1  Score=39.07  Aligned_cols=56  Identities=21%  Similarity=0.553  Sum_probs=39.6

Q ss_pred             CCCchhhccccCCC-----CccchhhhhhhhhhcccccccC------CC--CCCC--CCceeehhhhhhhh
Q psy15639         10 LGNCRVCLKSFKPD-----DYSRVCYECHQKVCEDCASYSK------LD--ENQD--ENTWRCSICRRKLQ   65 (135)
Q Consensus        10 ~g~CRVClKsfkP~-----e~~~tC~eCqqkVCEDCASYSk------l~--~~ed--~~~WrCSvCRRK~~   65 (135)
                      +..|-.|.+.|-..     --.|-|--|.+.||..|.++..      +.  +..+  +..-.|..|=+++.
T Consensus       460 SdtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~CSSnRs~yp~aKLpKPgsseE~ppRRVCD~CYdq~E  530 (1374)
T PTZ00303        460 SDSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCITKRAHYSFAKLAKPGSSDEAEERLVCDTCYKEYE  530 (1374)
T ss_pred             CCcccCcCCcccccccccccccccccCCccccCccccCCcccCcccccCCCCCcccccccchhHHHHHHHH
Confidence            46799999999764     3467799999999999997542      21  1111  12236999997764


No 40 
>PF13831 PHD_2:  PHD-finger; PDB: 2L43_A 2KU3_A.
Probab=58.12  E-value=3  Score=25.18  Aligned_cols=32  Identities=25%  Similarity=0.762  Sum_probs=14.9

Q ss_pred             chhhhhhhhhhcccccccCCCCCCCCCceeehhhh
Q psy15639         27 RVCYECHQKVCEDCASYSKLDENQDENTWRCSICR   61 (135)
Q Consensus        27 ~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCR   61 (135)
                      -.|..|.-.|=..|......++.+   .|.|..|+
T Consensus         5 l~C~~C~v~VH~~CYGv~~~~~~~---~W~C~~C~   36 (36)
T PF13831_consen    5 LFCDNCNVAVHQSCYGVSEVPDGD---DWLCDRCE   36 (36)
T ss_dssp             EE-SSS--EEEHHHHT-SS--SS--------HHH-
T ss_pred             EEeCCCCCcCChhhCCcccCCCCC---cEECCcCC
Confidence            357777777777888877776643   39999985


No 41 
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional
Probab=56.01  E-value=7  Score=31.04  Aligned_cols=25  Identities=36%  Similarity=0.573  Sum_probs=22.5

Q ss_pred             ccccccchHHHHHHHhhcccccccc
Q psy15639         76 STDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        76 stds~l~vpvlealqrrhsd~klg~  100 (135)
                      --|-++-.|++++|+++|++++|-.
T Consensus        16 iGD~vl~~P~l~~Lk~~~P~a~I~~   40 (352)
T PRK10422         16 HGDMLLTTPVISSLKKNYPDAKIDV   40 (352)
T ss_pred             cCceeeHHHHHHHHHHHCCCCeEEE
Confidence            3688999999999999999999964


No 42 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=55.42  E-value=5.8  Score=26.77  Aligned_cols=14  Identities=43%  Similarity=0.956  Sum_probs=11.4

Q ss_pred             CCchhhccccCCCC
Q psy15639         11 GNCRVCLKSFKPDD   24 (135)
Q Consensus        11 g~CRVClKsfkP~e   24 (135)
                      +.|.+|+|++.|++
T Consensus         4 kHC~~CG~~Ip~~~   17 (59)
T PF09889_consen    4 KHCPVCGKPIPPDE   17 (59)
T ss_pred             CcCCcCCCcCCcch
Confidence            46889999998874


No 43 
>KOG1985|consensus
Probab=55.33  E-value=4.5  Score=39.42  Aligned_cols=28  Identities=29%  Similarity=0.774  Sum_probs=20.8

Q ss_pred             hhcccccccCCCCCCCC--Cceeehhhhhh
Q psy15639         36 VCEDCASYSKLDENQDE--NTWRCSICRRK   63 (135)
Q Consensus        36 VCEDCASYSkl~~~ed~--~~WrCSvCRRK   63 (135)
                      -|+-|-+|-..--.-..  -.|||++|+|.
T Consensus       220 RCr~CRtYiNPFV~fid~gr~WrCNlC~~~  249 (887)
T KOG1985|consen  220 RCRRCRTYINPFVEFIDQGRRWRCNLCGRV  249 (887)
T ss_pred             eehhhhhhcCCeEEecCCCceeeechhhhh
Confidence            49999999765433333  48999999985


No 44 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=54.43  E-value=8.2  Score=21.92  Aligned_cols=33  Identities=27%  Similarity=0.451  Sum_probs=18.0

Q ss_pred             CCCCCchhhccccCCCCccchhhhhhhhhhccc
Q psy15639          8 ARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDC   40 (135)
Q Consensus         8 ~r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDC   40 (135)
                      .++..|.+|.+.+.-......|.+|+-.|=..|
T Consensus         9 ~~~~~C~~C~~~i~~~~~~~~C~~C~~~~H~~C   41 (49)
T smart00109        9 KKPTKCCVCRKSIWGSFQGLRCSWCKVKCHKKC   41 (49)
T ss_pred             CCCCCccccccccCcCCCCcCCCCCCchHHHHH
Confidence            345568888777763222455666654443333


No 45 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=54.12  E-value=5.9  Score=23.68  Aligned_cols=26  Identities=27%  Similarity=0.685  Sum_probs=16.7

Q ss_pred             hhhhcccccccCCCCCCCCCceeehhhh
Q psy15639         34 QKVCEDCASYSKLDENQDENTWRCSICR   61 (135)
Q Consensus        34 qkVCEDCASYSkl~~~ed~~~WrCSvCR   61 (135)
                      |.+|--|...=  .--..+.++||++|.
T Consensus         1 q~~C~~C~t~L--~yP~gA~~vrCs~C~   26 (31)
T TIGR01053         1 QVVCGGCRTLL--MYPRGASSVRCALCQ   26 (31)
T ss_pred             CcCcCCCCcEe--ecCCCCCeEECCCCC
Confidence            44566665432  233468899999996


No 46 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=53.90  E-value=5.7  Score=28.73  Aligned_cols=23  Identities=35%  Similarity=0.860  Sum_probs=16.0

Q ss_pred             CCchhhccccCCCCccch-hhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRV-CYECH   33 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~t-C~eCq   33 (135)
                      ..|+.|++-|.+.++... |..|+
T Consensus        72 ~~C~~Cg~~~~~~~~~~~~CP~Cg   95 (117)
T PRK00564         72 LECKDCSHVFKPNALDYGVCEKCH   95 (117)
T ss_pred             EEhhhCCCccccCCccCCcCcCCC
Confidence            469999999998876443 44443


No 47 
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional
Probab=53.37  E-value=6.6  Score=30.62  Aligned_cols=24  Identities=21%  Similarity=0.292  Sum_probs=21.1

Q ss_pred             cccccchHHHHHHHhhcccccccc
Q psy15639         77 TDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        77 tds~l~vpvlealqrrhsd~klg~  100 (135)
                      -|-++-.|++++|++.++|++|..
T Consensus        12 GD~v~~~p~~~~lk~~~P~a~I~~   35 (322)
T PRK10964         12 GDVLHTLPALTDAQQAIPGIQFDW   35 (322)
T ss_pred             HHHHhHHHHHHHHHHhCCCCEEEE
Confidence            467788899999999999999965


No 48 
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria.
Probab=53.08  E-value=6.3  Score=30.37  Aligned_cols=24  Identities=29%  Similarity=0.468  Sum_probs=21.3

Q ss_pred             cccccchHHHHHHHhhcccccccc
Q psy15639         77 TDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        77 tds~l~vpvlealqrrhsd~klg~  100 (135)
                      -|-++-.|++.+|.++|++++|-.
T Consensus        11 GD~vl~~p~l~~Lr~~~P~a~I~~   34 (319)
T TIGR02193        11 GDVIHTLPALTDIKRALPDVEIDW   34 (319)
T ss_pred             HHHHHHHHHHHHHHHhCCCCEEEE
Confidence            477888999999999999999865


No 49 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=52.22  E-value=3.3  Score=23.99  Aligned_cols=30  Identities=20%  Similarity=0.653  Sum_probs=21.9

Q ss_pred             CCchhhccccCCCCccchhhhhhhhhhccccccc
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYS   44 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYS   44 (135)
                      ..|..+.+    ......|.+|+..+|.+|+...
T Consensus         4 ~~C~~H~~----~~~~~~C~~C~~~~C~~C~~~~   33 (42)
T PF00643_consen    4 PKCPEHPE----EPLSLFCEDCNEPLCSECTVSG   33 (42)
T ss_dssp             SB-SSTTT----SBEEEEETTTTEEEEHHHHHTS
T ss_pred             ccCccCCc----cceEEEecCCCCccCccCCCCC
Confidence            45555543    2378899999999999998764


No 50 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=51.76  E-value=4.8  Score=26.56  Aligned_cols=32  Identities=28%  Similarity=0.706  Sum_probs=20.3

Q ss_pred             chhhccccCCCC------ccchhhhhhhhhhccccccc
Q psy15639         13 CRVCLKSFKPDD------YSRVCYECHQKVCEDCASYS   44 (135)
Q Consensus        13 CRVClKsfkP~e------~~~tC~eCqqkVCEDCASYS   44 (135)
                      |-=|++.|....      ....|..|+|-.|-||--|-
T Consensus         2 CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fi   39 (51)
T PF07975_consen    2 CFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFI   39 (51)
T ss_dssp             ETTTTEE-TTS-------EEE--TTTT--B-HHHHHTT
T ss_pred             CccCCCCCCCcccccccCCeEECCCCCCccccCcChhh
Confidence            556888888763      56899999999999998875


No 51 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=51.59  E-value=5.5  Score=30.39  Aligned_cols=24  Identities=29%  Similarity=0.629  Sum_probs=19.5

Q ss_pred             CCchhhccccCCCCccchhhhhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQK   35 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqk   35 (135)
                      ..|+.|+|-|.-. ...+|..|.++
T Consensus         4 ~nC~~CgklF~~~-~~~iCp~C~~~   27 (137)
T TIGR03826         4 ANCPKCGRLFVKT-GRDVCPSCYEE   27 (137)
T ss_pred             ccccccchhhhhc-CCccCHHHhHH
Confidence            4799999999885 66788888763


No 52 
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II.
Probab=51.56  E-value=9.4  Score=29.94  Aligned_cols=24  Identities=38%  Similarity=0.599  Sum_probs=21.7

Q ss_pred             cccccchHHHHHHHhhcccccccc
Q psy15639         77 TDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        77 tds~l~vpvlealqrrhsd~klg~  100 (135)
                      -|-++-.|++.+|+++++|++|--
T Consensus        11 GD~vl~tp~l~~Lk~~~P~a~I~~   34 (344)
T TIGR02201        11 GDMLLTTPVISSLKKNYPDAKIDV   34 (344)
T ss_pred             cceeeHHHHHHHHHHHCCCCEEEE
Confidence            578899999999999999999865


No 53 
>PF06718 DUF1203:  Protein of unknown function (DUF1203);  InterPro: IPR009593 This family consists of several hypothetical bacterial proteins of around 155 residues in length. Family members are present in Rhizobium, Agrobacterium and Streptomyces species.
Probab=51.12  E-value=7  Score=29.13  Aligned_cols=16  Identities=31%  Similarity=0.677  Sum_probs=13.7

Q ss_pred             CCchhhccccCCCCcc
Q psy15639         11 GNCRVCLKSFKPDDYS   26 (135)
Q Consensus        11 g~CRVClKsfkP~e~~   26 (135)
                      -+||+|||-..++|--
T Consensus         2 ~PcR~cL~~~~~Ge~~   17 (117)
T PF06718_consen    2 YPCRHCLRDAEPGEEL   17 (117)
T ss_pred             CCcEEecccCCCCCeE
Confidence            4799999999999853


No 54 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=49.85  E-value=7.6  Score=25.17  Aligned_cols=13  Identities=23%  Similarity=0.915  Sum_probs=10.4

Q ss_pred             CCCCceeehhhhh
Q psy15639         50 QDENTWRCSICRR   62 (135)
Q Consensus        50 ed~~~WrCSvCRR   62 (135)
                      +-+..|+|.+|+-
T Consensus        30 ~Lp~~w~CP~C~a   42 (50)
T cd00730          30 DLPDDWVCPVCGA   42 (50)
T ss_pred             HCCCCCCCCCCCC
Confidence            3477999999974


No 55 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=49.41  E-value=6  Score=20.20  Aligned_cols=11  Identities=45%  Similarity=1.044  Sum_probs=8.7

Q ss_pred             CchhhccccCC
Q psy15639         12 NCRVCLKSFKP   22 (135)
Q Consensus        12 ~CRVClKsfkP   22 (135)
                      .|.+|.|+|+-
T Consensus         2 ~C~~C~~~f~~   12 (23)
T PF00096_consen    2 KCPICGKSFSS   12 (23)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCCCCCccCC
Confidence            48899999864


No 56 
>KOG1813|consensus
Probab=49.37  E-value=6.8  Score=34.26  Aligned_cols=51  Identities=24%  Similarity=0.450  Sum_probs=37.9

Q ss_pred             CCCCCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639          8 ARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus         8 ~r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      .=+..|-||++.|.-.    +=..|.|-+|+-||+-.--      .+=+|-||.+-+-+..
T Consensus       239 ~~Pf~c~icr~~f~~p----Vvt~c~h~fc~~ca~~~~q------k~~~c~vC~~~t~g~~  289 (313)
T KOG1813|consen  239 LLPFKCFICRKYFYRP----VVTKCGHYFCEVCALKPYQ------KGEKCYVCSQQTHGSF  289 (313)
T ss_pred             cCCccccccccccccc----hhhcCCceeehhhhccccc------cCCcceeccccccccc
Confidence            3456799999999644    4467999999999974322      2246999998877766


No 57 
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional
Probab=49.26  E-value=8.1  Score=30.55  Aligned_cols=24  Identities=17%  Similarity=0.277  Sum_probs=21.5

Q ss_pred             cccccchHHHHHHHhhcccccccc
Q psy15639         77 TDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        77 tds~l~vpvlealqrrhsd~klg~  100 (135)
                      -|-++-.|++.+|++.++|++|-.
T Consensus        12 GD~il~tP~l~~Lk~~~P~a~I~~   35 (348)
T PRK10916         12 GDMMMSQSLYRTLKARYPQAIIDV   35 (348)
T ss_pred             cHHHhHHHHHHHHHHHCCCCeEEE
Confidence            478899999999999999999864


No 58 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=49.13  E-value=6  Score=24.18  Aligned_cols=24  Identities=38%  Similarity=0.987  Sum_probs=16.3

Q ss_pred             hhccccc--ccCCCCCCCCCceeehhhhh
Q psy15639         36 VCEDCAS--YSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        36 VCEDCAS--YSkl~~~ed~~~WrCSvCRR   62 (135)
                      ||..|.+  +..+..   ...|+|.-||+
T Consensus        20 ~CP~Cg~~~~~~~~~---~~~~~C~~C~~   45 (46)
T PF12760_consen   20 VCPHCGSTKHYRLKT---RGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCeeeEEeCC---CCeEECCCCCC
Confidence            4555654  344444   78999999985


No 59 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=48.30  E-value=6.1  Score=21.74  Aligned_cols=14  Identities=36%  Similarity=0.626  Sum_probs=10.9

Q ss_pred             CCCCCchhhccccC
Q psy15639          8 ARLGNCRVCLKSFK   21 (135)
Q Consensus         8 ~r~g~CRVClKsfk   21 (135)
                      .++-.|.+|.|+|+
T Consensus        12 ~k~~~C~~C~k~F~   25 (26)
T PF13465_consen   12 EKPYKCPYCGKSFS   25 (26)
T ss_dssp             SSSEEESSSSEEES
T ss_pred             CCCCCCCCCcCeeC
Confidence            35578999999985


