Query psy15664
Match_columns 174
No_of_seqs 135 out of 1088
Neff 6.6
Searched_HMMs 46136
Date Fri Aug 16 18:26:47 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy15664.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15664hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG2686|consensus 100.0 2.8E-45 6.1E-50 316.0 13.3 151 1-174 186-342 (366)
2 KOG4720|consensus 100.0 2E-44 4.3E-49 304.6 14.1 140 3-174 224-367 (391)
3 PTZ00296 choline kinase; Provi 100.0 3.9E-42 8.5E-47 306.3 14.2 144 6-174 257-414 (442)
4 PTZ00384 choline kinase; Provi 100.0 1.8E-38 3.9E-43 278.4 15.1 135 6-165 199-345 (383)
5 PLN02421 phosphotransferase, a 100.0 1.6E-38 3.4E-43 273.0 14.1 139 4-174 159-300 (330)
6 PLN02236 choline kinase 100.0 1.8E-36 3.8E-41 261.9 14.8 145 5-174 178-324 (344)
7 cd05156 ChoK_euk Choline Kinas 100.0 4E-34 8.6E-39 240.4 13.1 135 9-163 156-302 (302)
8 PF01633 Choline_kinase: Choli 99.9 9.3E-26 2E-30 181.3 4.8 92 4-119 120-211 (211)
9 TIGR02721 ycfN_thiK thiamine k 99.8 3.4E-20 7.3E-25 152.8 12.3 98 24-168 143-240 (256)
10 cd05157 ETNK_euk Ethanolamine 99.8 1.2E-20 2.6E-25 152.7 8.7 87 6-124 149-235 (235)
11 COG0510 ycfN Thiamine kinase a 99.8 9E-20 1.9E-24 153.5 11.6 110 7-167 132-242 (269)
12 PRK10271 thiK thiamine kinase; 99.7 2.4E-17 5.1E-22 132.4 11.0 97 22-167 72-168 (188)
13 cd05151 ChoK Choline Kinase (C 99.5 1.7E-13 3.7E-18 104.7 9.1 78 11-131 90-168 (170)
14 cd05153 HomoserineK_II Homoser 99.4 4.7E-12 1E-16 105.8 13.2 99 24-162 172-270 (296)
15 TIGR02172 Fb_sc_TIGR02172 Fibr 99.4 7.9E-13 1.7E-17 108.4 7.1 73 15-130 141-213 (226)
16 PRK09550 mtnK methylthioribose 99.2 7.9E-11 1.7E-15 104.4 11.0 67 8-101 206-272 (401)
17 cd05154 ACAD10_11_like Acyl-Co 99.2 2.1E-11 4.5E-16 96.3 6.3 49 25-95 172-220 (223)
18 PRK05231 homoserine kinase; Pr 99.2 3.3E-10 7.2E-15 95.8 11.9 95 10-140 167-264 (319)
19 TIGR02906 spore_CotS spore coa 99.2 1.4E-10 3E-15 97.3 9.4 99 24-164 184-282 (313)
20 PF01636 APH: Phosphotransfera 99.2 6.8E-11 1.5E-15 93.3 7.0 66 24-128 163-228 (239)
21 cd05150 APH Aminoglycoside 3'- 99.2 9.4E-11 2E-15 95.5 7.9 84 24-154 160-243 (244)
22 PRK12396 5-methylribose kinase 99.1 4.3E-10 9.4E-15 99.7 10.6 67 8-101 210-276 (409)
23 smart00587 CHK ZnF_C4 abd HLH 99.1 4E-10 8.6E-15 90.2 9.4 73 25-131 118-190 (196)
24 TIGR00938 thrB_alt homoserine 99.1 1.2E-09 2.6E-14 92.5 11.7 74 24-133 184-257 (307)
25 TIGR01767 MTRK 5-methylthiorib 99.1 7.4E-10 1.6E-14 97.2 10.6 67 8-101 175-241 (370)
26 TIGR02904 spore_ysxE spore coa 99.1 7.7E-10 1.7E-14 93.9 10.2 101 23-165 192-292 (309)
27 cd05155 APH_ChoK_like_1 Unchar 99.0 7.6E-10 1.6E-14 90.2 7.1 59 25-128 162-221 (235)
28 cd05152 MPH2' Macrolide 2'-Pho 98.9 2E-08 4.3E-13 84.7 11.7 65 24-132 182-247 (276)
29 PLN02756 S-methyl-5-thioribose 98.8 2.7E-08 5.8E-13 88.7 10.8 65 8-99 213-277 (418)
30 PRK11768 serine/threonine prot 98.8 4E-08 8.7E-13 84.4 10.6 90 24-157 193-282 (325)
31 PF02958 EcKinase: Ecdysteroid 98.8 2E-08 4.4E-13 84.0 8.6 74 24-131 212-285 (294)
32 COG2334 Putative homoserine ki 98.8 1.8E-07 3.9E-12 81.2 13.3 97 29-167 199-296 (331)
33 PLN02876 acyl-CoA dehydrogenas 98.7 5E-08 1.1E-12 93.3 9.3 103 26-159 224-332 (822)
34 cd05120 APH_ChoK_like Aminogly 98.6 1.6E-07 3.5E-12 68.3 7.2 45 27-95 108-152 (155)
35 COG4857 Predicted kinase [Gene 98.5 3.3E-07 7.1E-12 78.6 7.3 61 8-95 211-271 (408)
36 PRK10593 hypothetical protein; 98.3 2.6E-06 5.5E-11 72.5 8.8 68 22-134 188-255 (297)
37 PRK06148 hypothetical protein; 98.3 9.5E-06 2.1E-10 79.5 12.3 102 24-162 200-302 (1013)
38 COG3173 Predicted aminoglycosi 98.3 1.7E-06 3.6E-11 75.0 5.9 57 12-92 183-239 (321)
39 PRK14879 serine/threonine prot 98.1 2.8E-05 6.1E-10 61.4 9.2 70 28-131 115-184 (211)
40 PF07914 DUF1679: Protein of u 98.1 2.8E-06 6.1E-11 75.8 3.8 55 23-96 264-318 (414)
41 TIGR03724 arch_bud32 Kae1-asso 98.1 3.1E-05 6.7E-10 60.7 8.9 70 27-131 109-179 (199)
42 PRK06149 hypothetical protein; 98.0 5.2E-05 1.1E-09 74.1 12.1 102 25-160 206-307 (972)
43 PF06293 Kdo: Lipopolysacchari 98.0 1.9E-05 4.1E-10 63.5 7.2 65 27-127 137-206 (206)
44 COG3178 Predicted phosphotrans 97.9 6.9E-05 1.5E-09 64.6 8.5 73 23-131 196-268 (351)
45 PRK15123 lipopolysaccharide co 97.6 0.00078 1.7E-08 56.9 11.3 72 27-130 157-234 (268)
46 PF04655 APH_6_hur: Aminoglyco 97.6 0.00039 8.5E-09 58.4 9.2 110 8-161 141-250 (253)
47 COG3642 Mn2+-dependent serine/ 97.6 0.00048 1E-08 55.9 8.6 97 8-146 96-194 (204)
48 PRK09605 bifunctional UGMP fam 97.5 0.00035 7.5E-09 63.8 8.4 69 27-130 447-515 (535)
49 TIGR02905 spore_yutH spore coa 97.5 0.00076 1.6E-08 57.7 9.1 68 25-133 187-255 (313)
50 PRK01723 3-deoxy-D-manno-octul 97.2 0.0024 5.3E-08 52.6 8.6 32 28-83 162-193 (239)
51 PF03881 Fructosamin_kin: Fruc 97.1 0.00087 1.9E-08 57.2 5.5 65 23-134 184-248 (288)
52 cd05145 RIO1_like RIO kinase f 97.0 0.00079 1.7E-08 53.1 4.1 32 27-83 137-168 (190)
53 PRK09902 hypothetical protein; 97.0 0.003 6.6E-08 52.0 7.3 77 10-129 134-215 (216)
54 cd05147 RIO1_euk RIO kinase fa 96.9 0.0011 2.3E-08 52.8 3.7 29 27-80 137-165 (190)
55 PRK12274 serine/threonine prot 96.8 0.0038 8.3E-08 51.4 6.7 34 27-84 110-144 (218)
56 COG3570 StrB Streptomycin 6-ki 96.8 0.0085 1.8E-07 49.8 8.3 103 11-155 145-247 (274)
57 PRK10359 lipopolysaccharide co 96.7 0.0033 7.1E-08 52.2 5.5 44 27-97 154-199 (232)
58 KOG0667|consensus 96.7 0.0021 4.6E-08 59.6 4.4 35 26-82 307-341 (586)
59 PF01163 RIO1: RIO1 family; I 96.5 0.0055 1.2E-07 49.2 5.2 28 27-79 126-153 (188)
60 PF06176 WaaY: Lipopolysacchar 96.4 0.0058 1.3E-07 50.7 4.8 28 27-79 154-181 (229)
61 cd05119 RIO RIO kinase family, 96.3 0.0048 1E-07 47.6 3.6 32 24-80 131-162 (187)
62 cd00180 PKc Catalytic domain o 96.2 0.0059 1.3E-07 45.8 4.0 56 6-85 91-146 (215)
63 cd05146 RIO3_euk RIO kinase fa 96.2 0.0039 8.5E-08 50.5 2.9 27 27-78 144-170 (197)
64 cd05594 STKc_PKB_alpha Catalyt 96.1 0.0097 2.1E-07 50.0 5.0 35 22-80 110-144 (325)
65 cd05144 RIO2_C RIO kinase fami 96.1 0.011 2.5E-07 46.5 5.1 30 27-80 144-173 (198)
66 cd06605 PKc_MAPKK Catalytic do 96.0 0.01 2.2E-07 47.5 4.4 43 14-80 107-149 (265)
67 smart00090 RIO RIO-like kinase 95.8 0.016 3.4E-07 47.8 4.8 28 29-81 170-197 (237)
68 KOG0583|consensus 95.6 0.014 3E-07 51.4 4.1 34 27-83 139-172 (370)
69 PF00069 Pkinase: Protein kina 95.6 0.0093 2E-07 47.4 2.7 29 28-80 118-146 (260)
70 PRK10345 hypothetical protein; 95.6 0.021 4.5E-07 46.5 4.6 16 28-43 125-140 (210)
71 cd05122 PKc_STE Catalytic doma 95.5 0.021 4.7E-07 44.6 4.4 33 27-83 117-149 (253)
72 cd05068 PTKc_Frk_like Catalyti 95.5 0.02 4.4E-07 46.0 4.3 16 28-43 123-138 (261)
73 cd07863 STKc_CDK4 Catalytic do 95.4 0.016 3.4E-07 47.2 3.5 29 28-80 128-156 (288)
74 cd06649 PKc_MEK2 Catalytic dom 95.4 0.023 4.9E-07 48.0 4.5 17 27-43 123-139 (331)
75 cd06622 PKc_MAPKK_PBS2_like Ca 95.4 0.021 4.5E-07 46.5 4.1 31 26-80 121-151 (286)
76 KOG0984|consensus 95.3 0.013 2.8E-07 48.8 2.7 43 15-81 156-198 (282)
77 cd08223 STKc_Nek4 Catalytic do 95.3 0.026 5.7E-07 44.9 4.5 29 28-80 122-150 (257)
78 cd08528 STKc_Nek10 Catalytic d 95.3 0.028 6E-07 45.3 4.7 36 21-80 127-162 (269)
79 cd05604 STKc_SGK3 Catalytic do 95.3 0.017 3.7E-07 48.6 3.5 30 27-80 115-144 (325)
80 COG3001 Uncharacterized protei 95.3 0.081 1.8E-06 44.7 7.4 63 3-91 163-225 (286)
81 cd05573 STKc_ROCK_NDR_like Cat 95.3 0.017 3.7E-07 48.7 3.3 31 27-81 120-150 (350)
82 smart00219 TyrKc Tyrosine kina 95.2 0.03 6.4E-07 44.3 4.5 30 28-81 123-152 (258)
83 cd08215 STKc_Nek Catalytic dom 95.2 0.023 4.9E-07 44.8 3.8 30 28-81 123-152 (258)
84 cd05603 STKc_SGK2 Catalytic do 95.2 0.019 4.1E-07 48.1 3.4 30 27-80 115-144 (321)
85 cd05586 STKc_Sck1_like Catalyt 95.2 0.02 4.4E-07 48.1 3.5 30 28-81 116-145 (330)
86 cd05614 STKc_MSK2_N N-terminal 95.2 0.02 4.4E-07 48.1 3.5 16 28-43 125-140 (332)
87 KOG0658|consensus 95.2 0.027 5.9E-07 49.5 4.3 17 27-43 144-160 (364)
88 cd05069 PTKc_Yes Catalytic dom 95.1 0.032 6.9E-07 44.9 4.4 16 28-43 122-137 (260)
89 TIGR01982 UbiB 2-polyprenylphe 95.1 0.015 3.2E-07 52.3 2.6 34 27-84 276-309 (437)
90 cd06650 PKc_MEK1 Catalytic dom 95.1 0.031 6.8E-07 47.3 4.5 29 28-80 124-152 (333)
91 cd06617 PKc_MKK3_6 Catalytic d 95.1 0.03 6.5E-07 45.3 4.2 23 21-43 117-139 (283)
92 cd00192 PTKc Catalytic domain 95.1 0.032 7E-07 44.1 4.2 17 27-43 124-140 (262)
93 cd08217 STKc_Nek2 Catalytic do 95.0 0.031 6.7E-07 44.3 4.0 32 26-81 128-159 (265)
94 cd05082 PTKc_Csk Catalytic dom 95.0 0.033 7.3E-07 44.6 4.2 30 27-80 121-150 (256)
95 cd05627 STKc_NDR2 Catalytic do 95.0 0.025 5.4E-07 48.3 3.6 30 27-80 120-149 (360)
96 cd06616 PKc_MKK4 Catalytic dom 95.0 0.027 5.9E-07 45.9 3.6 19 25-43 125-143 (288)
97 cd05628 STKc_NDR1 Catalytic do 94.9 0.031 6.8E-07 47.8 4.1 30 27-80 120-149 (363)
98 cd05083 PTKc_Chk Catalytic dom 94.9 0.034 7.5E-07 44.4 4.0 31 27-81 119-149 (254)
99 cd05109 PTKc_HER2 Catalytic do 94.9 0.034 7.5E-07 45.2 4.0 16 28-43 129-144 (279)
100 cd06615 PKc_MEK Catalytic doma 94.9 0.033 7.2E-07 46.4 3.9 18 26-43 118-135 (308)
101 cd05621 STKc_ROCK2 Catalytic d 94.8 0.037 8E-07 47.9 4.1 30 27-80 161-190 (370)
102 cd05052 PTKc_Abl Catalytic dom 94.8 0.041 9E-07 44.3 4.2 17 27-43 123-139 (263)
103 cd05601 STKc_CRIK Catalytic do 94.8 0.033 7.2E-07 46.7 3.7 30 27-80 121-150 (330)
104 cd05571 STKc_PKB Catalytic dom 94.8 0.036 7.9E-07 46.6 4.0 29 28-80 115-143 (323)
105 cd05585 STKc_YPK1_like Catalyt 94.8 0.043 9.4E-07 45.8 4.4 30 28-81 113-142 (312)
106 PHA03212 serine/threonine kina 94.7 0.038 8.1E-07 48.4 4.1 28 28-79 202-229 (391)
107 cd05617 STKc_aPKC_zeta Catalyt 94.7 0.03 6.6E-07 47.2 3.4 16 28-43 116-131 (327)
108 cd05070 PTKc_Fyn_Yrk Catalytic 94.7 0.032 7E-07 44.8 3.4 29 28-80 122-150 (260)
109 cd05595 STKc_PKB_beta Catalyti 94.7 0.03 6.4E-07 47.2 3.2 16 28-43 115-130 (323)
110 cd05039 PTKc_Csk_like Catalyti 94.7 0.04 8.6E-07 44.0 3.8 32 27-82 121-152 (256)
111 cd05616 STKc_cPKC_beta Catalyt 94.6 0.034 7.3E-07 46.7 3.4 16 28-43 121-136 (323)