No 60 
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=47.50  E-value=6.2  Score=30.11  Aligned_cols=34  Identities=24%  Similarity=0.600  Sum_probs=22.5

Q ss_pred             CchhhccccCCCCccch-hhhhhhhhhcccccccCC
Q psy15639         12 NCRVCLKSFKPDDYSRV-CYECHQKVCEDCASYSKL   46 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~t-C~eCqqkVCEDCASYSkl   46 (135)
                      .|-+|++-++ +...++ =.+=.-.||.+||-|-|.
T Consensus         2 ~CEiCG~~i~-~~~~~v~iega~l~vC~~C~k~G~~   36 (154)
T TIGR00270         2 NCEICGRKIK-GKGFKIVIEGSEMTVCGECRKFGKE   36 (154)
T ss_pred             ccccCCCccC-CCCeEEEEcCeEEehhhhHHhcCCc
Confidence            3899998886 332222 222335799999999883


No 61 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=47.33  E-value=7.3  Score=25.46  Aligned_cols=28  Identities=32%  Similarity=0.729  Sum_probs=19.1

Q ss_pred             hhhcccccccCCC--CCCCCCceeehhhhh
Q psy15639         35 KVCEDCASYSKLD--ENQDENTWRCSICRR   62 (135)
Q Consensus        35 kVCEDCASYSkl~--~~ed~~~WrCSvCRR   62 (135)
                      .+|.-|.+-.-+.  +.-+.-.|+|..|+-
T Consensus        23 LIC~~C~~hNGla~~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   23 LICSKCFSHNGLAPKEEFEEIQYRCPYCGA   52 (54)
T ss_pred             EECcccchhhcccccccCCceEEEcCCCCC
Confidence            4566666655555  555567999999974


No 62 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=47.26  E-value=14  Score=22.98  Aligned_cols=34  Identities=26%  Similarity=0.600  Sum_probs=27.4

Q ss_pred             CchhhccccCCCCccchhhhh-hhhhhcccccccCC
Q psy15639         12 NCRVCLKSFKPDDYSRVCYEC-HQKVCEDCASYSKL   46 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eC-qqkVCEDCASYSkl   46 (135)
                      .|..|.|.+.. .+...|.+| +-..|++|-+.-+.
T Consensus         2 ~Cd~C~~~~~~-g~r~~C~~C~d~dLC~~Cf~~g~~   36 (49)
T cd02335           2 HCDYCSKDITG-TIRIKCAECPDFDLCLECFSAGAE   36 (49)
T ss_pred             CCCCcCCCCCC-CcEEECCCCCCcchhHHhhhCcCC
Confidence            48899998863 388899999 77899999886543


No 63 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=46.41  E-value=5.5  Score=24.84  Aligned_cols=28  Identities=25%  Similarity=0.875  Sum_probs=14.0

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccc
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCA   41 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCA   41 (135)
                      |.||+. |.-++---+=--|+|-.|++|.
T Consensus         1 CpIc~e-~~~~~n~P~~L~CGH~~c~~cl   28 (43)
T PF13445_consen    1 CPICKE-FSTEENPPMVLPCGHVFCKDCL   28 (43)
T ss_dssp             -TTT-----TTSS-EEE-SSS-EEEHHHH
T ss_pred             CCcccc-ccCCCCCCEEEeCccHHHHHHH
Confidence            788988 8554443333459999999985


No 64 
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria.
Probab=45.22  E-value=9.7  Score=29.63  Aligned_cols=24  Identities=17%  Similarity=0.278  Sum_probs=21.2

Q ss_pred             cccccchHHHHHHHhhcccccccc
Q psy15639         77 TDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        77 tds~l~vpvlealqrrhsd~klg~  100 (135)
                      -|-++-.|++++|++.++|++|-.
T Consensus        11 GD~i~~~p~l~~Lk~~~P~a~I~~   34 (334)
T TIGR02195        11 GDMVMAQSLYRLLKKRYPQAVIDV   34 (334)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEE
Confidence            477888999999999999999865


No 65 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=45.07  E-value=9.3  Score=22.60  Aligned_cols=26  Identities=31%  Similarity=0.844  Sum_probs=10.4

Q ss_pred             CchhhccccCCCCccchhhhhhhhhh
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQKVC   37 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqqkVC   37 (135)
                      .|.||.+.=.--+-..+|..|+.-.|
T Consensus         2 rC~vC~~~k~rk~T~~~C~~C~v~lC   27 (32)
T PF13842_consen    2 RCKVCSKKKRRKDTRYMCSKCDVPLC   27 (32)
T ss_pred             CCeECCcCCccceeEEEccCCCCccc
Confidence            35555552222223444444443333


No 66 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=44.78  E-value=4.9  Score=35.31  Aligned_cols=50  Identities=20%  Similarity=0.448  Sum_probs=35.6

Q ss_pred             CCCCCCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhc
Q psy15639          7 AARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQS   66 (135)
Q Consensus         7 ~~r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~s   66 (135)
                      ....-.|.||+.-|+  +..  --.|.|..|..|..+--..      .-.|.+|+..+..
T Consensus        23 Le~~l~C~IC~d~~~--~Pv--itpCgH~FCs~CI~~~l~~------~~~CP~Cr~~~~~   72 (397)
T TIGR00599        23 LDTSLRCHICKDFFD--VPV--LTSCSHTFCSLCIRRCLSN------QPKCPLCRAEDQE   72 (397)
T ss_pred             cccccCCCcCchhhh--Ccc--CCCCCCchhHHHHHHHHhC------CCCCCCCCCcccc
Confidence            345568999999885  222  2589999999998753211      2379999988754


No 67 
>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion]
Probab=44.66  E-value=6.6  Score=38.22  Aligned_cols=35  Identities=31%  Similarity=0.680  Sum_probs=26.2

Q ss_pred             hhhcccccccCC--CCCCCCCceeehhhhhhhhcccc
Q psy15639         35 KVCEDCASYSKL--DENQDENTWRCSICRRKLQSRAQ   69 (135)
Q Consensus        35 kVCEDCASYSkl--~~~ed~~~WrCSvCRRK~~sr~q   69 (135)
                      --|+-|.||-..  .--++...|||.+||-|++-+..
T Consensus       200 vRCrrCrsYiNPfv~fi~~g~kw~CNiC~~kN~vp~~  236 (861)
T COG5028         200 VRCRRCRSYINPFVQFIEQGRKWRCNICRSKNDVPEG  236 (861)
T ss_pred             hhhhhhHhhcCceEEEecCCcEEEEeeccccccCccc
Confidence            468999999762  22345669999999999986653


No 68 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=44.60  E-value=12  Score=25.77  Aligned_cols=36  Identities=25%  Similarity=0.718  Sum_probs=23.9

Q ss_pred             CCchhhccccCCCC--ccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhh
Q psy15639         11 GNCRVCLKSFKPDD--YSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRK   63 (135)
Q Consensus        11 g~CRVClKsfkP~e--~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK   63 (135)
                      -.|--|..-+.|.|  +...|.+|.+                 ...|||.-||+-
T Consensus         8 ~~CtSCg~~i~~~~~~~~F~CPnCG~-----------------~~I~RC~~CRk~   45 (59)
T PRK14890          8 PKCTSCGIEIAPREKAVKFLCPNCGE-----------------VIIYRCEKCRKQ   45 (59)
T ss_pred             ccccCCCCcccCCCccCEeeCCCCCC-----------------eeEeechhHHhc
Confidence            36888888888887  4455655543                 236777777753


No 69 
>PLN02189 cellulose synthase
Probab=43.92  E-value=52  Score=32.83  Aligned_cols=50  Identities=26%  Similarity=0.678  Sum_probs=41.1

Q ss_pred             CCchhhcccc---CCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639         11 GNCRVCLKSF---KPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus        11 g~CRVClKsf---kP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      ..|.||+--.   +-+|++--|.||.--||--|-.|-+-..     +=.|..|+-.-.
T Consensus        35 ~~C~iCgd~vg~~~~g~~fvaC~~C~fpvCr~Cyeyer~eg-----~q~CpqCkt~Y~   87 (1040)
T PLN02189         35 QVCEICGDEIGLTVDGDLFVACNECGFPVCRPCYEYERREG-----TQNCPQCKTRYK   87 (1040)
T ss_pred             ccccccccccCcCCCCCEEEeeccCCCccccchhhhhhhcC-----CccCcccCCchh
Confidence            4899999765   5688999999999999999999977655     447999976554


No 70 
>PRK06424 transcription factor; Provisional
Probab=43.86  E-value=7.2  Score=29.66  Aligned_cols=35  Identities=23%  Similarity=0.456  Sum_probs=22.9

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccccccCCCC
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDE   48 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~   48 (135)
                      |-+|+|-.+-- +.-.=.+=.-.||++||-|-+...
T Consensus         3 CE~CG~~~~~~-~~v~ieg~~l~vC~~Ca~~G~~v~   37 (144)
T PRK06424          3 CEMCGKKVPQT-TKVMIDGAILNVCDDCAKFGTPVI   37 (144)
T ss_pred             ccccCcccCCc-eEEEEcCeeeehhHHHHHcCCccc
Confidence            88888877622 322223334579999999988444


No 71 
>KOG2169|consensus
Probab=43.20  E-value=7  Score=35.55  Aligned_cols=36  Identities=31%  Similarity=0.730  Sum_probs=29.8

Q ss_pred             hhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639         28 VCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus        28 tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      -+..|+|.-|-|=++|-  +-++.--+|+|.||-++.+
T Consensus       321 r~~~CkHlQcFD~~~~l--q~n~~~pTW~CPVC~~~~~  356 (636)
T KOG2169|consen  321 RGHTCKHLQCFDALSYL--QMNEQKPTWRCPVCQKAAP  356 (636)
T ss_pred             cccccccceecchhhhH--HhccCCCeeeCccCCcccc
Confidence            45678999999988884  4578899999999988764


No 72 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=43.02  E-value=5.8  Score=19.39  Aligned_cols=14  Identities=29%  Similarity=1.042  Sum_probs=8.3

Q ss_pred             eeehhhhhhhhccc
Q psy15639         55 WRCSICRRKLQSRA   68 (135)
Q Consensus        55 WrCSvCRRK~~sr~   68 (135)
                      |.|.+|.....++.
T Consensus         1 ~~C~~C~~~~~~~~   14 (24)
T PF13894_consen    1 FQCPICGKSFRSKS   14 (24)
T ss_dssp             EE-SSTS-EESSHH
T ss_pred             CCCcCCCCcCCcHH
Confidence            78888887765543


No 73 
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=42.95  E-value=6.8  Score=25.77  Aligned_cols=26  Identities=23%  Similarity=0.713  Sum_probs=16.8

Q ss_pred             hhccccCCCCccchhhhhhh----hhhccc
Q psy15639         15 VCLKSFKPDDYSRVCYECHQ----KVCEDC   40 (135)
Q Consensus        15 VClKsfkP~e~~~tC~eCqq----kVCEDC   40 (135)
                      .|.+.|..++....|-.|..    -+|++|
T Consensus         2 ~C~~~~~~~q~~y~C~tC~~~~~~~iC~~C   31 (71)
T PF02207_consen    2 KCTYVWTSGQIFYRCLTCSLDESSGICEEC   31 (71)
T ss_dssp             SS--B--TT-EEEEETTTBSSTT-BBEHHH
T ss_pred             cCCCCCcCCCEEEECccCCCCCCEEEchhh
Confidence            58888999999999999976    467777


No 74 
>PF05810 NinF:  NinF protein;  InterPro: IPR008712 This family consists of several bacteriophage NinF proteins as well as related sequences from Escherichia coli.
Probab=42.81  E-value=6.4  Score=27.28  Aligned_cols=24  Identities=38%  Similarity=0.812  Sum_probs=18.7

Q ss_pred             CCCCCCchhhccccCCCCccchhhhh
Q psy15639          7 AARLGNCRVCLKSFKPDDYSRVCYEC   32 (135)
Q Consensus         7 ~~r~g~CRVClKsfkP~e~~~tC~eC   32 (135)
                      ..|+. |+-|.|-+.|+|.. .|.+|
T Consensus        15 i~RAl-Ca~C~~~L~~~E~h-~Ce~C   38 (58)
T PF05810_consen   15 IERAL-CANCGQKLHPDETH-VCEEC   38 (58)
T ss_pred             HHHHH-HhccCcccccchhh-HHHHH
Confidence            45888 99999999999973 45544


No 75 
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=41.95  E-value=8.6  Score=32.51  Aligned_cols=53  Identities=23%  Similarity=0.455  Sum_probs=34.7

Q ss_pred             CchhhccccCCCCccchhhhhhh-----hhhcccccccCCCCCCCCCceeehhhhhhhhcc
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQ-----KVCEDCASYSKLDENQDENTWRCSICRRKLQSR   67 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqq-----kVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr   67 (135)
                      -|.-|..-+...++..+|..|..     -.||.|..+-...+   ....+|.+|+....-|
T Consensus       122 Yc~~~e~fl~e~~v~g~CP~C~~~~a~g~~Ce~cG~~~~~~~---l~~p~~~~~g~~~~~r  179 (391)
T PF09334_consen  122 YCPSCERFLPESFVEGTCPYCGSDKARGDQCENCGRPLEPEE---LINPVCKICGSPPEVR  179 (391)
T ss_dssp             EETTTTEEE-GGGETCEETTT--SSCTTTEETTTSSBEECCC---SECEEETTTS-B-EEE
T ss_pred             EecCcCcccccceeeccccCcCccccCCCcccCCCCCccccc---ccCCccccccccCccc
Confidence            36667653333445578988873     47999998766544   8889999999987655


No 76 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.63  E-value=9.5  Score=28.22  Aligned_cols=13  Identities=23%  Similarity=0.524  Sum_probs=10.2

Q ss_pred             CCchhhccccCCC
Q psy15639         11 GNCRVCLKSFKPD   23 (135)
Q Consensus        11 g~CRVClKsfkP~   23 (135)
                      .-|+.|++-|..+
T Consensus        71 ~~C~~CG~~~~~~   83 (135)
T PRK03824         71 LKCRNCGNEWSLK   83 (135)
T ss_pred             EECCCCCCEEecc
Confidence            4688888888776


No 77 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=41.10  E-value=8.5  Score=28.01  Aligned_cols=48  Identities=23%  Similarity=0.616  Sum_probs=24.9

Q ss_pred             CCCCchhhcccc---CCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhh
Q psy15639          9 RLGNCRVCLKSF---KPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICR   61 (135)
Q Consensus         9 r~g~CRVClKsf---kP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCR   61 (135)
                      -+..|+||+-..   .-+|+|--|.||.--||--|-.|-+-.-     +-.|..|+
T Consensus         8 ~~qiCqiCGD~VGl~~~Ge~FVAC~eC~fPvCr~CyEYErkeg-----~q~CpqCk   58 (80)
T PF14569_consen    8 NGQICQICGDDVGLTENGEVFVACHECAFPVCRPCYEYERKEG-----NQVCPQCK   58 (80)
T ss_dssp             SS-B-SSS--B--B-SSSSB--S-SSS-----HHHHHHHHHTS------SB-TTT-
T ss_pred             CCcccccccCccccCCCCCEEEEEcccCCccchhHHHHHhhcC-----cccccccC
Confidence            456899998755   3478999999999999999999987544     34577775


No 78 
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=39.93  E-value=12  Score=29.04  Aligned_cols=28  Identities=21%  Similarity=0.490  Sum_probs=20.6

Q ss_pred             cccc--cCCCCCCCCCceeehhhhhhhhcc
Q psy15639         40 CASY--SKLDENQDENTWRCSICRRKLQSR   67 (135)
Q Consensus        40 CASY--Skl~~~ed~~~WrCSvCRRK~~sr   67 (135)
                      |.-+  +.+.+.+....+-|.+|++|++..
T Consensus       147 CvM~~s~s~~e~D~k~~~lC~~C~~kL~~~  176 (179)
T PRK13267        147 CVMNFSNSVRDVDIKEPNFCGSCQRKLERN  176 (179)
T ss_pred             ccCCCCCCHHHHhCCCcccCHHHHHHHHHh
Confidence            6555  444555567889999999999764


No 79 
>PRK03670 competence damage-inducible protein A; Provisional
Probab=39.78  E-value=18  Score=29.38  Aligned_cols=19  Identities=42%  Similarity=0.581  Sum_probs=16.7

Q ss_pred             hHHHHHHHhhccccccccCC
Q psy15639         83 VPVLEALQRRHSDVKIGSAN  102 (135)
Q Consensus        83 vpvlealqrrhsd~klg~~~  102 (135)
                      .|+|++|+++|. ++|||--
T Consensus       197 a~~l~~~~~~~~-v~igSyP  215 (252)
T PRK03670        197 APILEEALERFN-VKIHSSP  215 (252)
T ss_pred             HHHHHHHHHHCC-ceEecCC
Confidence            699999999995 9999944


No 80 
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]
Probab=39.74  E-value=14  Score=29.64  Aligned_cols=24  Identities=29%  Similarity=0.542  Sum_probs=21.6

Q ss_pred             cccccchHHHHHHHhhcccccccc
Q psy15639         77 TDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        77 tds~l~vpvlealqrrhsd~klg~  100 (135)
                      -|-++..|++.+|++.++|++|.-
T Consensus        13 GD~vlt~p~~~~lk~~~P~a~i~~   36 (334)
T COG0859          13 GDVVLTLPLLRTLKKAYPNAKIDV   36 (334)
T ss_pred             hHHHhHHHHHHHHHHHCCCCEEEE
Confidence            367888999999999999999985


No 81 
>KOG4739|consensus
Probab=39.59  E-value=14  Score=30.79  Aligned_cols=45  Identities=24%  Similarity=0.712  Sum_probs=35.3

Q ss_pred             CchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhc
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQS   66 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~s   66 (135)
                      -|-.|.+.=+++.|+-|  -|.|-.|+-|...+-.+        .|..|++-+..
T Consensus         5 hCn~C~~~~~~~~f~LT--aC~HvfC~~C~k~~~~~--------~C~lCkk~ir~   49 (233)
T KOG4739|consen    5 HCNKCFRFPSQDPFFLT--ACRHVFCEPCLKASSPD--------VCPLCKKSIRI   49 (233)
T ss_pred             EeccccccCCCCceeee--echhhhhhhhcccCCcc--------ccccccceeee
Confidence            37778776667777766  79999999999887766        79999987543


No 82 
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=39.04  E-value=11  Score=28.78  Aligned_cols=16  Identities=31%  Similarity=0.845  Sum_probs=12.2

Q ss_pred             CCCCchhhccccCCCC
Q psy15639          9 RLGNCRVCLKSFKPDD   24 (135)
Q Consensus         9 r~g~CRVClKsfkP~e   24 (135)
                      ....|.+|+|.|.|..
T Consensus       113 ~~~~C~~Cg~~f~~~k  128 (181)
T PRK08222        113 HLQRCSRCERPFAPQK  128 (181)
T ss_pred             ccCcCcccCCccCcHh
Confidence            3566999999998754


No 83 
>PRK01343 zinc-binding protein; Provisional
Probab=38.86  E-value=22  Score=24.12  Aligned_cols=25  Identities=20%  Similarity=0.349  Sum_probs=18.1

Q ss_pred             CCCCCCCCchhhccccCCCCccchhh
Q psy15639          5 KPAARLGNCRVCLKSFKPDDYSRVCY   30 (135)
Q Consensus         5 kp~~r~g~CRVClKsfkP~e~~~tC~   30 (135)
                      ++..+...|-||.|.|.. +|.-.|.
T Consensus         4 ~~~~p~~~CP~C~k~~~~-~~rPFCS   28 (57)
T PRK01343          4 EPLRPTRPCPECGKPSTR-EAYPFCS   28 (57)
T ss_pred             ccCCCCCcCCCCCCcCcC-CCCcccC
Confidence            455677899999999874 4555554


No 84 
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=37.44  E-value=9.1  Score=25.86  Aligned_cols=24  Identities=38%  Similarity=1.125  Sum_probs=7.7

Q ss_pred             CCCccch-----hhhhhhh----------hhcccccccC
Q psy15639         22 PDDYSRV-----CYECHQK----------VCEDCASYSK   45 (135)
Q Consensus        22 P~e~~~t-----C~eCqqk----------VCEDCASYSk   45 (135)
                      |+||...     |++|..+          -|..|.||-+
T Consensus        21 P~~Y~~~~v~IlCNDC~~~s~v~fH~lg~KC~~C~SYNT   59 (61)
T PF14599_consen   21 PEEYRNKKVWILCNDCNAKSEVPFHFLGHKCSHCGSYNT   59 (61)
T ss_dssp             -------EEEEEESSS--EEEEE--TT----TTTS---E
T ss_pred             CHHHhCCEEEEECCCCCCccceeeeHhhhcCCCCCCccc
Confidence            5555544     8888765          4888888864


No 85 
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology.  The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
Probab=36.69  E-value=17  Score=27.61  Aligned_cols=24  Identities=38%  Similarity=0.577  Sum_probs=21.5

Q ss_pred             cccccchHHHHHHHhhcccccccc
Q psy15639         77 TDSLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        77 tds~l~vpvlealqrrhsd~klg~  100 (135)
                      -|-++-.|++.+|++++++++|..
T Consensus        11 GD~i~~~p~l~~Lk~~~P~~~I~~   34 (279)
T cd03789          11 GDVVLATPLLRALKARYPDARITV   34 (279)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEE
Confidence            477888999999999999999876


No 86 
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=36.26  E-value=3.3  Score=26.19  Aligned_cols=31  Identities=32%  Similarity=0.819  Sum_probs=13.9

Q ss_pred             hhhhhhhhcccccccCCCCCCCCCceeehhhhh
Q psy15639         30 YECHQKVCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        30 ~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      ..|+|.-|-|=.+|=..  ++..+.|+|.+|.+
T Consensus        19 ~~C~H~~CFDl~~fl~~--~~~~~~W~CPiC~~   49 (50)
T PF02891_consen   19 KNCKHLQCFDLESFLES--NQRTPKWKCPICNK   49 (50)
T ss_dssp             TT--SS--EEHHHHHHH--HHHS---B-TTT--
T ss_pred             CcCcccceECHHHHHHH--hhccCCeECcCCcC
Confidence            46888888887666443  33445699999975


No 87 
>KOG1245|consensus
Probab=35.62  E-value=18  Score=36.41  Aligned_cols=55  Identities=22%  Similarity=0.468  Sum_probs=40.1

Q ss_pred             CCCCCCCchhhccccCCCC--ccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639          6 PAARLGNCRVCLKSFKPDD--YSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus         6 p~~r~g~CRVClKsfkP~e--~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      ..+..+-|.||++.+++++  .+.-|..+.|.-|-.=+.++....+     |-|.-||....
T Consensus      1104 ~s~~~~~c~~cr~k~~~~~m~lc~~c~~~~h~~C~rp~~~~~~~~d-----W~C~~c~~e~~ 1160 (1404)
T KOG1245|consen 1104 RSAVNALCKVCRRKKQDEKMLLCDECLSGFHLFCLRPALSSVPPGD-----WMCPSCRKEHR 1160 (1404)
T ss_pred             cccchhhhhhhhhcccchhhhhhHhhhhhHHHHhhhhhhccCCcCC-----ccCCccchhhh
Confidence            4566788999999999954  3444555556667776777776653     99999987664


No 88 
>PHA02926 zinc finger-like protein; Provisional
Probab=35.53  E-value=11  Score=31.95  Aligned_cols=59  Identities=19%  Similarity=0.578  Sum_probs=40.8

Q ss_pred             CCCCCCchhhccc-cC---CCC-ccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639          7 AARLGNCRVCLKS-FK---PDD-YSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus         7 ~~r~g~CRVClKs-fk---P~e-~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      .++...|-||+.. ++   |+| .+-+=..|.|-.|-+|----+....+......|.+||..+.
T Consensus       167 ~SkE~eCgICmE~I~eK~~~~eRrFGIL~~CnHsFCl~CIr~Wr~~r~~~~~~rsCPiCR~~f~  230 (242)
T PHA02926        167 VSKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRRETGASDNCPICRTRFR  230 (242)
T ss_pred             ccCCCCCccCccccccccccccccccccCCCCchHHHHHHHHHHHhccccCcCCcCCCCcceee
Confidence            3567889999954 44   233 45566789999999997644433334456788999998765


No 89 
>PLN02436 cellulose synthase A
Probab=35.31  E-value=21  Score=35.69  Aligned_cols=50  Identities=22%  Similarity=0.654  Sum_probs=41.3

Q ss_pred             CCchhhcccc---CCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639         11 GNCRVCLKSF---KPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus        11 g~CRVClKsf---kP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      ..|.||+-..   +-+|++--|.||.--||--|-.|-+-..     +=.|..|+-+-.
T Consensus        37 ~iCqICGD~Vg~t~dGe~FVACn~C~fpvCr~Cyeyer~eg-----~~~Cpqckt~Y~   89 (1094)
T PLN02436         37 QTCQICGDEIELTVDGEPFVACNECAFPVCRPCYEYERREG-----NQACPQCKTRYK   89 (1094)
T ss_pred             ccccccccccCcCCCCCEEEeeccCCCccccchhhhhhhcC-----CccCcccCCchh
Confidence            4899999764   6789999999999999999999977655     447999976554


No 90 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=35.14  E-value=24  Score=27.43  Aligned_cols=34  Identities=38%  Similarity=0.710  Sum_probs=16.0

Q ss_pred             hhhhhhhh--hhcccccccCCCCCCCCCceeehhhh
Q psy15639         28 VCYECHQK--VCEDCASYSKLDENQDENTWRCSICR   61 (135)
Q Consensus        28 tC~eCqqk--VCEDCASYSkl~~~ed~~~WrCSvCR   61 (135)
                      .|.-|++|  +||-|.+-.-+--=+..++-+|..|.
T Consensus       144 ~C~lC~~kGfiCe~C~~~~~IfPF~~~~~~~C~~C~  179 (202)
T PF13901_consen  144 SCELCQQKGFICEICNSDDIIFPFQIDTTVRCPKCK  179 (202)
T ss_pred             HhHHHHhCCCCCccCCCCCCCCCCCCCCeeeCCcCc
Confidence            34445443  55555443333333334555555554


No 91 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=35.10  E-value=12  Score=19.16  Aligned_cols=26  Identities=31%  Similarity=0.931  Sum_probs=17.2

Q ss_pred             chhhccccCCCCccchhhhhhhhhhccccc
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCAS   42 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCAS   42 (135)
                      |.||+...+    ..+-..|.|..|..|..
T Consensus         1 C~iC~~~~~----~~~~~~C~H~~c~~C~~   26 (39)
T smart00184        1 CPICLEELK----DPVVLPCGHTFCRSCIR   26 (39)
T ss_pred             CCcCccCCC----CcEEecCCChHHHHHHH
Confidence            667777632    22234699999999864


No 92 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=34.81  E-value=28  Score=34.97  Aligned_cols=69  Identities=17%  Similarity=0.330  Sum_probs=35.3

Q ss_pred             CCCccchhhhhhhh----hhcccccccCCCCCCCCCceeehhhhhhhhccccc-cccccccccccchHHHHHHHhhcccc
Q psy15639         22 PDDYSRVCYECHQK----VCEDCASYSKLDENQDENTWRCSICRRKLQSRAQP-VLSQNSTDSLLDVPVLEALQRRHSDV   96 (135)
Q Consensus        22 P~e~~~tC~eCqqk----VCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~qp-~~~q~stds~l~vpvlealqrrhsd~   96 (135)
                      -+--.+.|.+|.+.    .|.+|-.-       ....|+|+.||.....-.-| |=..-...+...+++-+.+++-...+
T Consensus       622 VEVg~RfCpsCG~~t~~frCP~CG~~-------Te~i~fCP~CG~~~~~y~CPKCG~El~~~s~~~i~l~~~~~~A~~~l  694 (1121)
T PRK04023        622 VEIGRRKCPSCGKETFYRRCPFCGTH-------TEPVYRCPRCGIEVEEDECEKCGREPTPYSKRKIDLKELYDRALENL  694 (1121)
T ss_pred             ecccCccCCCCCCcCCcccCCCCCCC-------CCcceeCccccCcCCCCcCCCCCCCCCccceEEecHHHHHHHHHHHh
Confidence            33345556666533    56666544       23456777776554421111 11222344556777777777665544


Q ss_pred             c
Q psy15639         97 K   97 (135)
Q Consensus        97 k   97 (135)
                      .
T Consensus       695 g  695 (1121)
T PRK04023        695 G  695 (1121)
T ss_pred             C
Confidence            3


No 93 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=34.79  E-value=12  Score=22.43  Aligned_cols=32  Identities=19%  Similarity=0.455  Sum_probs=21.1

Q ss_pred             hhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         36 VCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        36 VCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      +|..|-+.. +-.+.......|+.|+..+..+.
T Consensus         2 ~Cp~Cg~~~-~~~D~~~g~~vC~~CG~Vl~e~~   33 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDPERGELVCPNCGLVLEENI   33 (43)
T ss_dssp             SBTTTSSSE-EEEETTTTEEEETTT-BBEE-TT
T ss_pred             CCcCCcCCc-eEEcCCCCeEECCCCCCEeeccc
Confidence            467777755 55556677889999987766554


No 94 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=33.94  E-value=15  Score=27.25  Aligned_cols=24  Identities=21%  Similarity=0.531  Sum_probs=17.4

Q ss_pred             cchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhh
Q psy15639         26 SRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKL   64 (135)
Q Consensus        26 ~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~   64 (135)
                      |++|..|.+               .....|.|+.|+-.+
T Consensus       309 S~~C~~cg~---------------~~~r~~~C~~cg~~~  332 (364)
T COG0675         309 SKTCPCCGH---------------LSGRLFKCPRCGFVH  332 (364)
T ss_pred             cccccccCC---------------ccceeEECCCCCCee
Confidence            477887777               225689999998654


No 95 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=33.73  E-value=15  Score=26.73  Aligned_cols=12  Identities=33%  Similarity=1.046  Sum_probs=9.4

Q ss_pred             Cceeehhhhhhh
Q psy15639         53 NTWRCSICRRKL   64 (135)
Q Consensus        53 ~~WrCSvCRRK~   64 (135)
                      ..|+|..|....
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            788888887764


No 96 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=33.55  E-value=14  Score=22.46  Aligned_cols=28  Identities=29%  Similarity=0.646  Sum_probs=17.6

Q ss_pred             hhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639         36 VCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus        36 VCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      +|.+|..--..++.  ...++|..|+-++-
T Consensus         5 ~C~~CG~~~~~~~~--~~~~~Cp~CG~~~~   32 (46)
T PRK00398          5 KCARCGREVELDEY--GTGVRCPYCGYRIL   32 (46)
T ss_pred             ECCCCCCEEEECCC--CCceECCCCCCeEE
Confidence            57777654444332  23899999987654


No 97 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=33.35  E-value=11  Score=22.84  Aligned_cols=27  Identities=22%  Similarity=0.602  Sum_probs=16.9

Q ss_pred             hhccccc-ccCCCCCCCCCceeehhhhh
Q psy15639         36 VCEDCAS-YSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        36 VCEDCAS-YSkl~~~ed~~~WrCSvCRR   62 (135)
                      .|.+|.. |..+....+.....|..|+.
T Consensus         7 ~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         7 RCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            3555655 55544433456788999987