112 cd05053 PTKc_FGFR Catalytic do 94.6 0.036 7.8E-07 45.3 3.4 30 27-80 151-180 (293)
113 cd07869 STKc_PFTAIRE1 Catalyti 94.6 0.033 7.1E-07 46.1 3.2 16 28-43 123-138 (303)
114 cd06656 STKc_PAK3 Catalytic do 94.5 0.031 6.7E-07 46.3 3.0 29 28-80 135-163 (297)
115 cd06623 PKc_MAPKK_plant_like C 94.5 0.042 9.1E-07 43.7 3.6 26 18-43 110-135 (264)
116 PTZ00263 protein kinase A cata 94.5 0.053 1.1E-06 45.8 4.4 29 28-80 138-166 (329)
117 cd05593 STKc_PKB_gamma Catalyt 94.5 0.042 9.1E-07 46.4 3.8 16 28-43 115-130 (328)
118 KOG0581|consensus 94.5 0.041 8.8E-07 48.5 3.7 48 20-93 191-238 (364)
119 cd05040 PTKc_Ack_like Catalyti 94.5 0.045 9.7E-07 43.7 3.8 16 28-43 117-132 (257)
120 PLN00034 mitogen-activated pro 94.5 0.046 9.9E-07 46.6 4.0 16 28-43 188-203 (353)
121 cd05602 STKc_SGK1 Catalytic do 94.5 0.043 9.3E-07 46.1 3.8 17 27-43 115-131 (325)
122 cd05574 STKc_phototropin_like 94.5 0.053 1.1E-06 45.0 4.3 30 28-81 123-152 (316)
123 PHA03209 serine/threonine kina 94.5 0.044 9.5E-07 47.0 3.8 29 28-80 177-205 (357)
124 cd07873 STKc_PCTAIRE1 Catalyti 94.4 0.038 8.3E-07 45.6 3.3 17 27-43 123-139 (301)
125 cd05612 STKc_PRKX_like Catalyt 94.4 0.048 1E-06 45.0 3.9 29 28-80 121-149 (291)
126 cd05575 STKc_SGK Catalytic dom 94.4 0.043 9.2E-07 46.1 3.6 29 28-80 116-144 (323)
127 cd05598 STKc_LATS Catalytic do 94.4 0.056 1.2E-06 46.3 4.4 29 28-80 121-149 (376)
128 cd05584 STKc_p70S6K Catalytic 94.4 0.04 8.7E-07 46.3 3.4 16 28-43 120-135 (323)
129 PTZ00267 NIMA-related protein 94.4 0.051 1.1E-06 48.8 4.3 29 28-80 189-217 (478)
130 PRK09188 serine/threonine prot 94.4 0.069 1.5E-06 47.1 5.0 40 27-90 130-170 (365)
131 cd07868 STKc_CDK8 Catalytic do 94.4 0.054 1.2E-06 44.9 4.1 16 28-43 128-143 (317)
132 cd05629 STKc_NDR_like_fungal C 94.4 0.049 1.1E-06 46.8 4.0 30 27-80 120-149 (377)
133 cd05591 STKc_nPKC_epsilon Cata 94.4 0.051 1.1E-06 45.6 4.0 16 28-43 116-131 (321)
134 cd05618 STKc_aPKC_iota Catalyt 94.4 0.045 9.8E-07 46.3 3.7 16 28-43 116-131 (329)
135 PHA02882 putative serine/threo 94.4 0.057 1.2E-06 44.7 4.2 16 28-43 146-161 (294)
136 cd06627 STKc_Cdc7_like Catalyt 94.4 0.055 1.2E-06 42.7 3.9 30 28-81 119-148 (254)
137 cd05625 STKc_LATS1 Catalytic d 94.4 0.048 1E-06 47.0 3.8 29 28-80 121-149 (382)
138 cd07875 STKc_JNK1 Catalytic do 94.4 0.048 1E-06 46.5 3.8 29 28-80 146-174 (364)
139 cd05088 PTKc_Tie2 Catalytic do 94.4 0.042 9.2E-07 45.6 3.4 17 27-43 143-159 (303)
140 cd05597 STKc_DMPK_like Catalyt 94.3 0.054 1.2E-06 45.8 4.1 28 28-79 122-149 (331)
141 cd07871 STKc_PCTAIRE3 Catalyti 94.3 0.038 8.2E-07 45.5 3.0 17 27-43 122-138 (288)
142 cd07878 STKc_p38beta_MAPK11 Ca 94.3 0.051 1.1E-06 45.8 3.8 16 28-43 138-153 (343)
143 cd05623 STKc_MRCK_alpha Cataly 94.3 0.048 1E-06 46.0 3.7 29 27-79 121-149 (332)
144 cd05102 PTKc_VEGFR3 Catalytic 94.3 0.066 1.4E-06 45.0 4.5 16 28-43 194-209 (338)
145 cd05034 PTKc_Src_like Catalyti 94.3 0.052 1.1E-06 43.4 3.7 29 28-80 123-151 (261)
146 cd05587 STKc_cPKC Catalytic do 94.3 0.048 1E-06 45.8 3.6 16 28-43 121-136 (324)
147 cd05583 STKc_MSK_N N-terminal 94.3 0.047 1E-06 44.6 3.5 17 27-43 124-140 (288)
148 cd05084 PTKc_Fes Catalytic dom 94.3 0.062 1.3E-06 42.8 4.1 16 28-43 114-129 (252)
149 cd05624 STKc_MRCK_beta Catalyt 94.3 0.05 1.1E-06 46.0 3.7 17 27-43 121-137 (331)
150 cd05038 PTKc_Jak_rpt2 Catalyti 94.3 0.055 1.2E-06 43.7 3.8 17 27-43 128-144 (284)
151 KOG0594|consensus 94.3 0.077 1.7E-06 46.2 4.8 17 27-43 139-155 (323)
152 cd05080 PTKc_Tyk2_rpt2 Catalyt 94.2 0.065 1.4E-06 43.6 4.2 16 28-43 127-142 (283)
153 TIGR02457 TreS_Cterm trehalose 94.2 0.058 1.3E-06 49.9 4.3 44 28-96 380-432 (528)
154 PTZ00426 cAMP-dependent protei 94.2 0.047 1E-06 46.7 3.5 29 28-80 151-179 (340)
155 cd07857 STKc_MPK1 Catalytic do 94.2 0.038 8.2E-07 46.5 2.9 16 28-43 125-140 (332)
156 cd06618 PKc_MKK7 Catalytic dom 94.2 0.048 1E-06 44.9 3.5 17 27-43 134-150 (296)
157 cd07832 STKc_CCRK Catalytic do 94.2 0.053 1.2E-06 43.8 3.7 16 28-43 119-134 (286)
158 cd05096 PTKc_DDR1 Catalytic do 94.2 0.058 1.3E-06 44.6 3.9 29 28-80 158-186 (304)
159 cd05089 PTKc_Tie1 Catalytic do 94.2 0.053 1.1E-06 44.7 3.6 17 27-43 138-154 (297)
160 cd05590 STKc_nPKC_eta Catalyti 94.2 0.06 1.3E-06 45.3 4.0 16 28-43 116-131 (320)
161 cd05580 STKc_PKA Catalytic dom 94.2 0.053 1.2E-06 44.5 3.6 31 27-81 120-150 (290)
162 KOG4250|consensus 94.2 0.062 1.3E-06 51.0 4.4 34 27-80 139-172 (732)
163 cd05091 PTKc_Ror2 Catalytic do 94.2 0.053 1.2E-06 44.1 3.5 29 28-80 144-172 (283)
164 cd07853 STKc_NLK Catalytic dom 94.2 0.055 1.2E-06 46.4 3.8 16 28-43 123-138 (372)
165 cd07872 STKc_PCTAIRE2 Catalyti 94.1 0.049 1.1E-06 45.2 3.3 16 28-43 124-139 (309)
166 cd05075 PTKc_Axl Catalytic dom 94.1 0.05 1.1E-06 43.7 3.3 16 28-43 132-147 (272)
167 cd05620 STKc_nPKC_delta Cataly 94.1 0.048 1.1E-06 45.8 3.3 16 28-43 116-131 (316)
168 cd05600 STKc_Sid2p_Dbf2p Catal 94.1 0.064 1.4E-06 45.1 4.0 29 28-80 121-149 (333)
169 PTZ00036 glycogen synthase kin 94.1 0.058 1.3E-06 48.0 3.9 17 27-43 189-205 (440)
170 cd05113 PTKc_Btk_Bmx Catalytic 94.1 0.076 1.7E-06 42.7 4.3 29 28-80 120-148 (256)
171 cd07862 STKc_CDK6 Catalytic do 94.1 0.063 1.4E-06 43.8 3.9 28 28-79 130-157 (290)
172 cd05060 PTKc_Syk_like Catalyti 94.1 0.084 1.8E-06 42.2 4.5 29 28-80 115-143 (257)
173 cd05066 PTKc_EphR_A Catalytic 94.1 0.061 1.3E-06 43.4 3.7 17 27-43 125-141 (267)
174 cd05588 STKc_aPKC Catalytic do 94.1 0.055 1.2E-06 45.7 3.5 16 28-43 116-131 (329)
175 cd05599 STKc_NDR_like Catalyti 94.0 0.057 1.2E-06 45.9 3.6 29 28-80 121-149 (364)
176 cd07859 STKc_TDY_MAPK_plant Ca 94.0 0.065 1.4E-06 44.7 3.9 16 28-43 123-138 (338)
177 cd05582 STKc_RSK_N N-terminal 94.0 0.061 1.3E-06 45.0 3.7 29 28-80 118-146 (318)
178 PHA03207 serine/threonine kina 94.0 0.044 9.6E-07 47.6 2.9 16 28-43 205-220 (392)
179 cd05622 STKc_ROCK1 Catalytic d 94.0 0.076 1.6E-06 45.9 4.3 17 27-43 161-177 (371)
180 KOG1166|consensus 94.0 0.12 2.5E-06 51.1 6.0 48 11-79 801-848 (974)
181 cd08219 STKc_Nek3 Catalytic do 94.0 0.088 1.9E-06 42.0 4.4 30 27-80 119-148 (255)
182 cd05049 PTKc_Trk Catalytic dom 94.0 0.08 1.7E-06 42.8 4.2 16 28-43 142-157 (280)
183 cd05613 STKc_MSK1_N N-terminal 94.0 0.067 1.5E-06 43.7 3.8 29 27-79 124-152 (290)
184 cd05071 PTKc_Src Catalytic dom 94.0 0.067 1.5E-06 43.2 3.8 16 28-43 122-137 (262)
185 cd05057 PTKc_EGFR_like Catalyt 94.0 0.076 1.6E-06 43.1 4.1 17 27-43 128-144 (279)
186 cd05633 STKc_GRK3 Catalytic do 94.0 0.049 1.1E-06 44.6 3.0 16 28-43 117-132 (279)
187 cd05094 PTKc_TrkC Catalytic do 94.0 0.075 1.6E-06 43.6 4.1 16 28-43 143-158 (291)
188 cd07839 STKc_CDK5 Catalytic do 94.0 0.054 1.2E-06 43.9 3.2 16 28-43 119-134 (284)
189 cd06614 STKc_PAK Catalytic dom 94.0 0.074 1.6E-06 43.3 4.0 30 27-80 135-164 (286)
190 cd05123 STKc_AGC Catalytic dom 93.9 0.084 1.8E-06 41.7 4.2 31 27-81 112-142 (250)
191 cd05047 PTKc_Tie Catalytic dom 93.9 0.075 1.6E-06 43.0 4.0 17 27-43 131-147 (270)
192 cd07874 STKc_JNK3 Catalytic do 93.9 0.058 1.3E-06 45.8 3.5 29 28-80 139-167 (355)
193 cd05148 PTKc_Srm_Brk Catalytic 93.9 0.077 1.7E-06 42.4 4.0 29 28-80 124-152 (261)
194 cd07834 STKc_MAPK Catalytic do 93.9 0.057 1.2E-06 45.1 3.3 16 28-43 123-138 (330)
195 cd07841 STKc_CDK7 Catalytic do 93.9 0.091 2E-06 43.0 4.5 16 28-43 122-137 (298)
196 cd05608 STKc_GRK1 Catalytic do 93.9 0.059 1.3E-06 44.2 3.3 16 28-43 117-132 (280)
197 PTZ00284 protein kinase; Provi 93.9 0.059 1.3E-06 48.0 3.5 22 22-43 246-267 (467)
198 cd07876 STKc_JNK2 Catalytic do 93.8 0.058 1.3E-06 46.0 3.3 16 28-43 143-158 (359)
199 PLN03225 Serine/threonine-prot 93.8 0.084 1.8E-06 48.9 4.6 30 28-80 275-304 (566)
200 cd05632 STKc_GRK5 Catalytic do 93.8 0.068 1.5E-06 43.9 3.6 16 28-43 122-137 (285)
201 cd08529 STKc_FA2-like Catalyti 93.8 0.088 1.9E-06 41.7 4.2 17 27-43 120-136 (256)
202 cd05108 PTKc_EGFR Catalytic do 93.8 0.085 1.8E-06 44.0 4.2 16 28-43 129-144 (316)
203 cd07866 STKc_BUR1 Catalytic do 93.8 0.059 1.3E-06 44.2 3.2 16 28-43 135-150 (311)
204 cd05116 PTKc_Syk Catalytic dom 93.8 0.079 1.7E-06 42.5 3.9 16 28-43 115-130 (257)
205 PRK04750 ubiB putative ubiquin 93.8 0.035 7.6E-07 51.4 2.0 37 27-83 279-315 (537)
206 cd07870 STKc_PFTAIRE2 Catalyti 93.8 0.078 1.7E-06 43.3 3.9 16 28-43 123-138 (291)
207 cd05592 STKc_nPKC_theta_delta 93.8 0.062 1.3E-06 45.1 3.3 17 27-43 115-131 (316)
208 cd05085 PTKc_Fer Catalytic dom 93.7 0.087 1.9E-06 41.8 3.9 29 28-80 113-141 (250)
209 cd05079 PTKc_Jak1_rpt2 Catalyt 93.7 0.077 1.7E-06 43.3 3.7 17 27-43 128-144 (284)
210 cd05589 STKc_PKN Catalytic dom 93.7 0.069 1.5E-06 44.8 3.5 16 28-43 121-136 (324)
211 cd05099 PTKc_FGFR4 Catalytic d 93.7 0.087 1.9E-06 43.9 4.1 17 27-43 153-169 (314)
212 cd05112 PTKc_Itk Catalytic dom 93.7 0.074 1.6E-06 42.4 3.5 29 28-80 120-148 (256)
213 cd05062 PTKc_IGF-1R Catalytic 93.7 0.071 1.5E-06 43.3 3.4 16 28-43 139-154 (277)
214 cd05042 PTKc_Aatyk Catalytic d 93.7 0.097 2.1E-06 42.2 4.2 16 28-43 120-135 (269)
215 cd05631 STKc_GRK4 Catalytic do 93.6 0.09 1.9E-06 43.2 4.0 16 28-43 122-137 (285)
216 cd05101 PTKc_FGFR2 Catalytic d 93.6 0.091 2E-06 43.4 4.0 16 28-43 157-172 (304)
217 cd06638 STKc_myosinIIIA Cataly 93.6 0.076 1.7E-06 43.1 3.5 29 28-80 144-172 (286)
218 COG0478 RIO-like serine/threon 93.6 0.068 1.5E-06 45.9 3.3 28 26-77 220-247 (304)
219 cd07835 STKc_CDK1_like Catalyt 93.6 0.077 1.7E-06 43.0 3.5 16 28-43 119-134 (283)
220 cd07867 STKc_CDC2L6 Catalytic 93.6 0.097 2.1E-06 43.2 4.1 16 28-43 128-143 (317)
221 cd06639 STKc_myosinIIIB Cataly 93.6 0.092 2E-06 42.9 3.9 16 28-43 148-163 (291)
222 cd05041 PTKc_Fes_like Catalyti 93.6 0.11 2.3E-06 41.3 4.3 29 28-80 113-141 (251)
223 smart00220 S_TKc Serine/Threon 93.6 0.068 1.5E-06 41.3 3.0 32 28-83 107-138 (244)
224 smart00221 STYKc Protein kinas 93.6 0.078 1.7E-06 40.8 3.3 32 28-83 118-149 (225)
225 cd06644 STKc_STK10_LOK Catalyt 93.6 0.13 2.9E-06 42.1 4.9 17 27-43 129-145 (292)
226 cd05033 PTKc_EphR Catalytic do 93.5 0.085 1.8E-06 42.5 3.6 17 27-43 125-141 (266)