No 98 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=32.99  E-value=27  Score=21.17  Aligned_cols=32  Identities=28%  Similarity=0.703  Sum_probs=25.0

Q ss_pred             CchhhccccCCCCccchhhhhh-hhhhcccccccC
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECH-QKVCEDCASYSK   45 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCq-qkVCEDCASYSk   45 (135)
                      .|.+|.+.+. + +...|.+|. --.|.+|.+.-.
T Consensus         2 ~C~~C~~~i~-g-~r~~C~~C~d~dLC~~Cf~~~~   34 (46)
T cd02249           2 SCDGCLKPIV-G-VRYHCLVCEDFDLCSSCYAKGK   34 (46)
T ss_pred             CCcCCCCCCc-C-CEEECCCCCCCcCHHHHHCcCc
Confidence            4889999554 4 778899997 678999988664


No 99 
>PF10217 DUF2039:  Uncharacterized conserved protein (DUF2039);  InterPro: IPR019351  This entry is a region of approximately 100 residues containing three pairs of cysteine residues. The region is conserved from plants to humans but its function is unknown. 
Probab=32.80  E-value=11  Score=27.52  Aligned_cols=15  Identities=33%  Similarity=0.851  Sum_probs=7.6

Q ss_pred             cCCCCccchhhhhhh
Q psy15639         20 FKPDDYSRVCYECHQ   34 (135)
Q Consensus        20 fkP~e~~~tC~eCqq   34 (135)
                      +||=.-...|..|+|
T Consensus        49 YKpLt~p~kC~~C~q   63 (92)
T PF10217_consen   49 YKPLTQPKKCNKCQQ   63 (92)
T ss_pred             cccCCCCcccccccc
Confidence            444445555555553


No 100
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=32.80  E-value=20  Score=20.61  Aligned_cols=28  Identities=29%  Similarity=0.376  Sum_probs=14.8

Q ss_pred             CCCCchhhccccCCC-Cccchhhhhhhhh
Q psy15639          9 RLGNCRVCLKSFKPD-DYSRVCYECHQKV   36 (135)
Q Consensus         9 r~g~CRVClKsfkP~-e~~~tC~eCqqkV   36 (135)
                      ++..|.+|.+.|.-. .....|..|+..|
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~~C~~C~~~~   38 (50)
T cd00029          10 KPTFCDVCRKSIWGLFKQGLRCSWCKVKC   38 (50)
T ss_pred             CCCChhhcchhhhccccceeEcCCCCCch
Confidence            455677777766521 2333455554443


No 101
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=32.72  E-value=12  Score=21.29  Aligned_cols=27  Identities=30%  Similarity=0.732  Sum_probs=12.8

Q ss_pred             hccccc-ccCCCCCCCCCceeehhhhhh
Q psy15639         37 CEDCAS-YSKLDENQDENTWRCSICRRK   63 (135)
Q Consensus        37 CEDCAS-YSkl~~~ed~~~WrCSvCRRK   63 (135)
                      |.+|.. |.......+.....|..|+..
T Consensus         8 C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~   35 (41)
T smart00834        8 CEDCGHTFEVLQKISDDPLATCPECGGD   35 (41)
T ss_pred             cCCCCCEEEEEEecCCCCCCCCCCCCCc
Confidence            344433 333333333556667666653


No 102
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=32.57  E-value=23  Score=23.19  Aligned_cols=50  Identities=24%  Similarity=0.321  Sum_probs=31.5

Q ss_pred             CCCCCCCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639          6 PAARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus         6 p~~r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      +.+|+ .|+.|.+.+.-+++ |+...          .++ ....-....|.=--|=.+.....
T Consensus         4 ks~Ra-~Ck~C~~~I~kg~l-RiG~~----------~~~-~~~~~~~~~W~H~~C~~~~~~~~   53 (82)
T PF00645_consen    4 KSGRA-KCKGCKKKIAKGEL-RIGKI----------VPS-PEGDGDIPKWYHWDCFFKKQLRN   53 (82)
T ss_dssp             SSSTE-BETTTSCBE-TTSE-EEEEE----------EEE-TTSSCEEEEEEEHHHHHHTTCCT
T ss_pred             CCCCc-cCcccCCcCCCCCE-EEEEE----------ecc-cccCCCCCceECccccccchhhh
Confidence            34565 89999999998887 44332          111 11134567899888887776654


No 103
>PRK06260 threonine synthase; Validated
Probab=31.65  E-value=20  Score=29.81  Aligned_cols=23  Identities=35%  Similarity=0.810  Sum_probs=19.9

Q ss_pred             CchhhccccCCCCccchhhhhhh
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQ   34 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqq   34 (135)
                      .|.-|.+.|.++++...|.+|..
T Consensus         5 ~C~~cg~~~~~~~~~~~Cp~cg~   27 (397)
T PRK06260          5 KCIECGKEYDPDEIIYTCPECGG   27 (397)
T ss_pred             EECCCCCCCCCCCccccCCCCCC
Confidence            48889999999999999988853


No 104
>KOG4275|consensus
Probab=31.33  E-value=21  Score=31.79  Aligned_cols=53  Identities=21%  Similarity=0.669  Sum_probs=41.8

Q ss_pred             CCCCCCCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639          6 PAARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus         6 p~~r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      +.+-+-.|.-|+-.|.--.-.++|.+|+.-.|--|.   ...+    +.-+|+-|||--|
T Consensus        40 ~~~~~p~ckacg~~f~~~~~k~~c~dckk~fc~tcs---~v~~----~lr~c~~c~r~~a   92 (350)
T KOG4275|consen   40 SSSQAPHCKACGEEFEDAQSKSDCEDCKKEFCATCS---RVSI----SLRTCTSCRRVNA   92 (350)
T ss_pred             cccccchhhhhchhHhhhhhhhhhhhhhHHHHHHHH---Hhcc----cchhhhHHHHHHh
Confidence            344455899999999988889999999999888876   4433    5678999998654


No 105
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=31.04  E-value=19  Score=25.91  Aligned_cols=16  Identities=13%  Similarity=0.164  Sum_probs=10.7

Q ss_pred             CCchhhccccCCCCcc
Q psy15639         11 GNCRVCLKSFKPDDYS   26 (135)
Q Consensus        11 g~CRVClKsfkP~e~~   26 (135)
                      ..|+-|.+-|...+..
T Consensus        71 ~~C~~Cg~~~~~~~~~   86 (114)
T PRK03681         71 CWCETCQQYVTLLTQR   86 (114)
T ss_pred             EEcccCCCeeecCCcc
Confidence            4577888777665554


No 106
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=30.99  E-value=39  Score=26.50  Aligned_cols=74  Identities=19%  Similarity=0.313  Sum_probs=40.2

Q ss_pred             chhhccccCCCCccchhhhhhhhhhcccccccCCCC-CCCCCceeehhhhhhhhccccccccccccccccch------HH
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDE-NQDENTWRCSICRRKLQSRAQPVLSQNSTDSLLDV------PV   85 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~-~ed~~~WrCSvCRRK~~sr~qp~~~q~stds~l~v------pv   85 (135)
                      |-.|++...|. +..+|.+|--+.       -.+.+ .+.-+.-.|..|++-+....  .+.- ...+++++      ..
T Consensus         1 C~~CG~~~~~~-~~~lC~~C~~~~-------~~i~ei~~~i~v~~C~~Cg~~~~~~~--W~~~-~~~el~~~~lk~v~~~   69 (236)
T PF04981_consen    1 CPRCGREIEPL-IDGLCPDCYLKR-------FDIIEIPDRIEVTICPKCGRYRIGGR--WVDP-ESRELEELCLKKVERG   69 (236)
T ss_pred             CCCCCCCCCCc-ccccChHHhccc-------CCeeecCCccCceECCCCCCEECCCE--eeec-CcccHHHHHHHHHHHH
Confidence            77888866654 335666665432       12222 23357788999998777622  2222 34455665      33


Q ss_pred             HHHHHhhccccc
Q psy15639         86 LEALQRRHSDVK   97 (135)
Q Consensus        86 lealqrrhsd~k   97 (135)
                      |......|.|++
T Consensus        70 l~~~~~~~~d~~   81 (236)
T PF04981_consen   70 LKKNIKVHVDAE   81 (236)
T ss_pred             HHHhhccccccc
Confidence            333333456554


No 107
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=30.90  E-value=18  Score=30.97  Aligned_cols=47  Identities=36%  Similarity=0.730  Sum_probs=38.1

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhhccccc--ccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVCEDCAS--YSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCAS--YSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      +--|-||-|-|+    +.+=.+|.|-.|+-||-  |-|.++        |-||+.-+--|.
T Consensus       196 PF~C~iCKkdy~----spvvt~CGH~FC~~Cai~~y~kg~~--------C~~Cgk~t~G~f  244 (259)
T COG5152         196 PFLCGICKKDYE----SPVVTECGHSFCSLCAIRKYQKGDE--------CGVCGKATYGRF  244 (259)
T ss_pred             ceeehhchhhcc----chhhhhcchhHHHHHHHHHhccCCc--------ceecchhhccce
Confidence            447999999887    46678999999999995  666665        999998877665


No 108
>KOG0311|consensus
Probab=30.49  E-value=10  Score=34.00  Aligned_cols=49  Identities=31%  Similarity=0.653  Sum_probs=34.5

Q ss_pred             CchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      .|.|||--+|-   ..|=-||-|+.|.||---+--     ...-.|.-||.++.|+-
T Consensus        45 ~c~icl~llk~---tmttkeClhrfc~~ci~~a~r-----~gn~ecptcRk~l~Skr   93 (381)
T KOG0311|consen   45 ICPICLSLLKK---TMTTKECLHRFCFDCIWKALR-----SGNNECPTCRKKLVSKR   93 (381)
T ss_pred             ccHHHHHHHHh---hcccHHHHHHHHHHHHHHHHH-----hcCCCCchHHhhccccc
Confidence            47777755542   345568999999999643321     23446999999999976


No 109
>PRK04023 DNA polymerase II large subunit; Validated
Probab=30.31  E-value=20  Score=35.96  Aligned_cols=46  Identities=24%  Similarity=0.496  Sum_probs=34.3

Q ss_pred             CCchhhccccCCCCccchhhhhh-----hhhhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECH-----QKVCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCq-----qkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      ..|.-|++..    +...|.+|.     .+.|.+|-.-        ...-.|.-|+.++.+-.
T Consensus       627 RfCpsCG~~t----~~frCP~CG~~Te~i~fCP~CG~~--------~~~y~CPKCG~El~~~s  677 (1121)
T PRK04023        627 RKCPSCGKET----FYRRCPFCGTHTEPVYRCPRCGIE--------VEEDECEKCGREPTPYS  677 (1121)
T ss_pred             ccCCCCCCcC----CcccCCCCCCCCCcceeCccccCc--------CCCCcCCCCCCCCCccc
Confidence            4699999885    778999996     5799999322        22345999999876544


No 110
>PRK14284 chaperone protein DnaJ; Provisional
Probab=30.15  E-value=25  Score=29.65  Aligned_cols=49  Identities=22%  Similarity=0.618  Sum_probs=35.3

Q ss_pred             CCCCCchhh-ccccCCCCccchhhhhh--------------hhhhcccccccCCCCCCCCCceeehhhhh
Q psy15639          8 ARLGNCRVC-LKSFKPDDYSRVCYECH--------------QKVCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus         8 ~r~g~CRVC-lKsfkP~e~~~tC~eCq--------------qkVCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      .|...|..| ..+.+++.-.++|..|.              +..|..|-.--+...      =.|..|.-
T Consensus       156 ~r~~~C~~C~G~G~~~~~~~~~C~~C~G~G~v~~~~G~~~~~~~C~~C~G~G~~~~------~~C~~C~G  219 (391)
T PRK14284        156 SGYKSCDACSGSGANSSQGIKVCDRCKGSGQVVQSRGFFSMASTCPECGGEGRVIT------DPCSVCRG  219 (391)
T ss_pred             eeeccCCCCcccccCCCCCCeecCccCCeeEEEEEeceEEEEEECCCCCCCCcccC------CcCCCCCC
Confidence            356678888 45667777678899997              348999988776543      24988874


No 111
>KOG4628|consensus
Probab=29.96  E-value=24  Score=30.85  Aligned_cols=48  Identities=23%  Similarity=0.691  Sum_probs=32.4

Q ss_pred             CCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCce--eehhhhhhhhc
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTW--RCSICRRKLQS   66 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~W--rCSvCRRK~~s   66 (135)
                      ..|-||+-.|++||--++ -=|+|+.=-+|-- +-      -..|  .|.||.|.+..
T Consensus       230 ~~CaIClEdY~~GdklRi-LPC~H~FH~~CID-pW------L~~~r~~CPvCK~di~~  279 (348)
T KOG4628|consen  230 DTCAICLEDYEKGDKLRI-LPCSHKFHVNCID-PW------LTQTRTFCPVCKRDIRT  279 (348)
T ss_pred             ceEEEeecccccCCeeeE-ecCCCchhhccch-hh------HhhcCccCCCCCCcCCC
Confidence            589999999999998887 6676654333321 11      2234  39999996543


No 112
>PRK08197 threonine synthase; Validated
Probab=29.71  E-value=23  Score=29.49  Aligned_cols=22  Identities=23%  Similarity=0.773  Sum_probs=19.3

Q ss_pred             CCchhhccccCCCCccchhhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECH   33 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCq   33 (135)
                      -.|.-|.+.|.++++...| +|.
T Consensus         8 ~~C~~Cg~~~~~~~~~~~C-~cg   29 (394)
T PRK08197          8 LECSKCGETYDADQVHNLC-KCG   29 (394)
T ss_pred             EEECCCCCCCCCCCcceec-CCC
Confidence            4699999999999998888 785


No 113
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=29.57  E-value=19  Score=18.92  Aligned_cols=11  Identities=36%  Similarity=0.893  Sum_probs=8.4

Q ss_pred             CchhhccccCC
Q psy15639         12 NCRVCLKSFKP   22 (135)
Q Consensus        12 ~CRVClKsfkP   22 (135)
                      .|.+|.+.|.-
T Consensus         3 ~C~~C~~~F~~   13 (27)
T PF13912_consen    3 ECDECGKTFSS   13 (27)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCccCCccCC
Confidence            48888888863


No 114
>PF13945 NST1:  Salt tolerance down-regulator
Probab=29.07  E-value=21  Score=28.86  Aligned_cols=18  Identities=33%  Similarity=0.883  Sum_probs=12.9

Q ss_pred             Cceeehhhhhhhhcccccccccc
Q psy15639         53 NTWRCSICRRKLQSRAQPVLSQN   75 (135)
Q Consensus        53 ~~WrCSvCRRK~~sr~qp~~~q~   75 (135)
                      .+-.|+||+||   |.  +|-||
T Consensus       140 h~C~C~vCgr~---~~--~ie~e  157 (190)
T PF13945_consen  140 HSCSCSVCGRK---RT--AIEEE  157 (190)
T ss_pred             cCcccHHHhch---hh--HHHHH
Confidence            35789999999   43  46555


No 115
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=28.86  E-value=20  Score=26.55  Aligned_cols=31  Identities=26%  Similarity=0.618  Sum_probs=23.1

Q ss_pred             hhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         36 VCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        36 VCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      +|..|.+-  .-.-.-..-|.|.-|+.+.|--+
T Consensus        37 ~Cp~C~~~--~VkR~a~GIW~C~kCg~~fAGga   67 (89)
T COG1997          37 VCPFCGRT--TVKRIATGIWKCRKCGAKFAGGA   67 (89)
T ss_pred             cCCCCCCc--ceeeeccCeEEcCCCCCeecccc
Confidence            57777654  34445577899999999998765


No 116
>COG1773 Rubredoxin [Energy production and conversion]
Probab=28.77  E-value=22  Score=23.99  Aligned_cols=9  Identities=56%  Similarity=1.634  Sum_probs=5.6