227 cd05093 PTKc_TrkB Catalytic do 93.5 0.1 2.2E-06 42.7 4.2 17 27-43 139-155 (288)
228 cd06613 STKc_MAP4K3_like Catal 93.5 0.1 2.2E-06 41.5 4.1 30 27-80 120-149 (262)
229 KOG0596|consensus 93.5 0.11 2.4E-06 48.5 4.6 41 27-94 479-519 (677)
230 cd05095 PTKc_DDR2 Catalytic do 93.5 0.096 2.1E-06 43.1 4.0 16 28-43 150-165 (296)
231 COG2187 Uncharacterized protei 93.5 1.4 3.1E-05 38.2 11.0 68 24-132 206-277 (337)
232 cd05626 STKc_LATS2 Catalytic d 93.5 0.085 1.8E-06 45.5 3.8 30 27-80 120-149 (381)
233 cd05114 PTKc_Tec_Rlk Catalytic 93.5 0.084 1.8E-06 42.2 3.5 30 28-81 120-149 (256)
234 cd05111 PTK_HER3 Pseudokinase 93.5 0.11 2.5E-06 42.3 4.4 16 28-43 129-144 (279)
235 cd05578 STKc_Yank1 Catalytic d 93.4 0.079 1.7E-06 42.3 3.3 30 28-81 120-149 (258)
236 KOG0603|consensus 93.4 0.12 2.6E-06 48.3 4.8 36 27-85 434-469 (612)
237 cd06652 STKc_MEKK2 Catalytic d 93.4 0.091 2E-06 42.2 3.6 16 28-43 126-141 (265)
238 cd05037 PTK_Jak_rpt1 Pseudokin 93.4 0.11 2.4E-06 41.3 4.0 17 27-43 120-136 (259)
239 KOG3087|consensus 93.4 0.37 7.9E-06 39.6 6.9 83 28-146 133-219 (229)
240 cd05048 PTKc_Ror Catalytic Dom 93.4 0.11 2.4E-06 42.0 4.1 16 28-43 144-159 (283)
241 cd05615 STKc_cPKC_alpha Cataly 93.3 0.085 1.8E-06 44.4 3.5 17 27-43 120-136 (323)
242 cd05579 STKc_MAST_like Catalyt 93.3 0.091 2E-06 41.6 3.4 31 27-81 112-142 (265)
243 cd05609 STKc_MAST Catalytic do 93.3 0.091 2E-06 43.5 3.6 29 28-80 121-149 (305)
244 cd05118 STKc_CMGC Catalytic do 93.3 0.13 2.8E-06 41.4 4.4 30 28-81 118-147 (283)
245 COG0661 AarF Predicted unusual 93.3 0.047 1E-06 50.4 2.0 31 27-81 284-314 (517)
246 cd05596 STKc_ROCK Catalytic do 93.3 0.09 1.9E-06 45.4 3.6 16 28-43 162-177 (370)
247 cd07845 STKc_CDK10 Catalytic d 93.3 0.078 1.7E-06 43.9 3.1 16 28-43 128-143 (309)
248 cd07837 STKc_CdkB_plant Cataly 93.3 0.12 2.7E-06 42.1 4.3 16 28-43 130-145 (295)
249 cd08221 STKc_Nek9 Catalytic do 93.3 0.093 2E-06 41.8 3.4 31 27-81 120-150 (256)
250 cd05607 STKc_GRK7 Catalytic do 93.3 0.16 3.5E-06 41.5 4.9 17 27-43 114-130 (277)
251 PHA03211 serine/threonine kina 93.3 0.093 2E-06 47.4 3.8 16 28-43 280-295 (461)
252 cd05032 PTKc_InsR_like Catalyt 93.2 0.12 2.7E-06 41.6 4.2 17 27-43 138-154 (277)
253 cd07848 STKc_CDKL5 Catalytic d 93.2 0.091 2E-06 42.8 3.4 16 28-43 120-135 (287)
254 cd05051 PTKc_DDR Catalytic dom 93.2 0.092 2E-06 42.9 3.4 16 28-43 150-165 (296)
255 cd05097 PTKc_DDR_like Catalyti 93.2 0.12 2.5E-06 42.5 4.0 17 27-43 148-164 (295)
256 cd05115 PTKc_Zap-70 Catalytic 93.2 0.13 2.9E-06 41.4 4.3 16 28-43 115-130 (257)
257 cd05605 STKc_GRK4_like Catalyt 93.2 0.094 2E-06 43.0 3.4 16 28-43 122-137 (285)
258 cd05059 PTKc_Tec_like Catalyti 93.1 0.11 2.5E-06 41.5 3.8 29 28-80 120-148 (256)
259 KOG1163|consensus 93.1 0.11 2.4E-06 44.3 3.7 32 27-79 130-161 (341)
260 cd06641 STKc_MST3 Catalytic do 93.1 0.16 3.4E-06 41.3 4.6 30 27-80 120-149 (277)
261 cd08228 STKc_Nek6 Catalytic do 93.1 0.12 2.6E-06 41.4 3.9 30 27-80 125-154 (267)
262 cd05054 PTKc_VEGFR Catalytic d 93.1 0.13 2.9E-06 43.7 4.3 16 28-43 193-208 (337)
263 cd05035 PTKc_Axl_like Catalyti 93.1 0.12 2.7E-06 41.3 3.9 16 28-43 133-148 (273)
264 cd05044 PTKc_c-ros Catalytic d 93.1 0.11 2.5E-06 41.6 3.7 34 28-80 126-159 (269)
265 cd06654 STKc_PAK1 Catalytic do 93.1 0.077 1.7E-06 43.9 2.7 16 28-43 136-151 (296)
266 cd06648 STKc_PAK_II Catalytic 93.1 0.12 2.7E-06 42.3 3.9 17 27-43 134-150 (285)
267 cd05572 STKc_cGK_PKG Catalytic 93.1 0.12 2.5E-06 41.5 3.7 31 27-81 112-142 (262)
268 PHA03390 pk1 serine/threonine- 93.0 0.14 3E-06 41.7 4.2 30 28-80 129-158 (267)
269 cd06630 STKc_MEKK1 Catalytic d 93.0 0.11 2.3E-06 41.7 3.5 16 28-43 123-138 (268)
270 cd08220 STKc_Nek8 Catalytic do 93.0 0.11 2.3E-06 41.3 3.4 17 27-43 120-136 (256)
271 cd07861 STKc_CDK1_euk Catalyti 93.0 0.099 2.1E-06 42.3 3.3 16 28-43 121-136 (285)
272 PHA03210 serine/threonine kina 93.0 0.12 2.5E-06 46.9 4.1 28 28-79 287-314 (501)
273 cd07847 STKc_CDKL1_4 Catalytic 93.0 0.12 2.6E-06 41.8 3.7 17 27-43 119-135 (286)
274 COG3231 Aph Aminoglycoside pho 93.0 0.31 6.8E-06 41.0 6.2 66 25-129 183-248 (266)
275 cd05081 PTKc_Jak2_Jak3_rpt2 Ca 93.0 0.12 2.6E-06 42.0 3.7 16 28-43 128-143 (284)
276 cd07846 STKc_CDKL2_3 Catalytic 93.0 0.12 2.5E-06 41.9 3.6 29 28-80 120-148 (286)
277 cd05056 PTKc_FAK Catalytic dom 93.0 0.14 3.1E-06 41.2 4.1 17 27-43 126-142 (270)
278 cd06655 STKc_PAK2 Catalytic do 93.0 0.088 1.9E-06 43.6 3.0 16 28-43 135-150 (296)
279 cd07833 STKc_CDKL Catalytic do 92.9 0.13 2.9E-06 41.5 3.9 30 28-81 120-149 (288)
280 PLN00009 cyclin-dependent kina 92.9 0.16 3.6E-06 41.5 4.5 16 28-43 122-137 (294)
281 cd06658 STKc_PAK5 Catalytic do 92.9 0.11 2.4E-06 43.0 3.4 28 28-79 138-165 (292)
282 cd05072 PTKc_Lyn Catalytic dom 92.9 0.12 2.6E-06 41.4 3.5 16 28-43 123-138 (261)
283 cd07850 STKc_JNK Catalytic dom 92.9 0.1 2.2E-06 44.3 3.3 16 28-43 138-153 (353)
284 cd05074 PTKc_Tyro3 Catalytic d 92.9 0.14 3.1E-06 41.1 4.0 16 28-43 133-148 (273)
285 cd07836 STKc_Pho85 Catalytic d 92.8 0.12 2.6E-06 41.8 3.5 16 28-43 120-135 (284)
286 cd05050 PTKc_Musk Catalytic do 92.8 0.11 2.4E-06 42.4 3.3 17 27-43 149-165 (288)
287 cd05098 PTKc_FGFR1 Catalytic d 92.8 0.092 2E-06 43.5 2.9 17 27-43 159-175 (307)
288 cd05619 STKc_nPKC_theta Cataly 92.8 0.12 2.7E-06 43.4 3.6 16 28-43 116-131 (316)
289 cd05103 PTKc_VEGFR2 Catalytic 92.8 0.19 4.1E-06 42.7 4.8 30 27-80 198-227 (343)
290 cd06643 STKc_SLK Catalytic dom 92.8 0.17 3.8E-06 41.1 4.4 29 28-80 123-151 (282)
291 cd06645 STKc_MAP4K3 Catalytic 92.7 0.11 2.4E-06 41.7 3.2 16 28-43 126-141 (267)
292 cd05036 PTKc_ALK_LTK Catalytic 92.7 0.17 3.7E-06 41.1 4.3 16 28-43 136-151 (277)
293 cd06624 STKc_ASK Catalytic dom 92.7 0.19 4.1E-06 40.4 4.6 16 28-43 128-143 (268)
294 cd05087 PTKc_Aatyk1_Aatyk3 Cat 92.7 0.2 4.3E-06 40.4 4.7 16 28-43 120-135 (269)
295 cd07844 STKc_PCTAIRE_like Cata 92.7 0.11 2.5E-06 42.3 3.2 16 28-43 123-138 (291)
296 cd05106 PTKc_CSF-1R Catalytic 92.7 0.18 3.9E-06 43.7 4.6 16 28-43 232-247 (374)
297 cd05067 PTKc_Lck_Blk Catalytic 92.7 0.16 3.4E-06 40.7 4.0 17 27-43 121-137 (260)
298 cd05090 PTKc_Ror1 Catalytic do 92.7 0.14 3.1E-06 41.6 3.8 16 28-43 144-159 (283)
299 cd05577 STKc_GRK Catalytic dom 92.6 0.11 2.3E-06 42.3 3.0 16 28-43 115-130 (277)
300 cd05063 PTKc_EphR_A2 Catalytic 92.6 0.14 3E-06 41.2 3.6 16 28-43 127-142 (268)
301 cd06646 STKc_MAP4K5 Catalytic 92.6 0.13 2.8E-06 41.3 3.4 16 28-43 126-141 (267)
302 cd06637 STKc_TNIK Catalytic do 92.6 0.1 2.2E-06 42.0 2.7 29 28-80 131-159 (272)
303 KOG0588|consensus 92.6 0.092 2E-06 49.8 2.8 49 11-83 113-163 (786)
304 cd07865 STKc_CDK9 Catalytic do 92.6 0.11 2.5E-06 42.4 3.1 16 28-43 139-154 (310)
305 cd05073 PTKc_Hck Catalytic dom 92.6 0.14 3.1E-06 41.1 3.6 17 27-43 121-137 (260)
306 cd06610 STKc_OSR1_SPAK Catalyt 92.6 0.14 3E-06 40.8 3.5 30 27-80 121-150 (267)
307 cd05110 PTKc_HER4 Catalytic do 92.6 0.18 3.8E-06 41.8 4.2 16 28-43 129-144 (303)
308 cd08216 PK_STRAD Pseudokinase 92.5 0.18 3.9E-06 41.7 4.3 16 28-43 121-136 (314)
309 cd05570 STKc_PKC Catalytic dom 92.5 0.13 2.8E-06 43.1 3.5 17 27-43 115-131 (318)
310 KOG0608|consensus 92.5 0.18 3.9E-06 48.1 4.5 32 25-80 746-777 (1034)
311 cd05045 PTKc_RET Catalytic dom 92.5 0.13 2.8E-06 42.1 3.3 17 27-43 146-162 (290)
312 cd06608 STKc_myosinIII_like Ca 92.5 0.14 3E-06 40.9 3.4 30 27-80 132-161 (275)
313 cd06633 STKc_TAO3 Catalytic do 92.4 0.19 4.1E-06 42.0 4.3 16 28-43 141-156 (313)
314 cd06657 STKc_PAK4 Catalytic do 92.4 0.13 2.7E-06 42.7 3.2 29 28-80 136-164 (292)
315 cd06625 STKc_MEKK3_like Cataly 92.4 0.19 4.2E-06 40.0 4.2 29 28-80 124-152 (263)
316 cd05610 STKc_MASTL Catalytic d 92.4 0.15 3.2E-06 48.1 3.9 30 28-81 124-153 (669)
317 KOG2345|consensus 92.4 0.26 5.6E-06 42.0 5.0 16 28-43 149-164 (302)
318 cd05611 STKc_Rim15_like Cataly 92.3 0.16 3.4E-06 40.6 3.6 16 28-43 117-132 (260)
319 cd05630 STKc_GRK6 Catalytic do 92.3 0.17 3.6E-06 41.6 3.7 30 27-80 121-150 (285)
320 KOG0592|consensus 92.3 0.18 4E-06 46.7 4.3 18 27-44 193-210 (604)
321 cd05581 STKc_PDK1 Catalytic do 92.3 0.12 2.6E-06 41.4 2.9 30 27-80 121-150 (280)
322 cd07864 STKc_CDK12 Catalytic d 92.3 0.14 3E-06 41.9 3.2 16 28-43 136-151 (302)
323 cd07840 STKc_CDK9_like Catalyt 92.3 0.12 2.7E-06 41.5 2.9 16 28-43 120-135 (287)
324 PRK14705 glycogen branching en 92.3 2.1 4.5E-05 43.5 11.9 83 25-133 329-427 (1224)
325 cd06612 STKc_MST1_2 Catalytic 92.3 0.18 3.9E-06 39.9 3.8 16 28-43 119-134 (256)
326 cd05086 PTKc_Aatyk2 Catalytic 92.3 0.27 5.9E-06 39.8 4.9 16 28-43 119-134 (268)
327 cd08530 STKc_CNK2-like Catalyt 92.2 0.25 5.4E-06 39.0 4.6 30 27-80 122-151 (256)
328 cd07843 STKc_CDC2L1 Catalytic 92.2 0.15 3.3E-06 41.7 3.4 16 28-43 126-141 (293)
329 cd05606 STKc_beta_ARK Catalyti 92.2 0.15 3.2E-06 41.7 3.3 16 28-43 117-132 (278)
330 cd08224 STKc_Nek6_Nek7 Catalyt 92.2 0.19 4.2E-06 40.0 4.0 17 27-43 125-141 (267)
331 cd06634 STKc_TAO2 Catalytic do 92.2 0.16 3.4E-06 42.3 3.5 29 28-80 135-163 (308)
332 cd06635 STKc_TAO1 Catalytic do 92.2 0.22 4.9E-06 41.5 4.5 16 28-43 145-160 (317)
333 cd07851 STKc_p38 Catalytic dom 92.2 0.15 3.2E-06 43.3 3.4 29 28-80 138-166 (343)
334 cd05576 STKc_RPK118_like Catal 92.2 0.14 3.1E-06 40.8 3.1 17 27-43 104-120 (237)
335 cd05055 PTKc_PDGFR Catalytic d 92.2 0.15 3.2E-06 42.4 3.3 16 28-43 161-176 (302)
336 cd05058 PTKc_Met_Ron Catalytic 92.1 0.2 4.4E-06 40.0 4.0 17 27-43 117-133 (262)
337 cd06659 STKc_PAK6 Catalytic do 92.1 0.18 3.8E-06 41.8 3.7 28 28-79 137-164 (297)
338 cd07880 STKc_p38gamma_MAPK12 C 92.1 0.18 3.8E-06 42.8 3.7 30 27-80 137-166 (343)
339 cd08229 STKc_Nek7 Catalytic do 92.1 0.16 3.5E-06 40.7 3.3 17 27-43 125-141 (267)
340 cd07838 STKc_CDK4_6_like Catal 92.0 0.22 4.7E-06 40.2 4.1 29 28-80 127-155 (287)
341 cd06619 PKc_MKK5 Catalytic dom 92.0 0.21 4.6E-06 40.7 4.0 17 27-43 114-130 (279)
342 cd08218 STKc_Nek1 Catalytic do 92.0 0.22 4.7E-06 39.7 4.0 30 27-80 120-149 (256)
343 cd07879 STKc_p38delta_MAPK13 C 92.0 0.17 3.8E-06 42.8 3.6 29 28-80 137-165 (342)
344 cd06606 STKc_MAPKKK Catalytic 92.0 0.12 2.7E-06 40.4 2.5 17 27-43 120-136 (260)
345 cd06917 STKc_NAK1_like Catalyt 91.9 0.15 3.3E-06 41.2 3.0 17 27-43 120-136 (277)
346 KOG0983|consensus 91.9 0.23 5E-06 43.1 4.1 25 20-44 204-228 (391)
347 cd07830 STKc_MAK_like Catalyti 91.9 0.23 4.9E-06 40.2 4.0 16 28-43 119-134 (283)
348 cd06631 STKc_YSK4 Catalytic do 91.8 0.17 3.6E-06 40.6 3.2 29 28-80 122-150 (265)
349 KOG0668|consensus 91.8 0.17 3.6E-06 43.0 3.1 51 8-82 133-183 (338)
350 PTZ00283 serine/threonine prot 91.8 0.21 4.5E-06 45.3 4.0 16 28-43 163-178 (496)
351 cd07860 STKc_CDK2_3 Catalytic 91.8 0.19 4.2E-06 40.7 3.5 16 28-43 120-135 (284)
352 cd06629 STKc_MAPKKK_Bck1_like 91.7 0.32 7E-06 39.1 4.8 30 28-81 128-157 (272)
353 cd05100 PTKc_FGFR3 Catalytic d 91.7 0.23 5.1E-06 41.7 4.1 16 28-43 154-169 (334)
354 cd07842 STKc_CDK8_like Catalyt 91.7 0.21 4.5E-06 41.0 3.7 33 28-80 128-160 (316)
355 cd06640 STKc_MST4 Catalytic do 91.7 0.22 4.7E-06 40.4 3.8 17 27-43 120-136 (277)
356 cd08225 STKc_Nek5 Catalytic do 91.6 0.16 3.4E-06 40.3 2.8 17 27-43 120-136 (257)
357 KOG1006|consensus 91.5 0.065 1.4E-06 46.2 0.5 33 24-80 184-216 (361)
358 cd07849 STKc_ERK1_2_like Catal 91.5 0.17 3.7E-06 42.6 3.0 16 28-43 126-141 (336)
359 cd06607 STKc_TAO Catalytic dom 91.5 0.34 7.4E-06 40.1 4.8 16 28-43 135-150 (307)
360 cd07858 STKc_TEY_MAPK_plant Ca 91.5 0.19 4.2E-06 42.3 3.3 16 28-43 128-143 (337)
361 cd06632 STKc_MEKK1_plant Catal 91.4 0.19 4.1E-06 39.8 3.1 17 27-43 121-137 (258)
362 cd06653 STKc_MEKK3_like_1 Cata 91.4 0.19 4E-06 40.5 3.0 16 28-43 126-141 (264)
363 cd05065 PTKc_EphR_B Catalytic 91.4 0.3 6.4E-06 39.3 4.2 17 27-43 125-141 (269)
364 cd06651 STKc_MEKK3 Catalytic d 91.4 0.23 4.9E-06 40.0 3.5 17 27-43 125-141 (266)
365 cd07852 STKc_MAPK15 Catalytic 91.3 0.29 6.3E-06 41.1 4.2 16 28-43 127-142 (337)
366 cd06636 STKc_MAP4K4_6 Catalyti 91.3 0.22 4.7E-06 40.4 3.3 30 27-80 140-169 (282)
367 cd05046 PTK_CCK4 Pseudokinase 91.2 0.31 6.7E-06 39.3 4.2 16 28-43 137-152 (275)
368 cd07855 STKc_ERK5 Catalytic do 91.2 0.26 5.7E-06 41.4 3.8 16 28-43 127-142 (334)
369 cd05092 PTKc_TrkA Catalytic do 91.2 0.22 4.7E-06 40.6 3.3 17 27-43 141-157 (280)
370 cd07856 STKc_Sty1_Hog1 Catalyt 91.2 0.23 5.1E-06 41.9 3.5 16 28-43 128-143 (328)
371 cd05104 PTKc_Kit Catalytic dom 91.1 0.31 6.6E-06 42.2 4.2 16 28-43 234-249 (375)
372 cd08222 STKc_Nek11 Catalytic d 90.9 0.25 5.5E-06 39.4 3.3 17 27-43 125-141 (260)
373 cd06628 STKc_MAPKKK_Byr2_like 90.9 0.21 4.5E-06 40.0 2.8 16 28-43 126-141 (267)
374 KOG1167|consensus 90.9 0.35 7.5E-06 43.4 4.4 54 4-81 129-182 (418)
375 cd06642 STKc_STK25-YSK1 Cataly 90.8 0.46 1E-05 38.4 4.9 17 27-43 120-136 (277)
376 cd07877 STKc_p38alpha_MAPK14 C 90.8 0.3 6.4E-06 41.5 3.8 16 28-43 140-155 (345)
377 PLN03224 probable serine/threo 90.8 0.4 8.6E-06 44.1 4.9 29 28-80 329-357 (507)
378 KOG1235|consensus 90.8 0.18 3.9E-06 46.8 2.7 33 28-80 321-353 (538)
379 cd05043 PTK_Ryk Pseudokinase d 90.8 0.27 5.9E-06 39.8 3.4 17 27-43 136-152 (280)
380 cd05061 PTKc_InsR Catalytic do 90.7 0.3 6.5E-06 39.9 3.7 16 28-43 139-154 (288)
381 cd07831 STKc_MOK Catalytic dom 90.7 0.29 6.3E-06 39.4 3.5 16 28-43 120-135 (282)
382 cd05105 PTKc_PDGFR_alpha Catal 90.6 0.35 7.6E-06 42.6 4.3 16 28-43 257-272 (400)
383 PRK13184 pknD serine/threonine 90.6 0.3 6.4E-06 48.1 4.1 29 28-80 133-161 (932)
384 cd06647 STKc_PAK_I Catalytic d 90.6 0.26 5.7E-06 40.6 3.3 16 28-43 135-150 (293)
385 cd07829 STKc_CDK_like Catalyti 90.6 0.35 7.6E-06 38.9 3.9 16 28-43 118-133 (282)
386 KOG0610|consensus 90.6 0.42 9.2E-06 43.1 4.7 44 11-82 186-229 (459)
387 cd06621 PKc_MAPKK_Pek1_like Ca 90.5 0.33 7.1E-06 39.7 3.7 31 27-81 124-154 (287)
388 PLN00181 protein SPA1-RELATED; 90.3 0.43 9.4E-06 45.6 4.9 17 27-43 99-115 (793)
389 KOG0595|consensus 90.3 0.5 1.1E-05 42.4 4.8 52 11-84 116-167 (429)
390 cd06626 STKc_MEKK4 Catalytic d 90.2 0.38 8.2E-06 38.2 3.8 16 28-43 119-134 (264)
391 KOG0598|consensus 90.1 0.25 5.4E-06 43.5 2.8 29 11-43 132-160 (357)
392 KOG0578|consensus 90.1 0.49 1.1E-05 43.8 4.8 33 27-83 388-420 (550)
393 cd05107 PTKc_PDGFR_beta Cataly 90.0 0.53 1.1E-05 41.5 4.9 16 28-43 259-274 (401)
394 cd07854 STKc_MAPK4_6 Catalytic 90.0 0.26 5.6E-06 41.7 2.8 16 28-43 134-149 (342)
395 cd05077 PTK_Jak1_rpt1 Pseudoki 89.9 0.63 1.4E-05 37.6 4.9 17 27-43 124-140 (262)
396 cd06609 STKc_MST3_like Catalyt 89.9 0.33 7.3E-06 39.1 3.3 16 28-43 118-133 (274)
397 PTZ00024 cyclin-dependent prot 89.8 0.29 6.4E-06 41.0 3.0 17 27-43 138-154 (335)
398 cd06620 PKc_MAPKK_Byr1_like Ca 89.7 0.33 7.2E-06 39.5 3.2 16 28-43 124-139 (284)
399 PHA02988 hypothetical protein; 89.7 0.37 8.1E-06 39.7 3.4 15 29-43 144-158 (283)
400 KOG0660|consensus 89.6 0.27 5.8E-06 43.3 2.6 33 26-82 143-175 (359)
401 cd06611 STKc_SLK_like Catalyti 89.6 0.38 8.3E-06 38.9 3.4 16 28-43 123-138 (280)
402 KOG0593|consensus 89.5 0.49 1.1E-05 41.5 4.1 28 29-80 122-149 (396)
403 KOG0607|consensus 89.3 0.59 1.3E-05 41.4 4.4 32 8-43 180-211 (463)
404 KOG0670|consensus 89.2 0.63 1.4E-05 43.5 4.8 29 11-43 543-571 (752)
405 KOG0616|consensus 89.2 0.59 1.3E-05 40.8 4.3 41 11-79 151-191 (355)
406 KOG0604|consensus 89.1 0.52 1.1E-05 41.3 4.0 54 9-87 166-219 (400)
407 cd05064 PTKc_EphR_A10 Catalyti 88.8 0.53 1.1E-05 38.0 3.7 16 28-43 127-142 (266)
408 KOG0599|consensus 88.8 0.4 8.6E-06 41.7 3.0 41 28-92 143-183 (411)
409 KOG0582|consensus 88.7 0.66 1.4E-05 42.3 4.4 33 7-43 129-161 (516)
410 COG3281 Ble Uncharacterized pr 88.3 0.26 5.5E-06 43.8 1.6 45 27-96 284-337 (438)
411 cd05078 PTK_Jak2_Jak3_rpt1 Pse 88.1 0.71 1.5E-05 37.0 4.0 18 27-44 119-136 (258)
412 cd05076 PTK_Tyk2_rpt1 Pseudoki 87.9 1 2.2E-05 36.8 4.8 16 28-43 137-152 (274)
413 KOG0615|consensus 87.6 0.73 1.6E-05 41.7 4.0 19 26-44 294-312 (475)
414 KOG1187|consensus 86.9 0.77 1.7E-05 40.3 3.8 19 28-46 197-215 (361)
415 COG5072 ALK1 Serine/threonine 86.8 0.78 1.7E-05 41.4 3.7 62 4-90 315-379 (488)
416 COG1718 RIO1 Serine/threonine 86.8 0.59 1.3E-05 39.7 2.8 26 27-77 186-211 (268)
417 KOG0198|consensus 86.6 1 2.2E-05 39.1 4.3 17 27-43 136-152 (313)
418 PF10707 YrbL-PhoP_reg: PhoP r 86.6 1.8 3.9E-05 35.0 5.5 45 8-76 122-166 (199)
419 cd08227 PK_STRAD_alpha Pseudok 86.4 0.98 2.1E-05 37.8 4.1 16 28-43 121-136 (327)
420 KOG2268|consensus 86.4 1.2 2.7E-05 39.7 4.7 43 8-78 206-248 (465)
421 KOG1164|consensus 86.3 1 2.2E-05 38.3 4.1 36 26-80 140-175 (322)
422 KOG1035|consensus 85.7 0.94 2E-05 45.8 4.0 17 27-43 716-732 (1351)
423 cd08226 PK_STRAD_beta Pseudoki 85.4 0.88 1.9E-05 38.1 3.3 16 28-43 121-136 (328)
424 KOG0586|consensus 85.3 0.9 1.9E-05 42.6 3.4 31 27-81 174-204 (596)
425 KOG0659|consensus 85.1 1.1 2.4E-05 38.5 3.7 16 28-43 121-136 (318)
426 KOG0032|consensus 85.0 1.1 2.3E-05 39.8 3.7 38 27-84 154-191 (382)
427 KOG0579|consensus 84.3 0.53 1.1E-05 45.1 1.5 16 28-43 150-165 (1187)
428 KOG0605|consensus 83.9 1.3 2.9E-05 41.0 3.9 31 26-80 259-289 (550)
429 KOG4236|consensus 83.7 1.6 3.5E-05 41.1 4.4 33 28-81 684-716 (888)
430 KOG0577|consensus 83.6 0.5 1.1E-05 44.9 1.1 35 27-85 145-179 (948)
431 KOG0591|consensus 83.0 2.2 4.7E-05 37.3 4.6 40 4-43 121-163 (375)
432 KOG0671|consensus 82.5 2.7 5.8E-05 37.7 5.1 50 26-80 210-260 (415)
433 KOG0663|consensus 82.4 2.3 4.9E-05 37.9 4.5 17 27-43 196-212 (419)
434 KOG0612|consensus 81.1 2.1 4.5E-05 43.2 4.3 19 26-44 193-211 (1317)
435 PTZ00266 NIMA-related protein 80.0 2.1 4.6E-05 42.7 4.0 16 28-43 145-160 (1021)
436 PHA03111 Ser/Thr kinase; Provi 80.0 3.1 6.6E-05 37.2 4.5 22 23-44 298-319 (444)
437 KOG0694|consensus 79.4 2.1 4.5E-05 40.8 3.5 56 10-93 474-529 (694)
438 KOG0590|consensus 79.4 1.7 3.7E-05 40.9 3.0 20 25-44 437-456 (601)
439 PF07714 Pkinase_Tyr: Protein 79.3 3.1 6.8E-05 33.5 4.2 15 29-43 124-138 (259)
440 KOG0665|consensus 79.2 1.2 2.5E-05 39.2 1.7 36 26-85 136-171 (369)
441 KOG0192|consensus 78.7 2.9 6.3E-05 36.8 4.1 17 29-45 164-180 (362)
442 KOG0664|consensus 78.6 1.5 3.3E-05 38.1 2.2 30 27-80 175-204 (449)
443 KOG1027|consensus 78.4 2.4 5.2E-05 41.4 3.7 17 27-43 625-641 (903)
444 KOG1151|consensus 78.3 4.1 8.8E-05 37.8 4.9 17 28-44 590-606 (775)
445 KOG0193|consensus 76.8 2.4 5.2E-05 40.1 3.1 17 27-43 507-523 (678)
446 KOG0600|consensus 76.2 4.4 9.5E-05 37.6 4.6 18 26-43 236-253 (560)
447 PF05445 Pox_ser-thr_kin: Poxv 76.2 2.7 5.8E-05 37.7 3.1 23 23-45 294-316 (434)
448 KOG0661|consensus 75.9 1.5 3.3E-05 40.3 1.6 19 25-43 127-145 (538)
449 KOG0575|consensus 75.5 3.5 7.6E-05 38.7 3.8 17 27-43 137-153 (592)
450 COG0515 SPS1 Serine/threonine 75.3 4.6 0.0001 31.3 4.0 16 28-43 121-136 (384)
451 KOG0585|consensus 74.3 2 4.4E-05 39.7 1.9 17 28-44 230-246 (576)
452 KOG1989|consensus 74.0 3.6 7.8E-05 39.7 3.6 34 27-84 165-198 (738)
453 KOG0666|consensus 73.1 2.6 5.7E-05 37.3 2.3 15 29-43 153-167 (438)
454 KOG3021|consensus 73.0 12 0.00025 31.8 6.0 40 28-92 211-250 (313)
455 KOG1165|consensus 69.5 12 0.00025 33.6 5.4 34 28-80 144-177 (449)
456 PF14531 Kinase-like: Kinase-l 67.9 8.5 0.00018 33.0 4.3 38 14-79 155-192 (288)
457 KOG1345|consensus 64.6 11 0.00023 33.0 4.2 31 28-80 141-171 (378)
458 cd05172 PIKKc_DNA-PK DNA-depen 63.4 6.5 0.00014 32.5 2.6 32 26-80 135-166 (235)
459 PF02604 PhdYeFM_antitox: Anti 63.1 8.3 0.00018 25.4 2.7 33 1-33 1-33 (75)
460 KOG0584|consensus 62.6 11 0.00025 35.6 4.3 17 28-44 165-181 (632)
461 cd00142 PI3Kc_like Phosphoinos 61.8 5.5 0.00012 32.3 1.9 35 26-83 127-161 (219)
462 KOG2270|consensus 61.4 7.5 0.00016 35.4 2.8 18 26-43 283-300 (520)
463 KOG0574|consensus 61.1 2.7 5.8E-05 37.1 -0.1 15 29-43 150-164 (502)
464 KOG2269|consensus 60.5 8.6 0.00019 34.6 3.0 50 4-78 380-429 (531)
465 KOG0662|consensus 60.3 5.2 0.00011 33.0 1.5 13 31-43 124-136 (292)
466 KOG1240|consensus 59.5 4.4 9.6E-05 41.1 1.1 19 25-43 137-155 (1431)
467 cd05170 PIKKc_SMG1 Suppressor 58.0 7.1 0.00015 33.6 2.0 30 27-79 209-238 (307)