Q ss_pred             ceeehhhhh
Q psy15639         54 TWRCSICRR   62 (135)
Q Consensus        54 ~WrCSvCRR   62 (135)
                      .|+|++|+-
T Consensus         3 ~~~C~~CG~   11 (55)
T COG1773           3 RWRCSVCGY   11 (55)
T ss_pred             ceEecCCce
Confidence            566666653


No 117
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=28.76  E-value=12  Score=21.83  Aligned_cols=26  Identities=23%  Similarity=0.682  Sum_probs=16.2

Q ss_pred             CCCchhhccccCCC-----Cccchhhhhhhh
Q psy15639         10 LGNCRVCLKSFKPD-----DYSRVCYECHQK   35 (135)
Q Consensus        10 ~g~CRVClKsfkP~-----e~~~tC~eCqqk   35 (135)
                      -|.|..|+..+..+     .....|.+||++
T Consensus         3 yg~C~~CGe~I~~~Rl~~~p~~~~C~~C~~~   33 (36)
T PF01258_consen    3 YGICEDCGEPIPEERLVAVPGATLCVECQER   33 (36)
T ss_dssp             -SB-TTTSSBEEHHHHHHCTTECS-HHHHHH
T ss_pred             CCCccccCChHHHHHHHhCCCcEECHHHhCc
Confidence            35588888776543     467788888875


No 118
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=28.76  E-value=16  Score=33.00  Aligned_cols=30  Identities=27%  Similarity=0.659  Sum_probs=21.6

Q ss_pred             ccCCCCCCCCCceeehhhhhhhhccccccc
Q psy15639         43 YSKLDENQDENTWRCSICRRKLQSRAQPVL   72 (135)
Q Consensus        43 YSkl~~~ed~~~WrCSvCRRK~~sr~qp~~   72 (135)
                      |++..--+-.+.|+|.+|.||-.||-+--|
T Consensus       273 f~~~e~L~g~d~W~CpkC~~k~ss~K~~~I  302 (415)
T COG5533         273 FYEEEKLEGKDAWRCPKCGRKESSRKRMEI  302 (415)
T ss_pred             hhhHHhhcCcccccCchhcccccchheEEE
Confidence            333334456789999999999988875433


No 119
>PF12251 zf-SNAP50_C:  snRNA-activating protein of 50kDa MW C terminal;  InterPro: IPR022042  This domain family is found in eukaryotes, and is typically between 196 and 207 amino acids in length. There is a conserved CEH sequence motif. SNAP50 is part of the snRNA-activating protein complex which activates RNA polymerases II and III. There is a cysteine-histidine cluster which contains two possible zinc finger motifs. 
Probab=28.71  E-value=36  Score=26.72  Aligned_cols=33  Identities=30%  Similarity=0.535  Sum_probs=25.1

Q ss_pred             CCCCCCCCchhhcccc----------CCCCccchhhhhhhhhh
Q psy15639          5 KPAARLGNCRVCLKSF----------KPDDYSRVCYECHQKVC   37 (135)
Q Consensus         5 kp~~r~g~CRVClKsf----------kP~e~~~tC~eCqqkVC   37 (135)
                      ++..|...|.||.+..          .|++++..|..|-....
T Consensus       134 ~~~~~~~~C~vC~~~~A~~v~~~d~~~p~~P~~~C~~Cf~~lh  176 (196)
T PF12251_consen  134 KPRFRRRKCSVCGIYPAKWVTYNDELAPEDPCFFCDSCFRLLH  176 (196)
T ss_pred             ecCcccccCCCCCCCCCEEEEECCccCCCCCchhHHHHHHHhC
Confidence            3456788999998864          68999999988865443


No 120
>KOG1311|consensus
Probab=28.43  E-value=23  Score=28.08  Aligned_cols=29  Identities=24%  Similarity=0.587  Sum_probs=20.0

Q ss_pred             hhhhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         34 QKVCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        34 qkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      .+.|.-|-.|..      +-+|-||+|.+=+..++
T Consensus       113 ~~~C~~C~~~rP------pRs~HCsvC~~CV~rfD  141 (299)
T KOG1311|consen  113 WKYCDTCQLYRP------PRSSHCSVCNNCVLRFD  141 (299)
T ss_pred             eEEcCcCcccCC------CCcccchhhcccccccC
Confidence            367777777732      55788999887665544


No 121
>PF11523 DUF3223:  Protein of unknown function (DUF3223);  InterPro: IPR021602  This family of proteins has no known function. ; PDB: 2K0M_A.
Probab=28.35  E-value=32  Score=23.49  Aligned_cols=19  Identities=47%  Similarity=0.684  Sum_probs=14.3

Q ss_pred             hHHHHHHHhhcccc--ccccC
Q psy15639         83 VPVLEALQRRHSDV--KIGSA  101 (135)
Q Consensus        83 vpvlealqrrhsd~--klg~~  101 (135)
                      -=+|++|..+||++  |+|.|
T Consensus        20 ~~~l~~ll~~HP~~~~KiG~G   40 (76)
T PF11523_consen   20 KSVLEALLKYHPEAEEKIGCG   40 (76)
T ss_dssp             HHHHHHHHHTSTTHHHHHTT-
T ss_pred             HHHHHHHHHhCCcHHHhhcCC
Confidence            34788999999976  77765


No 122
>KOG3214|consensus
Probab=28.30  E-value=18  Score=27.70  Aligned_cols=12  Identities=42%  Similarity=1.148  Sum_probs=10.3

Q ss_pred             CCchhhccccCC
Q psy15639         11 GNCRVCLKSFKP   22 (135)
Q Consensus        11 g~CRVClKsfkP   22 (135)
                      -+||||..||+-
T Consensus        48 ~sC~iC~esFqt   59 (109)
T KOG3214|consen   48 ASCRICEESFQT   59 (109)
T ss_pred             eeeeehhhhhcc
Confidence            479999999974


No 123
>cd08430 PBP2_IlvY The C-terminal substrate binding of LysR-type transcriptional regulator IlvY, which activates the expression of ilvC gene that encoding acetohydroxy acid isomeroreductase for the biosynthesis of branched amino acids; contains the type 2 periplasmic binding fold. In Escherichia coli, IlvY is required for the regulation of ilvC gene expression that encodes acetohydroxy acid isomeroreductase (AHIR), a key enzyme in the biosynthesis of branched-chain amino acids (isoleucine, valine, and leucine). The ilvGMEDA operon genes encode remaining enzyme activities required for the biosynthesis of these amino acids. Activation of ilvC transcription by IlvY requires the additional binding of a co-inducer molecule (either alpha-acetolactate or alpha-acetohydoxybutyrate, the substrates for AHIR) to a preformed complex of IlvY protein-DNA.  Like many other LysR-family members, IlvY negatively auto-regulates the transcription of its own divergently transcribed ilvY gene in an inducer-i
Probab=28.19  E-value=39  Score=21.81  Aligned_cols=20  Identities=30%  Similarity=0.517  Sum_probs=16.0

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=-+++.+++++|++++|=.
T Consensus        14 ~l~~~l~~~~~~~P~v~l~~   33 (199)
T cd08430          14 FLPPILERFRAQHPQVEIKL   33 (199)
T ss_pred             eccHHHHHHHHHCCCceEEE
Confidence            33688999999999887754


No 124
>cd08471 PBP2_CrgA_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 2. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=28.15  E-value=40  Score=21.91  Aligned_cols=18  Identities=11%  Similarity=0.349  Sum_probs=15.3

Q ss_pred             hHHHHHHHhhcccccccc
Q psy15639         83 VPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        83 vpvlealqrrhsd~klg~  100 (135)
                      .+++..++++|++++|-.
T Consensus        17 ~~~l~~~~~~~P~v~i~i   34 (201)
T cd08471          17 LPIITDFLDAYPEVSVRL   34 (201)
T ss_pred             HHHHHHHHHHCCCcEEEE
Confidence            478999999999988754


No 125
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=27.88  E-value=19  Score=21.43  Aligned_cols=27  Identities=19%  Similarity=0.650  Sum_probs=20.0

Q ss_pred             hhcccccccCCCCC---CCCCceeehhhhh
Q psy15639         36 VCEDCASYSKLDEN---QDENTWRCSICRR   62 (135)
Q Consensus        36 VCEDCASYSkl~~~---ed~~~WrCSvCRR   62 (135)
                      .|..|...-+++++   +....-||+.|+-
T Consensus         4 ~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~   33 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLPAGGRKVRCPKCGH   33 (37)
T ss_pred             ECCCCCceEEcCHHHcccCCcEEECCCCCc
Confidence            47778777777776   5566789999874


No 126
>PF14260 zf-C4pol:  C4-type zinc-finger of DNA polymerase delta
Probab=27.86  E-value=40  Score=21.68  Aligned_cols=20  Identities=30%  Similarity=0.780  Sum_probs=11.0

Q ss_pred             chhhccccCCCCccchhhhhh
Q psy15639         13 CRVCLKSFKPDDYSRVCYECH   33 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCq   33 (135)
                      |-+|++-...++ ..+|.+|.
T Consensus         1 C~~C~~~~~~~~-~~lC~~C~   20 (73)
T PF14260_consen    1 CLVCGAKTQEGE-SPLCSNCR   20 (73)
T ss_pred             CCCCCCcCCCCC-CCcCcccC
Confidence            456666666665 34444443


No 127
>PF15379 DUF4606:  Domain of unknown function (DUF4606)
Probab=27.81  E-value=30  Score=26.15  Aligned_cols=37  Identities=27%  Similarity=0.507  Sum_probs=23.0

Q ss_pred             CCCCCCceeehhhhhhhhccccc-cccccccccccchHHH
Q psy15639         48 ENQDENTWRCSICRRKLQSRAQP-VLSQNSTDSLLDVPVL   86 (135)
Q Consensus        48 ~~ed~~~WrCSvCRRK~~sr~qp-~~~q~stds~l~vpvl   86 (135)
                      .-..+++|+|+-|++|.+.-+|- ++.|-  -.+||-..+
T Consensus        25 ~~k~H~~s~Cp~C~kkraeLa~~~Flr~K--ktlLE~~ll   62 (104)
T PF15379_consen   25 TAKQHNSSQCPSCNKKRAELAQSAFLRRK--KTLLESLLL   62 (104)
T ss_pred             cccccCcccChHHHHHHHHHHHHHHHHHH--HHHHHHHHH
Confidence            44568999999999996654432 33332  235555544


No 128
>cd08448 PBP2_LTTR_aromatics_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Ve
Probab=27.73  E-value=43  Score=21.49  Aligned_cols=20  Identities=10%  Similarity=0.104  Sum_probs=16.1

Q ss_pred             ccchHHHHHHHhhccccccc
Q psy15639         80 LLDVPVLEALQRRHSDVKIG   99 (135)
Q Consensus        80 ~l~vpvlealqrrhsd~klg   99 (135)
                      .+=.+++..++++|++++|=
T Consensus        13 ~~l~~~l~~~~~~~P~i~i~   32 (197)
T cd08448          13 RGLPRILRAFRAEYPGIEVA   32 (197)
T ss_pred             HHHHHHHHHHHHHCCCCeEE
Confidence            34468999999999998874


No 129
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=27.53  E-value=19  Score=22.36  Aligned_cols=37  Identities=24%  Similarity=0.560  Sum_probs=23.7

Q ss_pred             CCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      -.|..|.|.|.-.++..-|.+-.               ..+...-.|.+|..
T Consensus         3 f~CP~C~~~~~~~~L~~H~~~~H---------------~~~~~~v~CPiC~~   39 (54)
T PF05605_consen    3 FTCPYCGKGFSESSLVEHCEDEH---------------RSESKNVVCPICSS   39 (54)
T ss_pred             cCCCCCCCccCHHHHHHHHHhHC---------------cCCCCCccCCCchh
Confidence            36888988777666555444322               23345678999975


No 130
>cd08450 PBP2_HcaR The C-terminal substrate binding domain of LysR-type transcriptional regulator HcaR in involved in 3-phenylpropionic acid catabolism, contains the type2 periplasmic binding fold. HcaR, a member of the LysR family of transcriptional regulators, controls the expression of the hcA1, A2, B, C, and D operon, encoding for the 3-phenylpropionate dioxygenase complex and 3-phenylpropionate-2',3'-dihydrodiol dehydrogenase, that oxidizes 3-phenylpropionate to 3-(2,3-dihydroxyphenyl) propionate.  Dioxygenases play an important role in protecting the cell against the toxic effects of dioxygen. The expression of hcaR is negatively auto-regulated, as for other members of the LysR family, and is strongly repressed in the presence of glucose. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=27.45  E-value=41  Score=21.78  Aligned_cols=22  Identities=23%  Similarity=0.250  Sum_probs=17.4

Q ss_pred             cccchHHHHHHHhhcccccccc
Q psy15639         79 SLLDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        79 s~l~vpvlealqrrhsd~klg~  100 (135)
                      ..+=.+++..++++|++++|-.
T Consensus        12 ~~~l~~~l~~~~~~~P~i~l~i   33 (196)
T cd08450          12 VQWLPEVLPILREEHPDLDVEL   33 (196)
T ss_pred             hhhHHHHHHHHHhhCCCcEEEE
Confidence            3344688999999999988765


No 131
>cd08452 PBP2_AlsR The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate.  Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 perip
Probab=27.33  E-value=41  Score=22.26  Aligned_cols=17  Identities=18%  Similarity=0.544  Sum_probs=14.8

Q ss_pred             hHHHHHHHhhccccccc
Q psy15639         83 VPVLEALQRRHSDVKIG   99 (135)
Q Consensus        83 vpvlealqrrhsd~klg   99 (135)
                      .|++.+++++|++++|=
T Consensus        16 ~~~l~~~~~~~P~v~i~   32 (197)
T cd08452          16 PPIVREYRKKFPSVKVE   32 (197)
T ss_pred             HHHHHHHHHHCCCcEEE
Confidence            68999999999988764


No 132
>KOG4477|consensus
Probab=27.28  E-value=24  Score=29.73  Aligned_cols=14  Identities=50%  Similarity=1.308  Sum_probs=11.2

Q ss_pred             CCCCCCceeehhhh
Q psy15639         48 ENQDENTWRCSICR   61 (135)
Q Consensus        48 ~~ed~~~WrCSvCR   61 (135)
                      .++|.+-|-||||-
T Consensus        18 p~~Deg~WdCsvCT   31 (228)
T KOG4477|consen   18 PNDDEGKWDCSVCT   31 (228)
T ss_pred             CccccCceeeeeee
Confidence            45788999999984


No 133
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substra
Probab=27.13  E-value=42  Score=21.67  Aligned_cols=20  Identities=15%  Similarity=0.210  Sum_probs=15.4

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=-+++++++++|++++|=.
T Consensus        15 ~l~~~l~~~~~~~P~i~l~i   34 (199)
T cd08451          15 LVPGLIRRFREAYPDVELTL   34 (199)
T ss_pred             ccHHHHHHHHHHCCCcEEEE
Confidence            43458999999999877654


No 134
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=27.08  E-value=21  Score=24.24  Aligned_cols=15  Identities=27%  Similarity=0.519  Sum_probs=9.0

Q ss_pred             CchhhccccCCCCcc
Q psy15639         12 NCRVCLKSFKPDDYS   26 (135)
Q Consensus        12 ~CRVClKsfkP~e~~   26 (135)
                      .|-+|.|-+.-+|-+
T Consensus         4 kC~lCdk~~~Id~~~   18 (56)
T PF09963_consen    4 KCILCDKKEEIDEDT   18 (56)
T ss_pred             EEEecCCEEEeccCC
Confidence            366677666666543