468 KOG1290|consensus 57.8 9.2 0.0002 35.6 2.8 43 2-44 182-224 (590)
469 cd05171 PIKKc_ATM Ataxia telan 57.7 7 0.00015 33.1 1.9 31 26-79 180-210 (279)
470 KOG4717|consensus 57.1 11 0.00025 35.6 3.2 18 26-43 136-153 (864)
471 PF10009 DUF2252: Uncharacteri 56.9 18 0.00038 32.3 4.4 76 24-131 40-120 (385)
472 cd05169 PIKKc_TOR TOR (Target 56.8 8.1 0.00018 32.5 2.2 31 26-79 180-210 (280)
473 KOG0597|consensus 56.6 13 0.00028 35.5 3.5 39 4-43 97-135 (808)
474 KOG4158|consensus 56.1 17 0.00036 33.4 4.1 21 27-47 360-380 (598)
475 KOG0587|consensus 55.9 18 0.00039 35.8 4.5 17 27-43 142-158 (953)
476 KOG2052|consensus 53.1 17 0.00036 33.5 3.6 25 23-47 331-355 (513)
477 cd00892 PIKKc_ATR ATR (Ataxia 53.0 9 0.0002 31.7 1.8 32 26-80 138-169 (237)
478 cd05164 PIKKc Phosphoinositide 52.9 8.3 0.00018 31.6 1.5 32 26-80 130-161 (222)
479 KOG0201|consensus 52.7 16 0.00035 33.4 3.4 29 29-81 132-160 (467)
480 KOG0611|consensus 52.5 7.4 0.00016 35.7 1.3 17 27-43 172-188 (668)
481 KOG1152|consensus 52.0 20 0.00044 34.2 4.0 33 25-81 687-719 (772)
482 COG2112 Predicted Ser/Thr prot 51.0 9.7 0.00021 31.1 1.6 36 27-87 124-161 (201)
483 KOG0580|consensus 51.0 15 0.00032 31.4 2.7 23 20-43 137-159 (281)
484 KOG0907|consensus 50.1 34 0.00075 24.7 4.3 43 68-113 20-62 (106)
485 KOG1236|consensus 49.7 8.2 0.00018 35.6 1.1 18 29-46 366-383 (565)
486 smart00146 PI3Kc Phosphoinosit 49.5 13 0.00029 29.7 2.2 35 26-84 100-134 (202)
487 KOG2464|consensus 49.1 18 0.0004 29.8 3.1 30 14-43 144-173 (246)
488 KOG3653|consensus 49.1 34 0.00074 31.7 4.9 23 25-47 333-355 (534)
489 KOG0589|consensus 44.7 15 0.00033 33.3 2.0 18 26-43 124-141 (426)
490 PF00454 PI3_PI4_kinase: Phosp 43.8 14 0.00031 29.7 1.6 32 27-81 134-165 (235)
491 KOG0906|consensus 43.8 3.2E+02 0.007 26.7 10.6 71 3-97 644-745 (843)
492 KOG4721|consensus 43.2 20 0.00044 34.3 2.6 16 28-43 232-247 (904)
493 PF12377 DuffyBP_N: Duffy bind 40.4 46 0.001 22.0 3.2 27 66-92 18-44 (66)
494 PF13575 DUF4135: Domain of un 39.1 19 0.0004 31.5 1.7 29 29-82 150-178 (370)
495 KOG0669|consensus 38.7 16 0.00034 31.7 1.1 17 27-43 143-159 (376)
496 cd05163 TRRAP TRansformation/t 38.6 22 0.00048 29.7 2.0 30 27-79 154-183 (253)
497 KOG0033|consensus 38.5 22 0.00047 30.7 1.9 19 26-44 128-146 (355)
498 KOG0614|consensus 37.0 19 0.00042 33.9 1.5 28 28-79 540-567 (732)
499 PF12260 PIP49_C: Protein-kina 36.8 76 0.0017 25.0 4.8 32 29-84 83-114 (188)
500 KOG4645|consensus 36.7 51 0.0011 34.3 4.4 16 28-43 1354-1369(1509)
No 1
>KOG2686|consensus
Probab=100.00 E-value=2.8e-45 Score=316.04 Aligned_cols=151 Identities=43% Similarity=0.716 Sum_probs=140.8
Q ss_pred CCccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 1 MKKILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 1 ~~~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
++.+..++|..|+.+++++.+..++|+||||||||+||||+.+ ..+.+++||||||+
T Consensus 186 ~~~~~~~~l~~e~~~~~~~~e~~~~~vvFcHNDlq~gNiL~~~-----------------------~t~~Lv~IDfEYas 242 (366)
T KOG2686|consen 186 PDKLEIEDLLLELSLFRKWSELTKSPVVFCHNDLQYGNILLLN-----------------------STKELVLIDFEYAS 242 (366)
T ss_pred cchhhHHHHHHHHHHHHHHHhcCCCCeeeecccccccceeeec-----------------------CCCceeEEeecccc
Confidence 4678889999999999999977889999999999999999986 34689999999999
Q ss_pred CccchhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCC---C--CCcHHHHHHHHHHHHHHHHHH
Q psy15664 81 YNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQ---E--DSTPESVLEEVKHFTLASHFF 155 (174)
Q Consensus 81 ~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~---~--~~~v~~l~~~v~~~~~~s~~~ 155 (174)
||+||||||||||||++||+++++|++.++.+.||++++++.|+++|+.+... + +++++.|+++++.|++++|++
T Consensus 243 yN~r~fDlanHf~E~~~DY~~~~~P~~~~~~~~~p~~e~~~~F~~sYl~~~~~~~~~~~~~ev~~L~~e~~~~~p~shlf 322 (366)
T KOG2686|consen 243 YNPRGFDLANHFCEWAADYHTPTPPGLKINPDLYPGEEQRQRFIESYLDSAAVKRKEPREKEVEKLLKEIRFFTPASHLF 322 (366)
T ss_pred CCchhhhHHHHHHHhhccccCCCCCeeecchhhCCCcHHHHHHHHHHHHHhhccccCchHHHHHHHHHHHHHHhhhhHHH
Confidence 99999999999999999999999999999999999999999999999988763 2 278999999999999999999
Q ss_pred HHHHHHHHcccC-CCCCCCC
Q psy15664 156 WALWSFVHDDTS-EISFGYW 174 (174)
Q Consensus 156 W~lWaliq~~~s-~i~fdy~ 174 (174)
|+|||++|+..+ .|+|||+
T Consensus 323 W~LWsi~q~~~~~~i~fdy~ 342 (366)
T KOG2686|consen 323 WGLWSILQALVLHKIEFDYM 342 (366)
T ss_pred HHHHHHHHhhhccccccChH
Confidence 999999999999 8999995
No 2
>KOG4720|consensus
Probab=100.00 E-value=2e-44 Score=304.62 Aligned_cols=140 Identities=39% Similarity=0.728 Sum_probs=130.9
Q ss_pred ccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 3 KILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 3 ~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
.++++.|.+|+.||++.+...++|+|||||||.+|||+++. ..+++.|||||||+||
T Consensus 224 ~~~~~~L~~Ei~~l~E~l~~L~sPVVFcHNDLL~~Niiy~~-----------------------~~~~v~fIDYEYa~yN 280 (391)
T KOG4720|consen 224 EPSPEDLGEEISKLKEMLSMLKSPVVFCHNDLLCGNIIYDS-----------------------EKGSVEFIDYEYAGYN 280 (391)
T ss_pred CCCHHHHHHHHHHHHHHHHhhCCCeEEeecchhhcceeecc-----------------------ccCcEEEEeecccccc
Confidence 46788999999999999999999999999999999999987 5688999999999999
Q ss_pred cchhhHHHHHHHHhhhccCCCCCcc-cccCCCCCCHHHHHHHHHHHHhccCCCC---CcHHHHHHHHHHHHHHHHHHHHH
Q psy15664 83 YRAFDIANHFVESVYDYSYKHFPHY-TVKRENYPSYSLRKSFVETYLSRMNQED---STPESVLEEVKHFTLASHFFWAL 158 (174)
Q Consensus 83 ~~~fDlan~f~E~~~dy~~~~~p~~-~~~~~~~p~~~~~~~fl~~Yl~~~~~~~---~~v~~l~~~v~~~~~~s~~~W~l 158 (174)
|++|||||||||.+ |. .+|++.||++|+|.+||+.||+..++.+ .+|+.|+.+|.+|.+++|++|++
T Consensus 281 Y~afDIgNHFnE~a---------Gv~evDYSlyp~rE~Q~qwl~~YLq~~kg~evs~~eVe~lfvqvn~FalAsHlfWav 351 (391)
T KOG4720|consen 281 YQAFDIGNHFNEYA---------GVEEVDYSLYPTREEQLQWLRDYLQAYKGKEVSDTEVETLFVQVNQFALASHLFWAV 351 (391)
T ss_pred hhheehhhhHHhhc---------CCCccchhcCCCHHHHHHHHHHHHhhccCccCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999987 23 5788999999999999999999987643 79999999999999999999999
Q ss_pred HHHHHcccCCCCCCCC
Q psy15664 159 WSFVHDDTSEISFGYW 174 (174)
Q Consensus 159 Waliq~~~s~i~fdy~ 174 (174)
||++|++.|+|||||+
T Consensus 352 WAllQA~~StIdFdyl 367 (391)
T KOG4720|consen 352 WALLQAQNSTIDFDYL 367 (391)
T ss_pred HHHHHhhcCcccccch
Confidence 9999999999999995
No 3
>PTZ00296 choline kinase; Provisional
Probab=100.00 E-value=3.9e-42 Score=306.33 Aligned_cols=144 Identities=35% Similarity=0.687 Sum_probs=129.2
Q ss_pred hhhHHHHHHHHHHHHh------hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 6 SKDLNTEADWLKKHLL------KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 6 ~~~L~~e~~~l~~~l~------~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.+.+.+|+.++++.+. ..+.++||||||++++|||..+ ++++|||||||
T Consensus 257 ~~~l~~e~~~l~~~l~~~~~l~~~~~~~VfCHNDl~~~NiL~~~-------------------------~~l~LIDfEYA 311 (442)
T PTZ00296 257 IHKYIKESEKFIKFMKVYSKSDNLANDIVFCHNDLQENNIINTN-------------------------KCLRLIDFEYS 311 (442)
T ss_pred HHHHHHHHHHHHHHHHhhcccccccCCeeEEeCCCCccceeecC-------------------------CCEEEEeeccc
Confidence 4567788999988886 5567999999999999999754 46999999999
Q ss_pred cCccchhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC------CCcHHHHHHHHHHHHHHHH
Q psy15664 80 SYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE------DSTPESVLEEVKHFTLASH 153 (174)
Q Consensus 80 ~~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~------~~~v~~l~~~v~~~~~~s~ 153 (174)
|+|+|+||||||||||++||+.+++|+|.++.+.||+.++|+.|+++||+..... ++++++++.+|..|++++|
T Consensus 312 g~ndpafDIAn~f~E~~~dy~~~~~p~f~~d~~~yPs~e~q~~Fi~~Yl~~~~~~~~~~~~~~~v~~l~~ev~~f~l~sh 391 (442)
T PTZ00296 312 GYNFLATDIANFFIETTIDYSVSHYPFFAIDKKKYISYENRKLFITAYLSNYLDKSLVVPNPKIIDQILEAVEVQALGAH 391 (442)
T ss_pred ccccHHHHHHHHHHHHhhhcCCCCCCccccCcccCcCHHHHHHHHHHHHHHhccCCCCCchHHHHHHHHHHHHHHhhhhH
Confidence 9999999999999999999999999999999999999999999999999875221 2468899999999999999
Q ss_pred HHHHHHHHHHcc--cCCCCCCCC
Q psy15664 154 FFWALWSFVHDD--TSEISFGYW 174 (174)
Q Consensus 154 ~~W~lWaliq~~--~s~i~fdy~ 174 (174)
++||+||++|+. .|.|+|||+
T Consensus 392 l~W~lWaiiqa~~~~s~idFDy~ 414 (442)
T PTZ00296 392 LLWGFWSIIRGYQTKSYNEFDFF 414 (442)
T ss_pred HHHHHHHHHhCCcccCCCCCCHH
Confidence 999999999997 467999985
No 4
>PTZ00384 choline kinase; Provisional
Probab=100.00 E-value=1.8e-38 Score=278.40 Aligned_cols=135 Identities=30% Similarity=0.517 Sum_probs=120.1
Q ss_pred hhhHHHHHHHHHHHHhhc-------CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664 6 SKDLNTEADWLKKHLLKI-------KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY 78 (174)
Q Consensus 6 ~~~L~~e~~~l~~~l~~~-------~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY 78 (174)
...+.+++..+++.++.. ..++||||||++++|||..+ +++.||||||
T Consensus 199 ~~~l~~~~~~~~~~L~~~l~~~~~~~~~~VfCHNDL~~gNIL~~~-------------------------~~l~lID~EY 253 (383)
T PTZ00384 199 YNELVQNYELFKKILNNHLNTSNSITNSVLFCHNDLFFTNILDFN-------------------------QGIYFIDFDF 253 (383)
T ss_pred HHHHHHHHHHHHHHHHHhhccccccccceeeeeccCCcccEEecC-------------------------CCEEEEEecc
Confidence 346778888887777532 34699999999999999754 5799999999
Q ss_pred ccCccchhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC-----CCcHHHHHHHHHHHHHHHH
Q psy15664 79 CSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE-----DSTPESVLEEVKHFTLASH 153 (174)
Q Consensus 79 a~~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~-----~~~v~~l~~~v~~~~~~s~ 153 (174)
|++|+|+||||||||||++||+.+++|+|..+.+.||+.++|..|++.|+++..+. +++++.|+.+|..|++++|
T Consensus 254 A~~n~~~fDLAn~f~E~~~~y~~~~~~~~~~~~~~~ps~e~~~~fi~~Yl~~~~~~~~~~~~~~~~~l~~~v~~~~l~sh 333 (383)
T PTZ00384 254 AGFNYVGWEIANFFVKLYIVYDPPTPPYFNSDDSLALSEEMKTIFVSVYLSQLLGKNVLPSDDLVKEFLQSLEIHTLGVN 333 (383)
T ss_pred ccCCchHhHHHHHHHHHhcccCCCCCCccccCCCCCCCHHHHHHHHHHHHHHhcCCCCCCcHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999875321 2578999999999999999
Q ss_pred HHHHHHHHHHcc
Q psy15664 154 FFWALWSFVHDD 165 (174)
Q Consensus 154 ~~W~lWaliq~~ 165 (174)
++|++||+||+.
T Consensus 334 ~~W~lW~iIq~~ 345 (383)
T PTZ00384 334 LFWTYWGIVMND 345 (383)
T ss_pred HHHHHHHHHhCC
Confidence 999999999998
No 5
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=100.00 E-value=1.6e-38 Score=273.04 Aligned_cols=139 Identities=39% Similarity=0.676 Sum_probs=122.8
Q ss_pred cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
+..+.+.+++..+++.+...+.|+||||||++++|||+.+ .++++.||||||||+|+
T Consensus 159 ~~~~~l~~~~~~l~~~~~~~~~~~v~CHnDl~~~NiL~~~-----------------------~~~~l~lID~EYag~nd 215 (330)
T PLN02421 159 ISFEELRDEIVELKEITDSLKAPVVFAHNDLLSGNLMLNE-----------------------DEGKLYFIDFEYGSYSY 215 (330)
T ss_pred cCHHHHHHHHHHHHHHhccCCCCeEEEECCCCcccEEEeC-----------------------CCCcEEEEcccccCCCc
Confidence 4467888999999999988899999999999999999975 24679999999999999
Q ss_pred chhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC---CCcHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664 84 RAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE---DSTPESVLEEVKHFTLASHFFWALWS 160 (174)
Q Consensus 84 ~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~---~~~v~~l~~~v~~~~~~s~~~W~lWa 160 (174)
|+||||||||||+ +|.++.+.||+.++|..|+++|++..... +.++++++.+|+.|++++|++|++||
T Consensus 216 ~~fDIa~~f~E~~---------~~~~~~~~~p~~~~~~~fl~~Y~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~W~lWa 286 (330)
T PLN02421 216 RGYDIGNHFNEYA---------GFDCDYSLYPSKEEQYHFFRHYLRPDDPEEVSDAELEELFVETNFYALASHLYWAIWA 286 (330)
T ss_pred cHHHHHHHHHHHc---------ccccCcccCcCHHHHHHHHHHhCCcccCCcchHHHHHHHHHHHHHHhhhhHHHHHHHH
Confidence 9999999999987 24456689999999999999999764321 25688999999999999999999999
Q ss_pred HHHcccCCCCCCCC
Q psy15664 161 FVHDDTSEISFGYW 174 (174)
Q Consensus 161 liq~~~s~i~fdy~ 174 (174)
++|+..|+|+|||+
T Consensus 287 ~iq~~~s~i~fdf~ 300 (330)
T PLN02421 287 IVQAKMSPIDFDYL 300 (330)
T ss_pred HHHhhcCCcCCCHH
Confidence 99999999999985
No 6
>PLN02236 choline kinase
Probab=100.00 E-value=1.8e-36 Score=261.94 Aligned_cols=145 Identities=40% Similarity=0.719 Sum_probs=127.9
Q ss_pred chhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 5 LSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 5 ~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
..+.+..++.+|++.+.....++||||||++++|||+.+ .++.+.|||||||++|+|
T Consensus 178 ~~~~l~~~~~~L~~~~~~~~~~~~~cH~Dl~~~Nil~~~-----------------------~~~~~~lID~Eya~~~~~ 234 (344)
T PLN02236 178 RLDSLEDEINLLEKELSGDDQEIGFCHNDLQYGNIMIDE-----------------------ETRAITIIDYEYASYNPV 234 (344)
T ss_pred CHHHHHHHHHHHHHHhcccCCCceEEeCCCCcCcEEEeC-----------------------CCCcEEEEeehhccccch
Confidence 346788899999998888788999999999999999975 235799999999999999
Q ss_pred hhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC--CCcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664 85 AFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE--DSTPESVLEEVKHFTLASHFFWALWSFV 162 (174)
Q Consensus 85 ~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~--~~~v~~l~~~v~~~~~~s~~~W~lWali 162 (174)
+||||+||||++.+|+.+++ +.++.+.||+.++++.|++.|+++.+.. +.+++.++.+|+.|.+++|++|++||++
T Consensus 235 ~~Dia~~~~e~~~~y~~~~~--~~~~~~~~~~~~~~~~fi~~Yl~~~g~~~~~~~~~~l~~~v~~~~~~~~l~W~lWa~i 312 (344)
T PLN02236 235 AYDIANHFCEMAADYHSETP--HILDYSKYPGEEERRRFIRTYLSSSGEEPSDEEVEQLLDDVEKYTLASHLFWGLWGII 312 (344)
T ss_pred HHHHHHHHHHHHHhhcCCCc--ccCchhhCcCHHHHHHHHHHHHhhcCCCchHHHHHHHHHHHHHHhhHhHHHHHHHHHH
Confidence 99999999999999977654 3378888999999999999999764321 2578899999999999999999999999
Q ss_pred HcccCCCCCCCC
Q psy15664 163 HDDTSEISFGYW 174 (174)
Q Consensus 163 q~~~s~i~fdy~ 174 (174)
|+..|+|+|||+
T Consensus 313 q~~~s~~~fdy~ 324 (344)
T PLN02236 313 SGHVNKIDFDYM 324 (344)
T ss_pred hcccCCCCCCHH
Confidence 999999999985
No 7
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=100.00 E-value=4e-34 Score=240.38 Aligned_cols=135 Identities=46% Similarity=0.832 Sum_probs=114.8
Q ss_pred HHHHHHHHHHHHhh-----cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 9 LNTEADWLKKHLLK-----IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 9 L~~e~~~l~~~l~~-----~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
+..++..+++.+.. ...++||||||++++|||+.+++. +.+.+.|||||||++|+
T Consensus 156 ~~~~~~~~~~~l~~~~~~~~~~~~~lcH~Dl~~~Nil~~~~~~--------------------~~~~i~lIDwEya~~~~ 215 (302)
T cd05156 156 FLEDEAKYLRFLLESTSEESGSPVVFCHNDLQEGNILLLNPSS--------------------ETKKLVLIDFEYASYNY 215 (302)
T ss_pred HHHHHHHHHHHHHhhccCCCCCCceEEecCCCcCeEEecCCCC--------------------CCCcEEEEeeCCCCCCC
Confidence 34444455555543 347899999999999999986210 13679999999999999
Q ss_pred chhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC-------CCcHHHHHHHHHHHHHHHHHHH
Q psy15664 84 RAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE-------DSTPESVLEEVKHFTLASHFFW 156 (174)
Q Consensus 84 ~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~-------~~~v~~l~~~v~~~~~~s~~~W 156 (174)
|+||||+|||||+++|+.+++|++.++.+.||+.++|..|++.|+++.... ..++++++.+|+.|.+++|++|
T Consensus 216 p~~DlA~~~~e~~~~~~~~~~~~~~~~~~~~p~~~~~~~f~~~Yl~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~W 295 (302)
T cd05156 216 RGFDIANHFCEWMYDYHDPEPPFFKIHEDKYPTEEQRLNFISAYLSESLKGKNSVEEREKEVKDLLEEVEIFTPASHLFW 295 (302)
T ss_pred cHHHHHHHHHHHHhhcCCCCCCccccChhhCcCHHHHHHHHhccCchhcccccccCcHHHHHHHHHHHHHHHHhhhhHHH
Confidence 999999999999999999999999999999999999999999999876421 2678899999999999999999
Q ss_pred HHHHHHH
Q psy15664 157 ALWSFVH 163 (174)
Q Consensus 157 ~lWaliq 163 (174)
++||++|
T Consensus 296 ~lW~~~q 302 (302)
T cd05156 296 ALWGIIQ 302 (302)
T ss_pred HHHHhcC
Confidence 9999997
No 8
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome. Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=99.92 E-value=9.3e-26 Score=181.30 Aligned_cols=92 Identities=43% Similarity=0.711 Sum_probs=75.1
Q ss_pred cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
+.+..|.+++.++++.+++.++++|||||||+++|||+.. .+++++|||||||++|+
T Consensus 120 ~~~~~l~~~~~~~~~~l~~~~~~~v~cHnDl~~~Nil~~~-----------------------~~~~~~lIDfEya~~n~ 176 (211)
T PF01633_consen 120 EDLEDLQEELEELEKLLEKSNSPLVFCHNDLNPGNILINN-----------------------KDGEVKLIDFEYAGYND 176 (211)
T ss_dssp HHHHHHHHHHHHHHHHHHTSCGGEEEE-S--SGGGEEETS-----------------------SSSCEEE--GTT-EEEE
T ss_pred CCHHHHHHHHhhhhhhhhccCCCceEeeccCccccEEecc-----------------------CCCeEEEecHHHHhhcc
Confidence 3456788999999999998899999999999999999933 35889999999999999
Q ss_pred chhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHH
Q psy15664 84 RAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSL 119 (174)
Q Consensus 84 ~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~ 119 (174)
|+|||||||+|++++|...+. .+.++.+.||+++|
T Consensus 177 ~~fDia~~f~e~~~~~~~~~~-~~~~~~~~yp~~~~ 211 (211)
T PF01633_consen 177 RAFDIANFFCEWNFDYEQEEF-FFKCDYSKYPTEEQ 211 (211)
T ss_dssp HHHHHHHHHHHTTEETTHSST-STEE-GGGS--HHH
T ss_pred chhhHHHHHHHHcCchhhhhh-hhhhhHhhCCCccC
Confidence 999999999999999999888 89999999999875
No 9
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=99.83 E-value=3.4e-20 Score=152.84 Aligned_cols=98 Identities=21% Similarity=0.290 Sum_probs=83.7
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
+.+.|+||||++++|||+++ +++.|||||||++|+|+||||++++++
T Consensus 143 ~~~~~l~H~Dl~~~Nil~~~-------------------------~~~~lIDwE~a~~gdp~~DLa~~~~~~-------- 189 (256)
T TIGR02721 143 PLPLAPLHMDVHAYNLVVTP-------------------------QGLKLIDWEYASDGDIALELAAIIRAN-------- 189 (256)
T ss_pred CCCCeeecCCCCcCcEEEeC-------------------------CCCEEEeccccCcCCHHHHHHHHHHhC--------
Confidence 34789999999999999976 348999999999999999999999873
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcccCC
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDDTSE 168 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~~s~ 168 (174)
+.+++..|+++|.+.... ...+.+.++++.|.++++++|++|+.++...+.
T Consensus 190 ------------~~~~~~~~l~~Y~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~ 240 (256)
T TIGR02721 190 ------------DEEQQQDFVQRYCQRRRI--YSISVLWRQVKAWQPWVDYMAALWFELRWQQTG 240 (256)
T ss_pred ------------CHHHHHHHHHHHHHhhCC--ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence 478899999999976432 234678899999999999999999988876653
No 10
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=99.83 E-value=1.2e-20 Score=152.71 Aligned_cols=87 Identities=45% Similarity=0.833 Sum_probs=74.7
Q ss_pred hhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664 6 SKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA 85 (174)
Q Consensus 6 ~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~ 85 (174)
.+.+.+++.+|++.+.....+.|+||||++++|||+++ .++.+.|||||||++|+|+
T Consensus 149 ~~~l~~~~~~l~~~l~~~~~~~~l~H~Dl~~~Nil~~~-----------------------~~~~~~lIDwe~a~~~~~~ 205 (235)
T cd05157 149 FEQLRDEISWLKELLSALNSPIVFCHNDLLSGNIIYNE-----------------------EKNSVKFIDYEYAGYNYRA 205 (235)
T ss_pred HHHHHHHHHHHHHHhcccCCCEEEEcCCCCcCcEEEeC-----------------------CCCCEEEEEcccCCcCchh
Confidence 45677778888888877778899999999999999985 2357999999999999999
Q ss_pred hhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHH
Q psy15664 86 FDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFV 124 (174)
Q Consensus 86 fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl 124 (174)
||||++|+||+ ++.++...||+.++|+.|+
T Consensus 206 ~Dla~~~~e~~---------~~~~~~~~~~~~~~~~~~~ 235 (235)
T cd05157 206 FDIANHFNEWA---------GFDCDYYLYPPKEEQQAFI 235 (235)
T ss_pred eeHHHHHHHHc---------CccCChhhCcCHHHHHhhC
Confidence 99999999987 2455678999999999985
No 11
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=99.82 E-value=9e-20 Score=153.50 Aligned_cols=110 Identities=27% Similarity=0.538 Sum_probs=90.3
Q ss_pred hhHHHHHHHHHHHHhhcCCC-eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664 7 KDLNTEADWLKKHLLKIKSP-VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA 85 (174)
Q Consensus 7 ~~L~~e~~~l~~~l~~~~~~-~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~ 85 (174)
..+++.+..|++.+...+.+ .|+||||++++|+|.++ ++++.||||||||+|+++
T Consensus 132 ~~~~~~~~~l~~~l~~~~~~~~v~cH~Dl~~~N~l~t~------------------------~~~l~LIDWEyAg~~D~~ 187 (269)
T COG0510 132 HLLRKKLKELRRALEEVPKDDLVPCHNDLNPGNLLLTD------------------------KGGLFLIDWEYAGLNDPA 187 (269)
T ss_pred HHHHHHHHHHHHHhhhcCCCceeeecCCCCccceEEcC------------------------CCcEEEEecccCCCccHH
Confidence 35667788888888888877 89999999999999986 478999999999999999
Q ss_pred hhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcc
Q psy15664 86 FDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDD 165 (174)
Q Consensus 86 fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~ 165 (174)
||||+++.|+..+ ..+......+|++...- +. |..+.+...+.|.+|+.+|..
T Consensus 188 ~DLA~~~~e~~~~------------------~~~~~~~~~~~~~~~~~-----~~----~~~~~i~~~~~W~l~~~~~~~ 240 (269)
T COG0510 188 FDLAALLSEYIFN------------------HNELEDLYSAYLEKYGF-----EA----VLIYKILQKFLWYLWTKLQEQ 240 (269)
T ss_pred HHHHHHHHHhccc------------------hhHHHHHHHHHHHhCCc-----hh----hHHHHHHHHhHHHHHHHHHHH
Confidence 9999999998853 33455566666665432 11 678999999999999999998
Q ss_pred cC
Q psy15664 166 TS 167 (174)
Q Consensus 166 ~s 167 (174)
..
T Consensus 241 ~~ 242 (269)
T COG0510 241 IL 242 (269)
T ss_pred hh
Confidence 76
No 12
>PRK10271 thiK thiamine kinase; Provisional
Probab=99.73 E-value=2.4e-17 Score=132.42 Aligned_cols=97 Identities=20% Similarity=0.266 Sum_probs=84.0
Q ss_pred hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccC
Q psy15664 22 KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY 101 (174)
Q Consensus 22 ~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~ 101 (174)
..+.+.|+||||++++||++.+ +++++||||||+.|+|++|||..+.+
T Consensus 72 ~~~l~~~p~H~D~~~~N~~~~~-------------------------~~~~lIDwe~a~~gDp~~DLa~~~~~------- 119 (188)
T PRK10271 72 PRPLRLAPLHMDVHAGNLVHSA-------------------------SGLRLIDWEYAGDGDIALELAAVWVE------- 119 (188)
T ss_pred CCCCCeeeecCCCCCccEEEEC-------------------------CCEEEEeCCcccCCCHHHHHHHHHcC-------
Confidence 4456789999999999999876 45999999999999999999999863
Q ss_pred CCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcccC
Q psy15664 102 KHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDDTS 167 (174)
Q Consensus 102 ~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~~s 167 (174)
+.++++.|+++|.++.. .+...+.++++.|.+...++=.+|..++.+.+
T Consensus 120 --------------~~~~~~~~l~~Y~~~~~---~d~~~~~~~~~~W~p~~~~m~llWyev~~qq~ 168 (188)
T PRK10271 120 --------------NTEQHRQLVNDYATRAK---IDAAQLWRQVRRWFPWVLMLKAGWFEYRWRQT 168 (188)
T ss_pred --------------CHHHHHHHHHHHhCccC---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 47899999999996521 34567899999999999999999999998775
No 13
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=99.49 E-value=1.7e-13 Score=104.69 Aligned_cols=78 Identities=35% Similarity=0.494 Sum_probs=62.2
Q ss_pred HHHHHHHHHHhhcCC-CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHH
Q psy15664 11 TEADWLKKHLLKIKS-PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIA 89 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~-~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDla 89 (174)
.++..+-+.+...+. +.++||+|++++|||+++ +++++||||+++++++++|||
T Consensus 90 ~~l~~~l~~LH~~~~~~~~~~HgD~~~~Nil~~~-------------------------~~~~liDf~~a~~~~~~~Dla 144 (170)
T cd05151 90 EKIAKLLKKLHSSPLPDLVPCHNDLLPGNFLLDD-------------------------GRLWLIDWEYAGMNDPLFDLA 144 (170)
T ss_pred HHHHHHHHHHhCCCCCCceeecCCCCcCcEEEEC-------------------------CeEEEEecccccCCChHHHHH
Confidence 334433333433332 678999999999999974 579999999999999999999
Q ss_pred HHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664 90 NHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRM 131 (174)
Q Consensus 90 n~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~ 131 (174)
.++.++.+ +++++..|+++|-++.
T Consensus 145 ~~~~~~~~------------------~~~~~~~~~~~y~~~~ 168 (170)
T cd05151 145 NFFSEAKL------------------SEDQEEELLEAYFGRE 168 (170)
T ss_pred HHHHhcCC------------------CHHHHHHHHHHHhCCC
Confidence 99988652 6888999999998764
No 14
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=99.41 E-value=4.7e-12 Score=105.79 Aligned_cols=99 Identities=15% Similarity=0.178 Sum_probs=69.8
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
..|.++||+|++++|||+++ ++.+.|||||+|+++++.+|||..+..|++...
T Consensus 172 ~~~~~l~HgD~~~~Nil~~~------------------------~~~~~iIDfe~a~~g~~~~Dla~~~~~~~~~~~--- 224 (296)
T cd05153 172 DLPRGVIHADLFRDNVLFDG------------------------DELSGVIDFYFACTDAFLYDLAITLNDWCFDED--- 224 (296)
T ss_pred cCCCcCCccCcCcccEEEeC------------------------CceEEEeehhhhcCchHHHHHHHHHHHHHhCcc---
Confidence 45789999999999999986 234579999999999999999999988774211
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFV 162 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWali 162 (174)
.. .+.+....|++.|.+..+-.+++.+ .+..+.++..+.+.+|++.
T Consensus 225 --------~~-~~~~~~~~~l~gY~~~~~ls~~e~~----~l~~~~~~~a~~~~~~~~~ 270 (296)
T cd05153 225 --------GA-LDPERAQALLAGYQAVRPLTEAERA----ALPIMLRGAALRFWLSRLY 270 (296)
T ss_pred --------CC-CCHHHHHHHHHHHHhcCCCCHHHHH----HHHHHHHHHHHHHHHHHHH
Confidence 11 2677899999999876443223333 3344444444555555553
No 15
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=99.39 E-value=7.9e-13 Score=108.39 Aligned_cols=73 Identities=18% Similarity=0.178 Sum_probs=59.6
Q ss_pred HHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHH
Q psy15664 15 WLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVE 94 (174)
Q Consensus 15 ~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E 94 (174)
.+++.++..+.+.++||+|++++|||+.+ ++ +.|||||++++++|.+|||.++.-
T Consensus 141 ~l~~~l~~~~~~~~~~HgD~~~~Nii~~~------------------------~~-~~iIDwe~a~~Gdp~~Dla~~~~~ 195 (226)
T TIGR02172 141 KARAFIKEVPDTSTCLHGDFQIGNLITSG------------------------KG-TYWIDLGDFGYGNPLFDLGLLFMF 195 (226)
T ss_pred HHHHHHHhCCCCCceEecCCCCCcEEEcC------------------------CC-cEEEechhcCcCCHHHHHHHHHHh
Confidence 34555555666678899999999999976 23 899999999999999999998865
Q ss_pred HhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhc
Q psy15664 95 SVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSR 130 (174)
Q Consensus 95 ~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~ 130 (174)
+.+ ...++++|+..|..+
T Consensus 196 ~~~------------------~~~~~~~~~~~y~~~ 213 (226)
T TIGR02172 196 CHY------------------LDDDKLQAIFHMNAE 213 (226)
T ss_pred ccC------------------ChhHHHHHHHhcCHH
Confidence 442 577899999999975
No 16
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=99.23 E-value=7.9e-11 Score=104.45 Aligned_cols=67 Identities=30% Similarity=0.467 Sum_probs=54.9
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
.|..++..|+..+.. .+.+++|+|+++||||+.+ .++.+||||+|.+|+++||
T Consensus 206 ~L~~~~~~L~~~~~~--~~~~l~HgDl~~gni~~~~-------------------------~~~~viD~E~a~~G~~~~D 258 (401)
T PRK09550 206 ELKLEVAKLKHKFLT--KAEALLHGDLHTGSIFVTE-------------------------EETKVIDPEFAFYGPIGFD 258 (401)
T ss_pred HHHHHHHHHHHHHhc--CCCceeeccCCcccEEeeC-------------------------CCcEEEeccccccCChHHH
Confidence 345566666666553 3568999999999999976 4689999999999999999
Q ss_pred HHHHHHHHhhhccC
Q psy15664 88 IANHFVESVYDYSY 101 (174)
Q Consensus 88 lan~f~E~~~dy~~ 101 (174)
||+++.++...|..