No 135
>cd08431 PBP2_HupR The C-terminal substrate binding domain of LysR-type transcriptional regulator, HupR, which regulates expression of the heme uptake receptor HupA; contains the type 2 periplasmic binding fold. HupR, a member of the LysR family, activates hupA transcription under low-iron conditions in the presence of hemin. The expression of many iron-uptake genes, such as hupA,  is regulated at the transcriptional level by iron and an iron-binding repressor protein called Fur (ferric uptake regulation). Under iron-abundant conditions with heme, the active Fur repressor protein represses transcription of the iron-uptake gene hupA, and prevents transcriptional activation via HupR. Under low-iron conditions with heme, the Fur repressor is inactive and transcription of the hupA is allowed. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, p
Probab=26.96  E-value=45  Score=21.74  Aligned_cols=20  Identities=10%  Similarity=0.152  Sum_probs=16.0

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=.|++.+++++|++++|=.
T Consensus        14 ~l~~~l~~~~~~~P~v~i~i   33 (195)
T cd08431          14 PLYPLIAEFYQLNKATRIRL   33 (195)
T ss_pred             HHHHHHHHHHHHCCCCceEE
Confidence            34689999999999987743


No 136
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=26.89  E-value=15  Score=22.31  Aligned_cols=32  Identities=22%  Similarity=0.606  Sum_probs=19.6

Q ss_pred             hhcccc-cccCCCCCCCCCceeehhhhhhhhcc
Q psy15639         36 VCEDCA-SYSKLDENQDENTWRCSICRRKLQSR   67 (135)
Q Consensus        36 VCEDCA-SYSkl~~~ed~~~WrCSvCRRK~~sr   67 (135)
                      .|++|. -+..+..-.+.....|..|+..-..|
T Consensus         7 ~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~~~~r   39 (42)
T PF09723_consen    7 RCEECGHEFEVLQSISEDDPVPCPECGSTEVRR   39 (42)
T ss_pred             EeCCCCCEEEEEEEcCCCCCCcCCCCCCCceEE
Confidence            355665 34444444447788999998844444


No 137
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=26.70  E-value=24  Score=18.83  Aligned_cols=14  Identities=29%  Similarity=0.795  Sum_probs=8.8

Q ss_pred             CCceeehhhhhhhh
Q psy15639         52 ENTWRCSICRRKLQ   65 (135)
Q Consensus        52 ~~~WrCSvCRRK~~   65 (135)
                      .+-++|+.|++.|.
T Consensus        25 ~~Cf~C~~C~~~L~   38 (39)
T smart00132       25 PECFKCSKCGKPLG   38 (39)
T ss_pred             ccCCCCcccCCcCc
Confidence            34467777776653


No 138
>KOG4443|consensus
Probab=26.62  E-value=22  Score=34.12  Aligned_cols=55  Identities=27%  Similarity=0.559  Sum_probs=38.4

Q ss_pred             CCCCCCchhhccccCCCCcc--chhhhhhhhhhcccccccCCCCCCCC--Cceeehhhh
Q psy15639          7 AARLGNCRVCLKSFKPDDYS--RVCYECHQKVCEDCASYSKLDENQDE--NTWRCSICR   61 (135)
Q Consensus         7 ~~r~g~CRVClKsfkP~e~~--~tC~eCqqkVCEDCASYSkl~~~ed~--~~WrCSvCR   61 (135)
                      ..+.-.|+||++-+.-.|.-  --|.-|+--+=--|-..|.....+..  ...+||.||
T Consensus       142 c~s~~~cPvc~~~Y~~~e~~~~~~c~~c~rwsh~~c~~~sdd~~~q~~vD~~~~CS~CR  200 (694)
T KOG4443|consen  142 CASLSYCPVCLIVYQDSESLPMVCCSICQRWSHGGCDGISDDKYMQAQVDLQYKCSTCR  200 (694)
T ss_pred             ccccccCchHHHhhhhccchhhHHHHHhcccccCCCCccchHHHHHHhhhhhcccceee
Confidence            34466899999999988877  66777776655555555555443332  468999999


No 139
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=26.25  E-value=23  Score=19.56  Aligned_cols=20  Identities=25%  Similarity=0.443  Sum_probs=16.2

Q ss_pred             Cccchhhhhhhhhhcccccc
Q psy15639         24 DYSRVCYECHQKVCEDCASY   43 (135)
Q Consensus        24 e~~~tC~eCqqkVCEDCASY   43 (135)
                      .....|.+|+..+|.+|..-
T Consensus        10 ~~~~fC~~~~~~iC~~C~~~   29 (39)
T cd00021          10 PLSLFCETDRALLCVDCDLS   29 (39)
T ss_pred             ceEEEeCccChhhhhhcChh
Confidence            44667999999999999754


No 140
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=26.11  E-value=20  Score=21.73  Aligned_cols=16  Identities=25%  Similarity=0.422  Sum_probs=7.4

Q ss_pred             CCceeehhhhhhhhcc
Q psy15639         52 ENTWRCSICRRKLQSR   67 (135)
Q Consensus        52 ~~~WrCSvCRRK~~sr   67 (135)
                      .....|.+|+-+|..|
T Consensus        19 ~~~~~Cd~cg~~L~qR   34 (36)
T PF05191_consen   19 KVEGVCDNCGGELVQR   34 (36)
T ss_dssp             SSTTBCTTTTEBEBEE
T ss_pred             CCCCccCCCCCeeEeC
Confidence            3344555555444433


No 141
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=25.99  E-value=38  Score=22.99  Aligned_cols=21  Identities=33%  Similarity=0.632  Sum_probs=17.4

Q ss_pred             CCCCCCCchhhccccCCCCcc
Q psy15639          6 PAARLGNCRVCLKSFKPDDYS   26 (135)
Q Consensus         6 p~~r~g~CRVClKsfkP~e~~   26 (135)
                      |..|--.|.+|.+-|.+++.+
T Consensus        35 ~~~rYngCPfC~~~~~~~~~~   55 (55)
T PF14447_consen   35 PGERYNGCPFCGTPFEFDDPF   55 (55)
T ss_pred             ChhhccCCCCCCCcccCCCCC
Confidence            567888999999999988753


No 142
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit
Probab=25.90  E-value=31  Score=34.44  Aligned_cols=49  Identities=24%  Similarity=0.611  Sum_probs=39.2

Q ss_pred             CCchhhcccc---CCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhh
Q psy15639         11 GNCRVCLKSF---KPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKL   64 (135)
Q Consensus        11 g~CRVClKsf---kP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~   64 (135)
                      ..|+||+--.   .-+|++--|.||.--||-.|-.|-+-..     +=.|..|.-.-
T Consensus        18 qiCqICGD~vg~~~~Ge~FVAC~eC~FPVCrpCYEYEr~eG-----~q~CPqCktrY   69 (1079)
T PLN02638         18 QVCQICGDNVGKTVDGEPFVACDVCAFPVCRPCYEYERKDG-----NQSCPQCKTKY   69 (1079)
T ss_pred             ceeeecccccCcCCCCCEEEEeccCCCccccchhhhhhhcC-----CccCCccCCch
Confidence            4899998654   4578999999999999999999987655     34688896433


No 143
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=25.89  E-value=62  Score=22.78  Aligned_cols=56  Identities=21%  Similarity=0.526  Sum_probs=27.9

Q ss_pred             ccc--cccCCCCCCCCCceeehhhhhhhhccccccccccccccccchHHHHHHHhhccccccccCCCC
Q psy15639         39 DCA--SYSKLDENQDENTWRCSICRRKLQSRAQPVLSQNSTDSLLDVPVLEALQRRHSDVKIGSANSG  104 (135)
Q Consensus        39 DCA--SYSkl~~~ed~~~WrCSvCRRK~~sr~qp~~~q~stds~l~vpvlealqrrhsd~klg~~~~~  104 (135)
                      ||-  +|++    |+..+-.| +|++.|.-.--+|+.+--+     .+=-..+-|+--+.+.|..+..
T Consensus         7 ~Cgr~lya~----e~~kTkkC-~CG~~l~vk~~rIl~~~~~-----~~eA~eiVrklQ~e~~G~~~ft   64 (68)
T PF09082_consen    7 DCGRYLYAK----EGAKTKKC-VCGKTLKVKERRILARAEN-----AEEASEIVRKLQEEKYGGTQFT   64 (68)
T ss_dssp             TTS--EEEE----TT-SEEEE-TTTEEEE--SSS-BS--SS-----HHHHHHHHHHHSS---S-TTSS
T ss_pred             cCCCEEEec----CCcceeEe-cCCCeeeeeeEEEEEecCC-----HHHHHHHHHHHHHHhccccccc
Confidence            564  4544    45688999 9999998776667765322     1222345555556677765543


No 144
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=24.96  E-value=30  Score=20.62  Aligned_cols=24  Identities=25%  Similarity=0.526  Sum_probs=12.4

Q ss_pred             hhcccccccCCCCCCCCCceeehhhhh
Q psy15639         36 VCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus        36 VCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      -|+-|.|-..+   .|...+-|+.|..
T Consensus         4 ~Cp~C~se~~y---~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTY---EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----E---E-SSSEEETTTTE
T ss_pred             CCCCCCCccee---ccCCEEeCCcccc
Confidence            47778776666   5688888888864


No 145
>PRK14554 putative pseudouridylate synthase; Provisional
Probab=24.69  E-value=46  Score=29.64  Aligned_cols=49  Identities=29%  Similarity=0.594  Sum_probs=37.0

Q ss_pred             ccCCCCCCCCCceeehhhhhhhhccccccccccccccccchHHHHHHHhhccccccccCC
Q psy15639         43 YSKLDENQDENTWRCSICRRKLQSRAQPVLSQNSTDSLLDVPVLEALQRRHSDVKIGSAN  102 (135)
Q Consensus        43 YSkl~~~ed~~~WrCSvCRRK~~sr~qp~~~q~stds~l~vpvlealqrrhsd~klg~~~  102 (135)
                      |-|+.-.=-.+.|-|.-|++|         ..+|-+.++.=||++++.  -.++++=++|
T Consensus       197 Y~Kl~R~ipQT~W~~~~g~~~---------~~~SVeelI~~~i~~~f~--~~~~~fh~aG  245 (422)
T PRK14554        197 YRKLVRGIPQTRWPCRKCKKQ---------YPESVEELIAKPVIEAFG--GEDAVFHGAG  245 (422)
T ss_pred             EeeccCCCCCCccccCCCCCC---------CCCCHHHHHHHHHHHHhC--CCceEEecCC
Confidence            667776677899999999988         568889999999999886  2344444433


No 146
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=24.52  E-value=21  Score=26.69  Aligned_cols=9  Identities=56%  Similarity=1.268  Sum_probs=6.8

Q ss_pred             hhhhhcccc
Q psy15639         33 HQKVCEDCA   41 (135)
Q Consensus        33 qqkVCEDCA   41 (135)
                      .|.+|-|||
T Consensus        91 g~~iC~DCa   99 (99)
T PF13834_consen   91 GQPICRDCA   99 (99)
T ss_pred             CCEeccccC
Confidence            477888886


No 147
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=24.47  E-value=39  Score=29.17  Aligned_cols=33  Identities=18%  Similarity=0.405  Sum_probs=25.1

Q ss_pred             hhcccccccCCCCCCCCCceeehhhhhhhhccc
Q psy15639         36 VCEDCASYSKLDENQDENTWRCSICRRKLQSRA   68 (135)
Q Consensus        36 VCEDCASYSkl~~~ed~~~WrCSvCRRK~~sr~   68 (135)
                      .|++|-...+.+.-+.....+|.-|+-++..+.
T Consensus        15 ~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~~~   47 (403)
T TIGR00155        15 LCSQCDMLVALPRIESGQKAACPRCGTTLTVGW   47 (403)
T ss_pred             eCCCCCCcccccCCCCCCeeECCCCCCCCcCCC
Confidence            477777666666656677899999999997665


No 148
>KOG1571|consensus
Probab=24.38  E-value=26  Score=31.06  Aligned_cols=44  Identities=27%  Similarity=0.719  Sum_probs=28.0

Q ss_pred             CCCchhhccccCCCCccchhhhhhhhhh-cccccccCCCCCCCCCceeehhhhhhhhcc
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECHQKVC-EDCASYSKLDENQDENTWRCSICRRKLQSR   67 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCqqkVC-EDCASYSkl~~~ed~~~WrCSvCRRK~~sr   67 (135)
                      ...|=||+-.++--.|    .+|.|..| .+|+  +.+..        |.|||+.+..-
T Consensus       305 p~lcVVcl~e~~~~~f----vpcGh~ccct~cs--~~l~~--------CPvCR~rI~~~  349 (355)
T KOG1571|consen  305 PDLCVVCLDEPKSAVF----VPCGHVCCCTLCS--KHLPQ--------CPVCRQRIRLV  349 (355)
T ss_pred             CCceEEecCCccceee----ecCCcEEEchHHH--hhCCC--------CchhHHHHHHH
Confidence            4689999977665332    45666554 4443  33333        99999988653


No 149
>cd08437 PBP2_MleR The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold. MleR, a transcription activator of malolactic fermentation system, is found in gram-positive bacteria and belongs to the lysR family of bacterial transcriptional regulators. The mleR gene is required for the expression and induction of malolactic fermentation. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase dom
Probab=24.36  E-value=48  Score=21.65  Aligned_cols=20  Identities=10%  Similarity=0.051  Sum_probs=16.0

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=.+++.+++++|++++|=.
T Consensus        14 ~l~~~l~~~~~~~P~v~i~~   33 (198)
T cd08437          14 YFPKLAKDLIKTGLMIQIDT   33 (198)
T ss_pred             HhHHHHHHHHHhCCceEEEE
Confidence            44688999999999887654


No 150
>smart00868 zf-AD Zinc-finger associated domain (zf-AD). The zf-AD domain, also known as ZAD, forms an atypical treble-cleft-like zinc co-ordinating fold. The zf-AD domain is thought to be involved in mediating dimer formation, but does not bind to DNA.
Probab=24.27  E-value=31  Score=19.79  Aligned_cols=10  Identities=40%  Similarity=0.919  Sum_probs=7.5

Q ss_pred             CchhhccccC
Q psy15639         12 NCRVCLKSFK   21 (135)
Q Consensus        12 ~CRVClKsfk   21 (135)
                      .||+|++...
T Consensus         1 ~Cr~C~~~~~   10 (73)
T smart00868        1 VCRLCLSEGE   10 (73)
T ss_pred             CccccCCCCC
Confidence            4999988653


No 151
>PRK14298 chaperone protein DnaJ; Provisional
Probab=24.12  E-value=39  Score=28.55  Aligned_cols=47  Identities=26%  Similarity=0.689  Sum_probs=33.2

Q ss_pred             CCCCchhhc-cccCCCCccchhhhhh------------------hhhhcccccccCCCCCCCCCceeehhhh
Q psy15639          9 RLGNCRVCL-KSFKPDDYSRVCYECH------------------QKVCEDCASYSKLDENQDENTWRCSICR   61 (135)
Q Consensus         9 r~g~CRVCl-KsfkP~e~~~tC~eCq------------------qkVCEDCASYSkl~~~ed~~~WrCSvCR   61 (135)
                      |...|..|. ++.+++...++|..|.                  |..|..|..--+...      =.|..|+
T Consensus       140 r~~~C~~C~G~G~~~~~~~~~C~~C~G~G~~~~~~~~~~g~~~~~~~C~~C~G~G~~~~------~~C~~C~  205 (377)
T PRK14298        140 RAERCSTCSGTGAKPGTSPKRCPTCGGTGQVTTTRSTPLGQFVTTTTCSTCHGRGQVIE------SPCPVCS  205 (377)
T ss_pred             eeccCCCCCCCcccCCCCCCcCCCCCCccEEEEEEecCceeEEEEEeCCCCCCCCcccC------CCCCCCC
Confidence            456677774 5667777778888886                  457999988776543      1488887


No 152
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription]
Probab=24.01  E-value=38  Score=27.04  Aligned_cols=40  Identities=18%  Similarity=0.467  Sum_probs=24.9