T Consensus 259 lg~~lanl~~~~~~ 272 (401)
T PRK09550 259 IGTFIANLLLNYCS 272 (401)
T ss_pred HHHHHHHHHHHHhc
Confidence 99999998876644
No 17
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=99.22 E-value=2.1e-11 Score=96.26 Aligned_cols=49 Identities=20% Similarity=0.297 Sum_probs=42.6
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHH
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 95 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~ 95 (174)
.+.++||+|++++|||+.++ ..+.+.|||||++++++|++|||.++.+|
T Consensus 172 ~~~~l~HgD~~~~Nil~~~~----------------------~~~~~~iID~e~~~~g~~~~Dla~~~~~~ 220 (223)
T cd05154 172 SRPGLVHGDYRLGNVLFHPD----------------------EPRVVAVLDWELATLGDPLADLGWLLMYW 220 (223)
T ss_pred CCcEEEECCCCcccEEEcCC----------------------CCcEEEEEeccccccCChHHHHHHHHHhc
Confidence 57899999999999999762 02457899999999999999999999875
No 18
>PRK05231 homoserine kinase; Provisional
Probab=99.17 E-value=3.3e-10 Score=95.85 Aligned_cols=95 Identities=16% Similarity=0.196 Sum_probs=65.7
Q ss_pred HHHHHHHHHHHhh---cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchh
Q psy15664 10 NTEADWLKKHLLK---IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAF 86 (174)
Q Consensus 10 ~~e~~~l~~~l~~---~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~f 86 (174)
..++..+.+.+.. ...|.++||+|++++|||+.+ ++-..||||++|+++++.|
T Consensus 167 ~~~~~~~~~~~~~~~~~~lp~~liHgD~~~~Nil~~~------------------------~~~~~iIDf~~~~~~~~~~ 222 (319)
T PRK05231 167 EAELAAQLAFLASAAWPALPRGVIHADLFRDNVLFEG------------------------DRLSGFIDFYFACNDKLLY 222 (319)
T ss_pred HHHHHHHHHhhhccccccCCcccCCCCCCCCcEEEEC------------------------CceEEEEecccccCCchHH
Confidence 3444444444432 125778999999999999975 2334799999999999999
Q ss_pred hHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHH
Q psy15664 87 DIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPES 140 (174)
Q Consensus 87 Dlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~ 140 (174)
|||..+.-|+++.. ..+ +.+....|+++|-+..+-.+.+.+.
T Consensus 223 DlA~~~~~~~~~~~-----------~~~-~~~~~~~~l~gY~~~~~Ls~~E~~~ 264 (319)
T PRK05231 223 DVAITLNDWCFEAD-----------GSL-DATKARALLAAYQSVRPLTAAERAA 264 (319)
T ss_pred HHHHHHHHHHccCC-----------CCc-CHHHHHHHHHHHhhcCCCCHHHHHH
Confidence 99999988875421 112 4567889999997664432234433
No 19
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=99.17 E-value=1.4e-10 Score=97.26 Aligned_cols=99 Identities=24% Similarity=0.357 Sum_probs=73.3
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
..+.++||+|++++|||+.+ +.+.|||||.++++++.+|||.++..++-
T Consensus 184 ~~~~~liHgD~~~~Nil~~~-------------------------~~i~lIDfd~~~~~~~~~Dla~~l~~~~~------ 232 (313)
T TIGR02906 184 KKIRGFCHQDYAYHNILLKD-------------------------NEVYVIDFDYCTIDLPVRDLRKLIIKLMK------ 232 (313)
T ss_pred cCcCceEcCCCCcccEEEeC-------------------------CcEEEEECcccccCCcHHHHHHHHHHHHH------
Confidence 45679999999999999975 46899999999999999999999876650
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHc
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHD 164 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~ 164 (174)
....+ +.+....|++.|.+..+-.+. -++-+..+....+-+|.++--...
T Consensus 233 ------~~~~~-d~~~~~~~l~gY~~~~~L~~~----e~~~l~~~l~~p~~~~~~~~~y~~ 282 (313)
T TIGR02906 233 ------KNGVW-DLEKAKEIIEAYSSINPLSKE----EKEVLYIDLAFPHKFWKIGKQYYY 282 (313)
T ss_pred ------hccCC-CHHHHHHHHHHhhccCCCCHH----HHHHHHHHHhChHHHHHHHHHHHh
Confidence 00112 456778999999986543222 233456677888888887765543
No 20
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.; InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=99.17 E-value=6.8e-11 Score=93.31 Aligned_cols=66 Identities=29% Similarity=0.447 Sum_probs=47.3
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
..+.++||+|++++|||+.+ .++++.|||||.++++++++|+|..+.-+..+.
T Consensus 163 ~~~~~~~HgD~~~~Nil~~~-----------------------~~~~i~iID~e~a~~~~~~~Dla~~~~~~~~~~---- 215 (239)
T PF01636_consen 163 PLPPVLIHGDLHPGNILVDP-----------------------SDGRIGIIDFEDAGWGDPAYDLARLLRHFGEDQ---- 215 (239)
T ss_dssp CSCEEEE-SS-SGGGEEEES-----------------------STTEEEE--GTT-EEEETHHHHHHHHHHHTTHC----
T ss_pred CCCcEEEEeccccccceeee-----------------------ccceeEEEecccceECCHHHHHHHHHHHhcccC----
Confidence 57899999999999999993 235668999999999999999999994433111
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHH
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYL 128 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl 128 (174)
..+.+..|+++|.
T Consensus 216 ------------~~~~~~~~~~~~~ 228 (239)
T PF01636_consen 216 ------------DPEFRRAYLEAYG 228 (239)
T ss_dssp ------------HHHHHHHHHHHHT
T ss_pred ------------CHHHHHHHHHHhc
Confidence 3566777777777
No 21
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=99.17 E-value=9.4e-11 Score=95.53 Aligned_cols=84 Identities=18% Similarity=0.126 Sum_probs=60.7
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
..+.||||+|++++|||+.+ ++.+.|||||+|+++++++|||..+.....
T Consensus 160 ~~~~~l~HgD~~~~Nil~~~------------------------~~~~~iIDwe~a~~gdp~~Dla~~~~~~~~------ 209 (244)
T cd05150 160 EEDLVVTHGDACLPNIIVDP------------------------GKFSGFIDLGRLGVADRYQDLALAVRSLRE------ 209 (244)
T ss_pred cCceEEECCCCCCccEEEeC------------------------CcEEEEEEccccccccHHHHHHHHHHHhhh------
Confidence 35689999999999999986 244679999999999999999998754321
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHH
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHF 154 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~ 154 (174)
...+.+.+..|++.|-+.. .. .+++..|++...+
T Consensus 210 ---------~~~~~~~~~~f~~~Y~~~~----~~----~~~~~~~~~~~~~ 243 (244)
T cd05150 210 ---------NLGGEEYAARFLDRYGIDA----PD----PEKLAYYRLLDEF 243 (244)
T ss_pred ---------hcCChHHHHHHHHHcCCCC----CC----HHHHHHHHHHhhh
Confidence 1115677899999995431 11 2355666665543
No 22
>PRK12396 5-methylribose kinase; Reviewed
Probab=99.12 E-value=4.3e-10 Score=99.73 Aligned_cols=67 Identities=24% Similarity=0.418 Sum_probs=57.6
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
.|..|+..|+..+.. ...+++|+||++||||+++ +++++||.|+|-|||++||
T Consensus 210 ~Lk~ev~~Lk~~F~~--~~~aLlHGDlHtGSI~v~~-------------------------~~~kvIDpEFAfyGP~gFD 262 (409)
T PRK12396 210 ELRLEVAKLKFSFMT--NAQALIHGDLHTGSVFVKN-------------------------DSTKVIDPEFAFYGPMGYD 262 (409)
T ss_pred HHHHHHHHHHHHHHh--cchhhccCcCCCCCEEecC-------------------------CceEEEcccccccCCcHHH
Confidence 567788888877765 3479999999999999986 5799999999999999999
Q ss_pred HHHHHHHHhhhccC
Q psy15664 88 IANHFVESVYDYSY 101 (174)
Q Consensus 88 lan~f~E~~~dy~~ 101 (174)
||+++....+.|..
T Consensus 263 iG~~lanll~ay~~ 276 (409)
T PRK12396 263 IGNVMANLMFAWVN 276 (409)
T ss_pred HHHHHHHHHHHHhc
Confidence 99999988877744
No 23
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
Probab=99.12 E-value=4e-10 Score=90.23 Aligned_cols=73 Identities=19% Similarity=0.301 Sum_probs=53.0
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF 104 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~ 104 (174)
.+.|+||+|++++|||+..+..+ ....+.+|||+++++++|++||+.++.-++-
T Consensus 118 ~~~vl~HgD~~~~N~~~~~~~~~-------------------~~~~~~liDfq~~~~g~p~~Dl~~~l~~~~~------- 171 (196)
T smart00587 118 EFNVLNHGDLWANNIMFKYDDEG-------------------KPEDVALIDFQLSHYGSPAEDLHYFLLTSLS------- 171 (196)
T ss_pred CceEEeeCCCCccceeeccCCCC-------------------CccceEEEecccCCcCChHHHHHHHHHhCCC-------
Confidence 36799999999999999852211 1247999999999999999999999975330
Q ss_pred CcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664 105 PHYTVKRENYPSYSLRKSFVETYLSRM 131 (174)
Q Consensus 105 p~~~~~~~~~p~~~~~~~fl~~Yl~~~ 131 (174)
+ . -..+....+++.|.+++
T Consensus 172 ~-------~-~r~~~~~~ll~~Y~~~l 190 (196)
T smart00587 172 V-------E-IRREHFDELLKFYYETL 190 (196)
T ss_pred H-------H-HHHHHHHHHHHHHHHHH
Confidence 0 0 02344567777777654
No 24
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=99.09 E-value=1.2e-09 Score=92.46 Aligned_cols=74 Identities=23% Similarity=0.352 Sum_probs=57.2
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
..|.++||+|++++|||+.+ ++...|||||+++++++.+|||..+..|+.+-
T Consensus 184 ~~~~~l~HgD~~~~Nvl~~~------------------------~~~~~vIDfd~~~~~~~~~DLA~~~~~~~~~~---- 235 (307)
T TIGR00938 184 DLPRGVIHADLFPDNVLFDG------------------------DSVKGVIDFYFACTDARAYDLAITVNAWCFDA---- 235 (307)
T ss_pred cCCCccCCCCCCcCcEEEEC------------------------CceEEEeecccccCcchHHHHHHHHHHHHcCC----
Confidence 35789999999999999976 23357999999999999999999876666321
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhccCC
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQ 133 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~ 133 (174)
...+ +.+..+.|++.|-+..+-
T Consensus 236 -------~~~~-~~~~~~~~l~gY~~~~~L 257 (307)
T TIGR00938 236 -------DDHF-DADHAKALIKGYHQSRPL 257 (307)
T ss_pred -------CCCC-CHHHHHHHHHHHHhcCCC
Confidence 0112 467789999999876543
No 25
>TIGR01767 MTRK 5-methylthioribose kinase. This enzyme is involved in the methionine salvage pathway in certain bacteria.
Probab=99.09 E-value=7.4e-10 Score=97.16 Aligned_cols=67 Identities=33% Similarity=0.420 Sum_probs=53.6
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
.|..++..|+..+.. ...++||+||++||||+.+ .++.+||||+|.+|+++||
T Consensus 175 ~l~~~v~~Lk~~f~~--~~~~llHGDl~~gNi~~~~-------------------------~~~~~iD~e~~~~G~~~~D 227 (370)
T TIGR01767 175 SLKIEAAKLKHSFLA--SAETLLHGDLHSGSIFVSE-------------------------HETKVIDPEFAFYGPIGFD 227 (370)
T ss_pred HHHHHHHHHHHhhcc--CcceeeeccCCcccEEEcC-------------------------CCCEEEcCcccccCchHhh
Confidence 445556666555543 4468999999999999975 4688999999999999999
Q ss_pred HHHHHHHHhhhccC
Q psy15664 88 IANHFVESVYDYSY 101 (174)
Q Consensus 88 lan~f~E~~~dy~~ 101 (174)
||+.+.+....|..
T Consensus 228 lg~~ianL~l~~~~ 241 (370)
T TIGR01767 228 IGQFIANLFLNALS 241 (370)
T ss_pred HHHHHHHHHHHHhC
Confidence 99999998876643
No 26
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=99.08 E-value=7.7e-10 Score=93.87 Aligned_cols=101 Identities=17% Similarity=0.132 Sum_probs=75.2
Q ss_pred cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664 23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK 102 (174)
Q Consensus 23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~ 102 (174)
...+.++||+|+.++|+|+++ ++.+.+||||+++++++.+|||+++.-.+-.
T Consensus 192 ~~~~~~lcHgD~~~~Nvl~~~------------------------~~~~~iIDfd~~~~d~~~~DLa~~~~~~~~~---- 243 (309)
T TIGR02904 192 ESWRTVLVHGKLSLSHFLYDE------------------------TRGGYFINFEKASFASPLTDLAAFFRRSFGT---- 243 (309)
T ss_pred hhcceeeeCCCCcHHhEEEcC------------------------CCCEEEEEhhhcccCCcHHHHHHHHHHHHhh----
Confidence 446889999999999999975 3568999999999999999999877654311
Q ss_pred CCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcc
Q psy15664 103 HFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDD 165 (174)
Q Consensus 103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~ 165 (174)
.. ++.++.+.|+++|-+..+-.+++.+ -+....+..+-+|-+|--+...
T Consensus 244 ---------~~-~~~~~~~~~l~~Y~~~~pL~~~E~~----~l~~~L~fP~~f~~~~~~yy~~ 292 (309)
T TIGR02904 244 ---------YP-QPIDEMFEWFYTYEKTLPLTDEEIH----LLTSYLAYPGPFIRVIQNYTKQ 292 (309)
T ss_pred ---------CC-CChHHHHHHHHHHHhcCCCCHHHHH----HHHHHHhCCHHHHHHHHHHHhc
Confidence 11 3567789999999987644323332 3445677788888888766554
No 27
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=99.02 E-value=7.6e-10 Score=90.18 Aligned_cols=59 Identities=29% Similarity=0.379 Sum_probs=49.5
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCce-EEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDL-VVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
.+.++||+|++++|||+.+ +++ .|||||+|+.+++++|||...+. +
T Consensus 162 ~~~~l~HGD~~~~Nvlv~~-------------------------~~i~giIDw~~a~~gDp~~Dla~~~~~--~------ 208 (235)
T cd05155 162 GPPVWFHGDLAPGNLLVQD-------------------------GRLSAVIDFGCLGVGDPACDLAIAWTL--L------ 208 (235)
T ss_pred CCceEEeCCCCCCcEEEEC-------------------------CCEEEEEeCcccCcCChHHHHHHHHhc--C------
Confidence 5779999999999999975 344 59999999999999999976542 1
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHH
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYL 128 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl 128 (174)
+...+..|++.|.
T Consensus 209 ------------~~~~~~~~~~~y~ 221 (235)
T cd05155 209 ------------DEDSRAAFRAALG 221 (235)
T ss_pred ------------CHHHHHHHHHHcC
Confidence 4567899999998
No 28
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported
Probab=98.90 E-value=2e-08 Score=84.71 Aligned_cols=65 Identities=20% Similarity=0.242 Sum_probs=52.1
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCc-eEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNID-LVVIDFEYCSYNYRAFDIANHFVESVYDYSYK 102 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~ 102 (174)
..+.++||+|++++|||+++ +++ .-|||||.++.++|++|||-.+.-
T Consensus 182 ~~~~~lvHGD~~~~Nilv~~------------------------~~~~~gviDWe~a~iGDPa~Dla~~~~~-------- 229 (276)
T cd05152 182 PRHTVLVHGDLHPGHILIDE------------------------DARVTGLIDWTEAKVGDPARDFVLHYRI-------- 229 (276)
T ss_pred CCCCeeEeCCCCCCcEEEeC------------------------CCCEEEEECcHhcccCCHHHHHHHHHHh--------
Confidence 45679999999999999975 134 469999999999999999965431
Q ss_pred CCCcccccCCCCCCHHHHHHHHHHHHhccC
Q psy15664 103 HFPHYTVKRENYPSYSLRKSFVETYLSRMN 132 (174)
Q Consensus 103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~ 132 (174)
-..+.+..|+++|-....