Q ss_pred             CCchhhccccCCCCccchhhhhhhhhhcccccccCCCCCCC
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQD   51 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqkVCEDCASYSkl~~~ed   51 (135)
                      ..|-+|++... .=+.-.=..=.-.||.|||-|-+-.....
T Consensus         4 ~~CEiCG~~i~-~~~~v~vegsel~VC~~Cak~G~~~~~~~   43 (165)
T COG1813           4 MGCELCGREID-KPIKVKVEGAELTVCDDCAKFGTAAKTAS   43 (165)
T ss_pred             cceeccccccC-CCeeEEeecceeehhHHHHHhccCccccC
Confidence            34999999887 22222223345579999998875544333


No 153
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=23.85  E-value=54  Score=21.10  Aligned_cols=20  Identities=35%  Similarity=0.496  Sum_probs=16.2

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=.+++..++++|++++|=.
T Consensus        14 ~l~~~l~~~~~~~P~i~l~~   33 (195)
T cd08427          14 LLPRALARLRRRHPDLEVHI   33 (195)
T ss_pred             HhHHHHHHHHHHCCCceEEE
Confidence            34689999999999988754


No 154
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=23.69  E-value=29  Score=28.30  Aligned_cols=9  Identities=56%  Similarity=1.010  Sum_probs=6.3

Q ss_pred             hhhcccccc
Q psy15639         35 KVCEDCASY   43 (135)
Q Consensus        35 kVCEDCASY   43 (135)
                      -|||.||--
T Consensus        27 ~vCe~Ca~~   35 (176)
T COG3880          27 YVCETCAKP   35 (176)
T ss_pred             ehhhcCCCc
Confidence            378888754


No 155
>PRK14282 chaperone protein DnaJ; Provisional
Probab=23.59  E-value=37  Score=28.40  Aligned_cols=49  Identities=27%  Similarity=0.651  Sum_probs=33.8

Q ss_pred             CCCCCchhhc-cccCCCCccchhhhhh------------------hhhhcccccccCCCCCCCCCceeehhhhh
Q psy15639          8 ARLGNCRVCL-KSFKPDDYSRVCYECH------------------QKVCEDCASYSKLDENQDENTWRCSICRR   62 (135)
Q Consensus         8 ~r~g~CRVCl-KsfkP~e~~~tC~eCq------------------qkVCEDCASYSkl~~~ed~~~WrCSvCRR   62 (135)
                      .|...|..|. .+++++.-.++|..|.                  +..|..|...-+...      =.|+.|.-
T Consensus       150 ~r~~~C~~C~G~G~~~~~~~~~C~~C~G~G~~~~~~~~~~G~~~~~~~C~~C~G~G~~~~------~~C~~C~G  217 (369)
T PRK14282        150 DRYETCPHCGGTGVEPGSGYVTCPKCHGTGRIREERRSFFGVFVSERTCERCGGTGKIPG------EYCHECGG  217 (369)
T ss_pred             eecccCCCCCccCCCCCCCCcCCCCCCCcCEEEEEEEccCcceEEEEECCCCCCcceeCC------CCCCCCCC
Confidence            3556677774 4566666667888884                  457999988777643      24999974


No 156
>PRK12268 methionyl-tRNA synthetase; Reviewed
Probab=23.58  E-value=35  Score=29.30  Aligned_cols=46  Identities=11%  Similarity=0.227  Sum_probs=29.5

Q ss_pred             CchhhccccCCCCccchhhhhh-----hhhhcccccccCCCCCCCCCceee
Q psy15639         12 NCRVCLKSFKPDDYSRVCYECH-----QKVCEDCASYSKLDENQDENTWRC   57 (135)
Q Consensus        12 ~CRVClKsfkP~e~~~tC~eCq-----qkVCEDCASYSkl~~~ed~~~WrC   57 (135)
                      -|.-|...+....+.-+|..|.     ...||.|+.+-+..+-.++..|+|
T Consensus       127 ~~~~~~~~l~~~~v~g~cp~c~~~~~~G~~ce~cg~~~~~~~l~~p~~~~~  177 (556)
T PRK12268        127 YCPSDGRFLPDRYVEGTCPYCGYEGARGDQCDNCGALLDPTDLINPRSKIS  177 (556)
T ss_pred             ecCCCCcCcCccceeccCCCCCCcccCCchhhhccccCChHHhcCCccccC
Confidence            3566666555555556677776     667888888766655555555554


No 157
>cd08478 PBP2_CrgA The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene wh
Probab=23.53  E-value=53  Score=21.50  Aligned_cols=18  Identities=17%  Similarity=0.512  Sum_probs=15.4

Q ss_pred             hHHHHHHHhhcccccccc
Q psy15639         83 VPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        83 vpvlealqrrhsd~klg~  100 (135)
                      -+++.+++++|++++|-.
T Consensus        19 ~~~l~~f~~~~P~v~i~~   36 (199)
T cd08478          19 APLIAKFRERYPDIELEL   36 (199)
T ss_pred             HHHHHHHHHHCCCeEEEE
Confidence            468999999999988865


No 158
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=23.47  E-value=16  Score=20.27  Aligned_cols=17  Identities=29%  Similarity=0.825  Sum_probs=14.0

Q ss_pred             CCchhhccccCCCCccc
Q psy15639         11 GNCRVCLKSFKPDDYSR   27 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~   27 (135)
                      -.|.+|+..|.|+.+.+
T Consensus         3 ~~C~~CgR~F~~~~l~~   19 (25)
T PF13913_consen    3 VPCPICGRKFNPDRLEK   19 (25)
T ss_pred             CcCCCCCCEECHHHHHH
Confidence            36999999999987654


No 159
>cd08481 PBP2_GcdR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators GcdR-like, contains the type 2 periplasmic binding fold. GcdR is involved in the glutaconate/glutarate-specific activation of the Pg promoter driving expression of a glutaryl-CoA dehydrogenase-encoding gene (gcdH). The GcdH protein is essential for the anaerobic catabolism of many aromatic compounds and some alicyclic and dicarboxylic acids.  The structural topology of this substrate-binding domain is most similar to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplas
Probab=23.43  E-value=45  Score=21.44  Aligned_cols=17  Identities=29%  Similarity=0.671  Sum_probs=14.3

Q ss_pred             hHHHHHHHhhccccccc
Q psy15639         83 VPVLEALQRRHSDVKIG   99 (135)
Q Consensus        83 vpvlealqrrhsd~klg   99 (135)
                      .|++.+++++|++++|=
T Consensus        16 ~~~l~~f~~~~P~i~i~   32 (194)
T cd08481          16 IPRLPDFLARHPDITVN   32 (194)
T ss_pred             HhhhhHHHHHCCCceEE
Confidence            47788999999998874


No 160
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=23.29  E-value=41  Score=18.08  Aligned_cols=13  Identities=31%  Similarity=0.797  Sum_probs=9.8

Q ss_pred             CchhhccccCCCC
Q psy15639         12 NCRVCLKSFKPDD   24 (135)
Q Consensus        12 ~CRVClKsfkP~e   24 (135)
                      .|-+|.|.|+-+.
T Consensus         3 ~C~~C~k~f~~~~   15 (27)
T PF12171_consen    3 YCDACDKYFSSEN   15 (27)
T ss_dssp             BBTTTTBBBSSHH
T ss_pred             CcccCCCCcCCHH
Confidence            5889999987543


No 161
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold. GltC, a member of the LysR family of bacterial transcriptional factors, activates the expression of gltA gene of glutamate synthase operon and is essential for cell growth in the absence of glutamate. Glutamate synthase is a heterodimeric protein that encoded by gltA and gltB, whose expression is subject to nutritional regulation. GltC also negatively auto-regulates its own expression. This substrate-binding domain has strong homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, 
Probab=23.19  E-value=54  Score=20.88  Aligned_cols=20  Identities=15%  Similarity=0.245  Sum_probs=15.7

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=.|++..++++|++++|=.
T Consensus        14 ~l~~~l~~~~~~~P~i~i~i   33 (195)
T cd08434          14 LVPDLIRAFRKEYPNVTFEL   33 (195)
T ss_pred             hhHHHHHHHHHhCCCeEEEE
Confidence            44678999999999887653


No 162
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=23.17  E-value=46  Score=18.38  Aligned_cols=20  Identities=25%  Similarity=0.723  Sum_probs=11.6

Q ss_pred             chhhccccCCCCccchhhhhhh
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQ   34 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqq   34 (135)
                      |..|++.+.++.  +.|..|..
T Consensus         2 Cp~CG~~~~~~~--~fC~~CG~   21 (23)
T PF13240_consen    2 CPNCGAEIEDDA--KFCPNCGT   21 (23)
T ss_pred             CcccCCCCCCcC--cchhhhCC
Confidence            666777765543  34666654


No 163
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C. The last step in methanogenesis leaves two coenzymes of methanogenesis, CoM and CoB, linked by a disulfide bond. Members of this protein family are the C subunit of the enzyme that reduces the heterodisulfide to CoB-SH and CoM-SH. Similar enzyme complex subunits are found in various other species, but likely act on a different substrate.
Probab=23.14  E-value=34  Score=24.66  Aligned_cols=13  Identities=31%  Similarity=1.099  Sum_probs=10.1

Q ss_pred             CCCCceeehhhhh
Q psy15639         50 QDENTWRCSICRR   62 (135)
Q Consensus        50 ed~~~WrCSvCRR   62 (135)
                      ++...|+|..|++
T Consensus        41 ~~~~~~~C~~Cg~   53 (144)
T TIGR03290        41 SDDDLWMCTTCYT   53 (144)
T ss_pred             cCCCCCcCcCcCc
Confidence            4568899998875


No 164
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=22.78  E-value=37  Score=23.98  Aligned_cols=18  Identities=44%  Similarity=0.947  Sum_probs=14.8

Q ss_pred             CCchhhccccCCCCccchhh
Q psy15639         11 GNCRVCLKSFKPDDYSRVCY   30 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~   30 (135)
                      .-|-||.|++-|||.  +|.
T Consensus         9 ~HC~VCg~aIp~de~--~CS   26 (64)
T COG4068           9 RHCVVCGKAIPPDEQ--VCS   26 (64)
T ss_pred             ccccccCCcCCCccc--hHH
Confidence            469999999999985  454


No 165
>PRK11595 DNA utilization protein GntX; Provisional
Probab=22.63  E-value=51  Score=25.49  Aligned_cols=30  Identities=23%  Similarity=0.822  Sum_probs=18.7

Q ss_pred             CCchhhccccCCCCccchhhhhhhh------hhcccc
Q psy15639         11 GNCRVCLKSFKPDDYSRVCYECHQK------VCEDCA   41 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~tC~eCqqk------VCEDCA   41 (135)
                      ..|-+|.+.+...+. .+|..|..+      .|..|.
T Consensus         6 ~~C~~C~~~~~~~~~-~lC~~C~~~l~~~~~~C~~Cg   41 (227)
T PRK11595          6 GLCWLCRMPLALSHW-GICSVCSRALRTLKTCCPQCG   41 (227)
T ss_pred             CcCccCCCccCCCCC-cccHHHHhhCCcccCcCccCC
Confidence            358888887654432 367777644      377775


No 166
>PRK08359 transcription factor; Validated
Probab=22.55  E-value=25  Score=27.86  Aligned_cols=34  Identities=21%  Similarity=0.554  Sum_probs=23.2

Q ss_pred             CCchhhccccCCCCccch-hhhhhhhhhcccc-cccC
Q psy15639         11 GNCRVCLKSFKPDDYSRV-CYECHQKVCEDCA-SYSK   45 (135)
Q Consensus        11 g~CRVClKsfkP~e~~~t-C~eCqqkVCEDCA-SYSk   45 (135)
                      -.|-+|++-++ +...++ =.+=.-.||.+|| -|-+
T Consensus         7 ~~CEiCG~~i~-g~~~~v~ieGael~VC~~Ca~k~G~   42 (176)
T PRK08359          7 RYCEICGAEIR-GPGHRIRIEGAELLVCDRCYEKYGR   42 (176)
T ss_pred             ceeecCCCccC-CCCeEEEEcCeEEehHHHHHHHhCC
Confidence            34999999986 443333 2233457999999 8877


No 167
>TIGR00398 metG methionyl-tRNA synthetase. The methionyl-tRNA synthetase (metG) is a class I amino acyl-tRNA ligase. This model appears to recognize the methionyl-tRNA synthetase of every species, including eukaryotic cytosolic and mitochondrial forms. The UPGMA difference tree calculated after search and alignment according to this model shows an unusual deep split between two families of MetG. One family contains forms from the Archaea, yeast cytosol, spirochetes, and E. coli, among others. The other family includes forms from yeast mitochondrion, Synechocystis sp., Bacillus subtilis, the Mycoplasmas, Aquifex aeolicus, and Helicobacter pylori. The E. coli enzyme is homodimeric, although monomeric forms can be prepared that are fully active. Activity of this enzyme in bacteria includes aminoacylation of fMet-tRNA with Met; subsequent formylation of the Met to fMet is catalyzed by a separate enzyme. Note that the protein from Aquifex aeolicus is split into an alpha (large) and beta (sma
Probab=22.17  E-value=35  Score=29.11  Aligned_cols=50  Identities=26%  Similarity=0.482  Sum_probs=25.8

Q ss_pred             chhhccccCCCCccchhhhhhh-----hhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639         13 CRVCLKSFKPDDYSRVCYECHQ-----KVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus        13 CRVClKsfkP~e~~~tC~eCqq-----kVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      |..|...+...++.-+|..|..     .+||.|..+....+   ...=+|..|+..+.
T Consensus       123 ~~~~~~~l~~~~v~g~cp~c~~~~~~g~~ce~cg~~~~~~~---l~~p~~~~~~~~~e  177 (530)
T TIGR00398       123 CPECEMFLPDRYVEGTCPKCGSEDARGDHCEVCGRHLEPTE---LINPRCKICGAKPE  177 (530)
T ss_pred             cCCCCcCCchhhhcCCCCCCCCcccccchhhhccccCCHHH---hcCCccccCCCcce
Confidence            3344433333334445555553     47888887654433   44445555654443


No 168
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=21.96  E-value=32  Score=22.35  Aligned_cols=31  Identities=19%  Similarity=0.306  Sum_probs=19.8

Q ss_pred             CCCCchhhccccCCCCccchhhhhhhhhhcccc
Q psy15639          9 RLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCA   41 (135)
Q Consensus         9 r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDCA   41 (135)
                      ....|.||.|.|....|....+  .+.|--.|+
T Consensus        77 ~~~~C~vC~k~l~~~~f~~~p~--~~v~H~~C~  107 (109)
T PF10367_consen   77 ESTKCSVCGKPLGNSVFVVFPC--GHVVHYSCI  107 (109)
T ss_pred             CCCCccCcCCcCCCceEEEeCC--CeEEecccc
Confidence            3457999999998866555432  255554443


No 169
>cd08476 PBP2_CrgA_like_7 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 7. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=21.58  E-value=62  Score=20.73  Aligned_cols=18  Identities=28%  Similarity=0.600  Sum_probs=15.1

Q ss_pred             hHHHHHHHhhcccccccc
Q psy15639         83 VPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        83 vpvlealqrrhsd~klg~  100 (135)
                      .|++..++++|++++|=.
T Consensus        15 ~~~l~~~~~~~P~v~i~~   32 (197)
T cd08476          15 LPVLAAFMQRYPEIELDL   32 (197)
T ss_pred             HHHHHHHHHHCCCeEEEE
Confidence            489999999999977654


No 170
>cd08449 PBP2_XapR The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold. In Escherichia coli, XapR is a positive regulator for the expression of xapA gene, encoding xanthosine phosphorylase, and xapB gene, encoding a polypeptide similar to the nucleotide transport protein NupG. As an operon, the expression of both xapA and xapB is fully dependent on the presence of both XapR and the inducer xanthosine. Expression of the xapR is constitutive but not auto-regulated, unlike many other LysR family proteins. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their 
Probab=21.50  E-value=61  Score=20.86  Aligned_cols=20  Identities=20%  Similarity=0.213  Sum_probs=16.0

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=.|++..++++|++++|-.
T Consensus        14 ~l~~~l~~~~~~~P~i~i~~   33 (197)
T cd08449          14 GLGPALRRFKRQYPNVTVRF   33 (197)
T ss_pred             hHHHHHHHHHHHCCCeEEEE
Confidence            44688999999999988743


No 171
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=21.38  E-value=38  Score=30.02  Aligned_cols=45  Identities=31%  Similarity=0.577  Sum_probs=27.0

Q ss_pred             cchhhhhhhhhhcccccccCC-----------CC-------CCCC-Cceeehhhhhhhhccccc
Q psy15639         26 SRVCYECHQKVCEDCASYSKL-----------DE-------NQDE-NTWRCSICRRKLQSRAQP   70 (135)
Q Consensus        26 ~~tC~eCqqkVCEDCASYSkl-----------~~-------~ed~-~~WrCSvCRRK~~sr~qp   70 (135)
                      -..|-+|++..|.+|.+.--.           +.       +-=. +-|.|.+|.-.|+-+...
T Consensus         5 L~fC~~C~~irc~~c~~~Ei~~~yCp~CL~~~p~~e~~~~~nrC~r~Cf~CP~C~~~L~~~~~~   68 (483)
T PF05502_consen    5 LYFCEHCHKIRCPRCVSEEIDSYYCPNCLFEVPSSEARSEKNRCSRNCFDCPICFSPLSVRASD   68 (483)
T ss_pred             ceecccccccCChhhcccccceeECccccccCChhhheeccceeccccccCCCCCCcceeEecc
Confidence            356888888888888764211           11       1111 447777887777665533


No 172
>KOG3576|consensus
Probab=21.06  E-value=29  Score=29.85  Aligned_cols=110  Identities=24%  Similarity=0.407  Sum_probs=57.4

Q ss_pred             CCCCCchhhccccCCCCccchhhhhhh----hhhcccccccCCC--------CCCCCCceeehhhhhhhhcccccccccc
Q psy15639          8 ARLGNCRVCLKSFKPDDYSRVCYECHQ----KVCEDCASYSKLD--------ENQDENTWRCSICRRKLQSRAQPVLSQN   75 (135)
Q Consensus         8 ~r~g~CRVClKsfkP~e~~~tC~eCqq----kVCEDCASYSkl~--------~~ed~~~WrCSvCRRK~~sr~qp~~~q~   75 (135)
                      .-.-.||||.|.|.-.-.-..=-.|..    -.|.-|.---.++        ..-.-..++|++|.+....|-       
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrc-------  187 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRC-------  187 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhc-------
Confidence            334579999999975433222223332    2355554211111        112234689999998776654       


Q ss_pred             ccccc----cchHHHHHHHhhcccccc----ccCCCCCCC--CCCCCCCCCCccccccC
Q psy15639         76 STDSL----LDVPVLEALQRRHSDVKI----GSANSGAHP--ANQGLAPPRSPELRRHS  124 (135)
Q Consensus        76 stds~----l~vpvlealqrrhsd~kl----g~~~~~~~~--~g~glapprspelrrhs  124 (135)
                      |-+|-    -.|+-.-|...|-..+-+    |.++.....  +--.++-|-||-|++-|
T Consensus       188 sleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~SpallKfs  246 (267)
T KOG3576|consen  188 SLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPALLKFS  246 (267)
T ss_pred             cHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHHHHHHH
Confidence            22332    246666666666544433    443332222  33445667777776643


No 173
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=21.06  E-value=38  Score=19.73  Aligned_cols=12  Identities=25%  Similarity=0.775  Sum_probs=9.5

Q ss_pred             CCCCceeehhhh
Q psy15639         50 QDENTWRCSICR   61 (135)
Q Consensus        50 ed~~~WrCSvCR   61 (135)
                      ..+.++||++|.
T Consensus        12 ~GA~sVrCa~C~   23 (25)
T PF06943_consen   12 RGAPSVRCACCH   23 (25)
T ss_pred             CCCCCeECCccC
Confidence            347799999995


No 174
>cd08470 PBP2_CrgA_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene
Probab=20.98  E-value=64  Score=20.96  Aligned_cols=19  Identities=11%  Similarity=0.324  Sum_probs=15.5

Q ss_pred             chHHHHHHHhhcccccccc
Q psy15639         82 DVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        82 ~vpvlealqrrhsd~klg~  100 (135)
                      =.|++..++++|+++.|=.
T Consensus        16 l~~~l~~f~~~~P~v~l~i   34 (197)
T cd08470          16 IAPLVNDFMQRYPKLEVDI   34 (197)
T ss_pred             HHHHHHHHHHHCCCeEEEE
Confidence            3588999999999987753


No 175
>KOG2041|consensus
Probab=20.93  E-value=72  Score=32.06  Aligned_cols=56  Identities=27%  Similarity=0.635  Sum_probs=37.7

Q ss_pred             CCCCCCCCCchhhccccCCCCccchhhhhhhhhhccc-ccccCCCCCCCCCceeehhhhhhhh
Q psy15639          4 DKPAARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDC-ASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus         4 ~kp~~r~g~CRVClKsfkP~e~~~tC~eCqqkVCEDC-ASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      -.|.+---+|-+|+--+.  ++.-.|.||+-|. .-| ||=+-.++   ..-|-|++|.-...
T Consensus      1111 ~d~~~~~vdc~~cg~~i~--~~~~~c~ec~~kf-P~CiasG~pIt~---~~fWlC~~CkH~a~ 1167 (1189)
T KOG2041|consen 1111 VDPNSAKVDCSVCGAKID--PYDLQCSECQTKF-PVCIASGRPITD---NIFWLCPRCKHRAH 1167 (1189)
T ss_pred             CCCCccceeeeecCCcCC--ccCCCChhhcCcC-ceeeccCCcccc---ceEEEccccccccc
Confidence            345555678999987554  5666799999885 334 34343444   55999999976543


No 176
>PLN02195 cellulose synthase A
Probab=20.92  E-value=40  Score=33.32  Aligned_cols=51  Identities=20%  Similarity=0.474  Sum_probs=39.5

Q ss_pred             CCCchhhcccc---CCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhhhh
Q psy15639         10 LGNCRVCLKSF---KPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQ   65 (135)
Q Consensus        10 ~g~CRVClKsf---kP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK~~   65 (135)
                      +..|.||+--.   +-+|++--|.||.--||--|-.|-+-+.     +=.|..|.-.-.
T Consensus         6 ~~~c~~cgd~~~~~~~g~~fvaC~eC~~pvCrpCyeyer~eg-----~q~CpqCkt~Yk   59 (977)
T PLN02195          6 APICATCGEEVGVDSNGEAFVACHECSYPLCKACLEYEIKEG-----RKVCLRCGGPYD   59 (977)
T ss_pred             CccceecccccCcCCCCCeEEEeccCCCccccchhhhhhhcC-----CccCCccCCccc
Confidence            45799998744   3468999999999999999999987655     335888865443


No 177
>cd08444 PBP2_Cbl The C-terminal substrate binding domain of LysR-type transcriptional regulator Cbl, which is required for expression of sulfate starvation-inducible (ssi) genes, contains the type 2 periplasmic binding fold. Cbl is a member of the LysR transcriptional regulators that comprise the largest family of prokaryotic transcription factor. Cbl shows high sequence similarity to CysB, the LysR-type transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the function of Cbl is required for expression of sulfate starvation-inducible (ssi) genes, coupled with the biosynthesis of cysteine from the organic sulfur sources (sulfonates). The ssi genes include the ssuEADCB and tauABCD operons encoding uptake systems for organosulfur compounds, aliphatic sulfonates, and taurine. The genes in these operons encode an ABC-type transport system required for uptake of aliphatic sulfonates and a desulfonati
Probab=20.82  E-value=64  Score=21.45  Aligned_cols=20  Identities=15%  Similarity=0.112  Sum_probs=15.9

Q ss_pred             cchHHHHHHHhhcccccccc
Q psy15639         81 LDVPVLEALQRRHSDVKIGS  100 (135)
Q Consensus        81 l~vpvlealqrrhsd~klg~  100 (135)
                      +=-+++.+++++|++++|-.
T Consensus        14 ~l~~~l~~~~~~~P~v~l~i   33 (198)
T cd08444          14 ALPWVVQAFKEQFPNVHLVL   33 (198)
T ss_pred             hhhHHHHHHHHHCCCeEEEE
Confidence            34578999999999888754


No 178
>PF15261 DUF4591:  Domain of unknown function (DUF4591)
Probab=20.40  E-value=79  Score=24.00  Aligned_cols=21  Identities=33%  Similarity=0.515  Sum_probs=16.3

Q ss_pred             cccccccchHHHHHHHhhccc
Q psy15639         75 NSTDSLLDVPVLEALQRRHSD   95 (135)
Q Consensus        75 ~stds~l~vpvlealqrrhsd   95 (135)
                      ..-.++.++..||.||.||-.
T Consensus       100 ~~e~~~~~ls~Le~L~~RHe~  120 (134)
T PF15261_consen  100 QDEASLPELSELEMLEQRHER  120 (134)
T ss_pred             ccCCCcchhHHHHHHHHHHHH
Confidence            344567788899999999954


No 179
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=20.37  E-value=55  Score=18.20  Aligned_cols=10  Identities=30%  Similarity=1.182  Sum_probs=8.0

Q ss_pred             Cceeehhhhh
Q psy15639         53 NTWRCSICRR   62 (135)
Q Consensus        53 ~~WrCSvCRR   62 (135)
                      ..|.|+.|.-
T Consensus         3 g~W~C~~C~~   12 (30)
T PF00641_consen    3 GDWKCPSCTF   12 (30)
T ss_dssp             SSEEETTTTE
T ss_pred             cCccCCCCcC
Confidence            4799999963


No 180
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=20.25  E-value=73  Score=22.24  Aligned_cols=27  Identities=26%  Similarity=0.498  Sum_probs=18.2

Q ss_pred             CCCCCCCCCCCchhhccccCCCCccchhh
Q psy15639          2 KSDKPAARLGNCRVCLKSFKPDDYSRVCY   30 (135)
Q Consensus         2 ~~~kp~~r~g~CRVClKsfkP~e~~~tC~   30 (135)
                      .+.++......|.+|..++.  |.++.|.
T Consensus        41 q~~~~~~~~~~C~~C~R~L~--d~~~fCS   67 (72)
T PF04640_consen   41 QSRPSKGSGNICETCHRSLQ--DPYRFCS   67 (72)
T ss_pred             cCCCCCCCCCccCCCCCCCC--CCCeEEe
Confidence            34444456788999999987  3366663


No 181
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=20.24  E-value=58  Score=19.39  Aligned_cols=34  Identities=21%  Similarity=0.341  Sum_probs=17.0

Q ss_pred             CCCCCchhhccccC-CCCccchhhhhhhhhhcccc
Q psy15639          8 ARLGNCRVCLKSFK-PDDYSRVCYECHQKVCEDCA   41 (135)
Q Consensus         8 ~r~g~CRVClKsfk-P~e~~~tC~eCqqkVCEDCA   41 (135)
                      ..+..|.+|.|.+- ..-....|..|+-.+=.+|+
T Consensus         9 ~~~~~C~~C~~~i~g~~~~g~~C~~C~~~~H~~C~   43 (53)
T PF00130_consen    9 SKPTYCDVCGKFIWGLGKQGYRCSWCGLVCHKKCL   43 (53)
T ss_dssp             SSTEB-TTSSSBECSSSSCEEEETTTT-EEETTGG
T ss_pred             CCCCCCcccCcccCCCCCCeEEECCCCChHhhhhh
Confidence            35567888887772 22223455555554444444


No 182
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=20.13  E-value=41  Score=19.87  Aligned_cols=9  Identities=33%  Similarity=0.678  Sum_probs=4.6

Q ss_pred             chhhccccC
Q psy15639         13 CRVCLKSFK   21 (135)
Q Consensus        13 CRVClKsfk   21 (135)
                      |++|+--+.
T Consensus         5 C~~CG~i~~   13 (34)
T cd00729           5 CPVCGYIHE   13 (34)
T ss_pred             CCCCCCEeE
Confidence            555554444


No 183
>PF01586 Basic:  Myogenic Basic domain;  InterPro: IPR002546 This basic domain is found in the MyoD family of muscle specific proteins that control muscle development. The bHLH region of the MyoD family includes the basic domain and the Helix-loop-helix (HLH) motif. The bHLH region mediates specific DNA binding []. With 12 residues of the basic domain involved in DNA binding []. The basic domain forms an extended alpha helix in the structure.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0007517 muscle organ development, 0005634 nucleus; PDB: 1MDY_C.
Probab=20.12  E-value=32  Score=24.94  Aligned_cols=12  Identities=42%  Similarity=1.176  Sum_probs=1.4

Q ss_pred             ceeehhhhhhhh
Q psy15639         54 TWRCSICRRKLQ   65 (135)
Q Consensus        54 ~WrCSvCRRK~~   65 (135)
                      .|-|.+|.||-.
T Consensus        72 ~WACKaCKRKt~   83 (86)
T PF01586_consen   72 LWACKACKRKTV   83 (86)
T ss_dssp             -------S---T
T ss_pred             HHHhHhhhccCc
Confidence            699999999854


No 184
>PLN02400 cellulose synthase
Probab=20.09  E-value=46  Score=33.32  Aligned_cols=49  Identities=29%  Similarity=0.670  Sum_probs=39.3

Q ss_pred             CCCchhhcccc---CCCCccchhhhhhhhhhcccccccCCCCCCCCCceeehhhhhh
Q psy15639         10 LGNCRVCLKSF---KPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRK   63 (135)
Q Consensus        10 ~g~CRVClKsf---kP~e~~~tC~eCqqkVCEDCASYSkl~~~ed~~~WrCSvCRRK   63 (135)
                      +..|.||+--.   .-+|++--|.||.--||--|-.|-+-..     +=.|..|+-+
T Consensus        36 gqiCqICGD~VG~t~dGe~FVAC~eCaFPVCRpCYEYERkeG-----nq~CPQCkTr   87 (1085)
T PLN02400         36 GQICQICGDDVGVTETGDVFVACNECAFPVCRPCYEYERKDG-----TQCCPQCKTR   87 (1085)
T ss_pred             CceeeecccccCcCCCCCEEEEEccCCCccccchhheecccC-----CccCcccCCc
Confidence            34899998754   4578999999999999999999987655     3468889643


No 185
>PLN02569 threonine synthase
Probab=20.05  E-value=45  Score=29.48  Aligned_cols=23  Identities=9%  Similarity=0.171  Sum_probs=19.7

Q ss_pred             CCCchhhccccCCCCccchhhhhh
Q psy15639         10 LGNCRVCLKSFKPDDYSRVCYECH   33 (135)
Q Consensus        10 ~g~CRVClKsfkP~e~~~tC~eCq   33 (135)
                      .-.|.-|.+.|.++++...| +|.
T Consensus        49 ~l~C~~Cg~~y~~~~~~~~C-~cg   71 (484)
T PLN02569         49 FLECPLTGEKYSLDEVVYRS-KSG   71 (484)
T ss_pred             ccEeCCCCCcCCCccccccC-CCC
Confidence            35699999999999999888 784


No 186
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=20.03  E-value=28  Score=19.44  Aligned_cols=22  Identities=18%  Similarity=0.594  Sum_probs=8.2

Q ss_pred             CchhhccccCCCCc----cchhhhhh
Q psy15639         12 NCRVCLKSFKPDDY----SRVCYECH   33 (135)
Q Consensus        12 ~CRVClKsfkP~e~----~~tC~eCq   33 (135)
                      .|..|..-+....+    ...|..||
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rCq   28 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRCQ   28 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTTC
T ss_pred             cCccCCCcceEeEecCCCCeECcCCc
Confidence            45555544433333    44555554


Done!