T Consensus 230 ------------~~~~~~~~~~~~Y~~~~g 247 (276)
T cd05152 230 ------------FGEAGLERLIDAYEAAGG 247 (276)
T ss_pred ------------cChHHHHHHHHHHHHcCC
Confidence 146678999999997653
No 29
>PLN02756 S-methyl-5-thioribose kinase
Probab=98.84 E-value=2.7e-08 Score=88.71 Aligned_cols=65 Identities=26% Similarity=0.351 Sum_probs=54.8
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
.|..++..|+..+.... .+++|+||++|||++.+ ++..+||.|+|-|+|++||
T Consensus 213 ~L~~~v~~Lk~~f~~~~--~~L~HGDl~~g~i~~~~-------------------------~~~~~id~ef~~~g~~~~d 265 (418)
T PLN02756 213 ILKLEIAELKSMFCERA--QALVHGDLHTGSVMVTP-------------------------DSTQVIDPEFAFYGPMGFD 265 (418)
T ss_pred HHHHHHHHHHHHHHhcc--cceeecCCCCCcEEEcC-------------------------CCceEecchhhccCchHHh
Confidence 57778888877776543 68999999999999986 4689999999999999999
Q ss_pred HHHHHHHHhhhc
Q psy15664 88 IANHFVESVYDY 99 (174)
Q Consensus 88 lan~f~E~~~dy 99 (174)
||..+......|
T Consensus 266 ~g~~~~~~~~~~ 277 (418)
T PLN02756 266 IGAFLGNLILAY 277 (418)
T ss_pred HHHHHhhhHHHH
Confidence 999887766544
No 30
>PRK11768 serine/threonine protein kinase; Provisional
Probab=98.81 E-value=4e-08 Score=84.41 Aligned_cols=90 Identities=16% Similarity=0.215 Sum_probs=61.2
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
..+.++||+|++++|||+.+ .+.||||+.|+++++.+|||..+.-.
T Consensus 193 ~~~~~liHgD~h~~NvL~~d--------------------------~~~iIDFDd~~~g~~i~DLa~~l~~~-------- 238 (325)
T PRK11768 193 DVRLLRLHGDCHPGNILWRD--------------------------GPHFVDLDDARMGPAVQDLWMLLSGD-------- 238 (325)
T ss_pred CCCccceecCCCchhccccC--------------------------CcEEEeCCCCCCCCHHHHHHHHhccC--------
Confidence 45779999999999999942 46899999999999999999866320
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHH
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWA 157 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~ 157 (174)
... ..++...|++.|-+...-...+ -.++.-......+...-|.
T Consensus 239 --------~~~-~~~~~~~~l~GY~~~r~l~~~e-~~~l~~l~~lR~~~~~~W~ 282 (325)
T PRK11768 239 --------RAE-QLMQLETLLEGYEEFCEFDPRE-LALIEPLRALRLIHYSAWL 282 (325)
T ss_pred --------cch-hHHHHHHHHHHhhccCCCCHHH-HHHHHHHHHHHHHHHHHHH
Confidence 111 2567789999997654321111 2344445555555555553
No 31
>PF02958 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans.
Probab=98.81 E-value=2e-08 Score=84.03 Aligned_cols=74 Identities=26% Similarity=0.494 Sum_probs=54.7
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~ 103 (174)
..+.|+||+|++.+|||+.....+ ....+++|||..+.+++++.||+.++.-+.-
T Consensus 212 ~~~~vl~HGD~w~nNilf~~~~~g-------------------~~~~~~liDfQ~~~~g~p~~Dl~~fl~~s~~------ 266 (294)
T PF02958_consen 212 EPFNVLCHGDFWTNNILFKYDDDG-------------------KPIDVVLIDFQLARYGSPAIDLAYFLYTSLD------ 266 (294)
T ss_pred CCceEEEcCccCHHhEeEcccccc-------------------ccccceeeccccccCCCcHhHHHHHHHHCCC------
Confidence 457799999999999999873221 2357999999999999999999999975430
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRM 131 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~ 131 (174)
+. . ..+....+|+.|..++
T Consensus 267 -~~-------~-r~~~~~~ll~~Y~~~L 285 (294)
T PF02958_consen 267 -PE-------L-RREHEDELLRHYHESL 285 (294)
T ss_pred -HH-------H-HHHHHHHHHHHHHHHH
Confidence 00 0 2344567788887664
No 32
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=98.76 E-value=1.8e-07 Score=81.21 Aligned_cols=97 Identities=19% Similarity=0.233 Sum_probs=69.6
Q ss_pred eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCC-ceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCcc
Q psy15664 29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNI-DLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHY 107 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~~ 107 (174)
+||||++++||+++. ++ -..+|||+.|++++..||||..++-|..|
T Consensus 199 iIH~D~~~~NVl~d~------------------------~~~~~g~iDFdDa~~~~~i~DlAi~l~~~~~d--------- 245 (331)
T COG2334 199 IIHGDLHPDNVLFDD------------------------DTDVSGFIDFDDAGYGWFIYDLAIALNAWNGD--------- 245 (331)
T ss_pred eeecCCCccceeEcC------------------------CCCeeeEEEccccccchHHHHHHHHHHHhhcC---------
Confidence 999999999999987 23 37899999999999999999999876211
Q ss_pred cccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcccC
Q psy15664 108 TVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDDTS 167 (174)
Q Consensus 108 ~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~~s 167 (174)
... ...+...|+++|-+...-..++. ..+..+..+..+.-..|.++.....
T Consensus 246 ----~~~-~~~~~~a~l~GY~~v~pl~~~El----~~Lp~l~r~~a~~~~~~~~~~~~~~ 296 (331)
T COG2334 246 ----EAD-PRAAIAAFLEGYEEVRPLTAAEL----ELLPDLRRLRALRLWAWRLIRWLLP 296 (331)
T ss_pred ----CCC-cHHHHHHHHHHHHhcCCCCHHHH----HHHHHHHHHHHHHHHHHHhhhhhcC
Confidence 111 46778999999998754322223 3344455555566666777666554
No 33
>PLN02876 acyl-CoA dehydrogenase
Probab=98.72 E-value=5e-08 Score=93.29 Aligned_cols=103 Identities=17% Similarity=0.259 Sum_probs=67.4
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCc-eEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNID-LVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF 104 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~ 104 (174)
+.++||+|++++|||+... +.+ +-|||||+++.++|.+|||..+.-|..++.....
T Consensus 224 ~~~LvHGD~~~~Nvl~~~~-----------------------~~~v~aVLDWE~a~~GdPl~DLa~~~~~~~~~~~~~~~ 280 (822)
T PLN02876 224 GTGIVHGDFRIDNLVFHPT-----------------------EDRVIGILDWELSTLGNQMCDVAYSCLPYIVDINLDNQ 280 (822)
T ss_pred CcceEecCcccccEEEcCC-----------------------CCeEEEEEeeeccccCChHHHHHHHhhhccccccCCcc
Confidence 4689999999999999851 233 5799999999999999999888766544311111
Q ss_pred ---Cccccc--CCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHH
Q psy15664 105 ---PHYTVK--RENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALW 159 (174)
Q Consensus 105 ---p~~~~~--~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lW 159 (174)
.++... ...+|+ ++.++..|.+..... ..+ ..+..|..++.|-|++-
T Consensus 281 ~~~~~~~~~~~~~G~p~---~~e~~~~Y~~~~g~~-~~~----~~~~~~~~~~~~r~a~I 332 (822)
T PLN02876 281 QVGKGFEFTGIPEGIPS---LPEYLAEYCSASGKP-WPA----ANWKFYVAFSLFRGASI 332 (822)
T ss_pred ccccccccCcCCCCCCC---HHHHHHHHHHHhCCC-CCC----cccHHHHHHHHHHHHHH
Confidence 122221 235666 678999999875421 001 13445666666666543
No 34
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves
Probab=98.61 E-value=1.6e-07 Score=68.33 Aligned_cols=45 Identities=40% Similarity=0.718 Sum_probs=40.8
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHH
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 95 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~ 95 (174)
.+++|+|++++|||+.+ .+.+.+|||+.+.+.++++|+|..++-|
T Consensus 108 ~~i~H~Dl~~~Nil~~~------------------------~~~~~l~Df~~~~~~~~~~d~~~~~~~~ 152 (155)
T cd05120 108 LVLCHGDLHPGNILVDD------------------------GKILGIIDWEYAGYGPPAFDLAAALLFN 152 (155)
T ss_pred eEEEecCCCcceEEEEC------------------------CcEEEEEecccccCCChHHHHHHHHHHh
Confidence 58999999999999975 3679999999999999999999998754
No 35
>COG4857 Predicted kinase [General function prediction only]
Probab=98.51 E-value=3.3e-07 Score=78.62 Aligned_cols=61 Identities=36% Similarity=0.485 Sum_probs=51.8
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
+|.-|+..|+..+.... ..+||+||+.|.|++++ ...++||-|+|-|+|.+||
T Consensus 211 dlkvea~kLk~~F~~~a--etLiHGDLHsGSIfvte-------------------------~etkvIDPEFaFYGPmafD 263 (408)
T COG4857 211 DLKVEAQKLKHKFMAYA--ETLIHGDLHSGSIFVTE-------------------------KETKVIDPEFAFYGPMAFD 263 (408)
T ss_pred chhhhHHHHHHHHHHHh--HHHhccccccCcEEeec-------------------------CcceeeCccccccCcchhh
Confidence 56678888887776533 57999999999999987 6789999999999999999
Q ss_pred HHHHHHHH
Q psy15664 88 IANHFVES 95 (174)
Q Consensus 88 lan~f~E~ 95 (174)
||+.+...
T Consensus 264 iG~~iaNl 271 (408)
T COG4857 264 IGMLIANL 271 (408)
T ss_pred HHHHHHHH
Confidence 99988763
No 36
>PRK10593 hypothetical protein; Provisional
Probab=98.34 E-value=2.6e-06 Score=72.50 Aligned_cols=68 Identities=9% Similarity=0.186 Sum_probs=49.5
Q ss_pred hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccC
Q psy15664 22 KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY 101 (174)
Q Consensus 22 ~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~ 101 (174)
....+.++||+|+++||+|++.. ......+||..-+.+++|-+|||..+.
T Consensus 188 ~~~~~psLlHGDlw~gNvl~~~~----------------------~~~i~~liDPa~~~~g~rE~DLa~~~~-------- 237 (297)
T PRK10593 188 GFNDNCVLVHGNFTLRSMLKDPR----------------------SDQLLAMLNPGLMLWAPREYELFRLMD-------- 237 (297)
T ss_pred cCCCCCeeEeCCCCcccEEECCC----------------------CCceEEEECchHhCCCCHHHhHHHhhc--------
Confidence 33445699999999999999751 112278999988999999999986641
Q ss_pred CCCCcccccCCCCCCHHHHHHHHHHHHhccCCC
Q psy15664 102 KHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE 134 (174)
Q Consensus 102 ~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~ 134 (174)
..+ ...|+++|.+..+..
T Consensus 238 ----------~~f-----~~~f~~~Y~~~~pl~ 255 (297)
T PRK10593 238 ----------NGL-----AEQLLWRYLQKAPVA 255 (297)
T ss_pred ----------CCc-----cHHHHHHHHHhCCCC
Confidence 111 236888888877643
No 37
>PRK06148 hypothetical protein; Provisional
Probab=98.27 E-value=9.5e-06 Score=79.53 Aligned_cols=102 Identities=17% Similarity=0.136 Sum_probs=68.7
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceE-EEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLV-VIDFEYCSYNYRAFDIANHFVESVYDYSYK 102 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-lIDfEYa~~n~~~fDlan~f~E~~~dy~~~ 102 (174)
.-|..+||||++..|||++++. .+++. ||||+.++++++.+|||--+.-++.+
T Consensus 200 ~Lp~~vIHgDln~~NiLv~~~~----------------------~~~isGiIDFgDa~~~~~v~DLAialay~~~~---- 253 (1013)
T PRK06148 200 ALPAQVIHNDANDYNILVDADD----------------------GERISGLIDFGDAVHAPRICEVAIAAAYAILD---- 253 (1013)
T ss_pred cCCcceECCCCCcccEEEcCCC----------------------CcceEEEEECcccccccHHHHHHHHHHHHhcC----
Confidence 3467899999999999998621 12454 99999999999999999887544321
Q ss_pred CCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664 103 HFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFV 162 (174)
Q Consensus 103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWali 162 (174)
. ....+....|++.|-+...-.+.+++.| --+...+++.-+.|+.|-.-
T Consensus 254 ---------~-~~p~~~~~a~laGY~sv~pLt~~E~~~L-~~li~~R~~~s~~~~~~~~~ 302 (1013)
T PRK06148 254 ---------H-PDPIGAAAALVAGYHAVYPLQAQELDLL-FDLIRMRLAVSVTNSASRRE 302 (1013)
T ss_pred ---------C-CChHHHHHHHHHHHhhcCCCCHHHHHHH-HHHHHHHHHHHHHHHHHhhh
Confidence 0 0113456789999998765544455443 34455555555666555443
No 38
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]
Probab=98.25 E-value=1.7e-06 Score=74.97 Aligned_cols=57 Identities=21% Similarity=0.312 Sum_probs=46.9
Q ss_pred HHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHH
Q psy15664 12 EADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANH 91 (174)
Q Consensus 12 e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~ 91 (174)
-+.|++........+.|+.|+|+++||||+.+ .+.+-|||||-++.++|..||+.+
T Consensus 183 ~~~Wl~~~~p~~~~~~~lvHGD~~~gNlii~~------------------------~~~~gVlDwe~~~lGDP~~Dl~~~ 238 (321)
T COG3173 183 LIKWLEANRPPWAGPPVLVHGDYRPGNLIIDP------------------------GRPTGVLDWELATLGDPLEDLAII 238 (321)
T ss_pred HHHHHHhcCCCcCCCceeeeCCcccCCEEEeC------------------------CCeeEEEeccccccCCcHHHHHHH
Confidence 34455444444567899999999999999997 344999999999999999999999
Q ss_pred H
Q psy15664 92 F 92 (174)
Q Consensus 92 f 92 (174)
+
T Consensus 239 ~ 239 (321)
T COG3173 239 C 239 (321)
T ss_pred H
Confidence 7
No 39
>PRK14879 serine/threonine protein kinase; Provisional
Probab=98.08 E-value=2.8e-05 Score=61.36 Aligned_cols=70 Identities=21% Similarity=0.284 Sum_probs=49.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCcc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHY 107 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~~ 107 (174)
.++|+|++++|||+.. +.+.+|||+.+....+..|.+.-+......+. ...|.
T Consensus 115 ~i~H~Dl~p~Nil~~~-------------------------~~~~liDf~~a~~~~~~~~~~~~~~~~~~~~~-~~~~~- 167 (211)
T PRK14879 115 GIIHGDLTTSNMILSG-------------------------GKIYLIDFGLAEFSKDLEDRAVDLHVLLRSLE-STHPD- 167 (211)
T ss_pred CcccCCCCcccEEEEC-------------------------CCEEEEECCcccCCCcHHhhhccHHHHHHHhh-ccCcc-
Confidence 5899999999999973 57899999999999998888764433221110 00111
Q ss_pred cccCCCCCCHHHHHHHHHHHHhcc
Q psy15664 108 TVKRENYPSYSLRKSFVETYLSRM 131 (174)
Q Consensus 108 ~~~~~~~p~~~~~~~fl~~Yl~~~ 131 (174)
...+....|+..|....
T Consensus 168 -------~~~~~~~~f~~gY~~~~ 184 (211)
T PRK14879 168 -------WAEELFEAFLEGYREVM 184 (211)
T ss_pred -------hHHHHHHHHHHHHHHhh
Confidence 12466788999999765
No 40
>PF07914 DUF1679: Protein of unknown function (DUF1679); InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in zinc finger-C4 and HLH domain-containing kinases. In fact, one member of this family (Q9GUC1 from SWISSPROT) is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (IPR000536 from INTERPRO, IPR008946 from INTERPRO, and IPR001628 from INTERPRO).
Probab=98.08 E-value=2.8e-06 Score=75.79 Aligned_cols=55 Identities=22% Similarity=0.298 Sum_probs=44.6
Q ss_pred cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHh
Q psy15664 23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 96 (174)
Q Consensus 23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~ 96 (174)
.+.+.|+||+||+..|||...+..+ ...--.||||.-+..+.++.||+-.|+-++
T Consensus 264 lG~~~VL~HGDLw~~NiLw~k~~~g-------------------~~~l~AIIDwQ~vh~G~~~eDl~Rll~~~l 318 (414)
T PF07914_consen 264 LGIKPVLVHGDLWSSNILWDKDSDG-------------------KLKLKAIIDWQCVHRGSPAEDLARLLVSCL 318 (414)
T ss_pred cCCCcceecCCccHHheeeecCCch-------------------hHHHHHHHHHHHhhcCchHHHHHHHHHhcC
Confidence 4568899999999999999873221 112367999999999999999999998655
No 41
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=98.05 E-value=3.1e-05 Score=60.69 Aligned_cols=70 Identities=24% Similarity=0.300 Sum_probs=49.1
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPH 106 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~ 106 (174)
..++|+|++++|||+.+ +++.+|||+.+....+..|.+.-+........
T Consensus 109 ~gi~H~Dl~~~Nil~~~-------------------------~~~~liDfg~a~~~~~~~~~~~~~~~~~~~~~------ 157 (199)
T TIGR03724 109 AGIVHGDLTTSNIIVRD-------------------------DKLYLIDFGLGKYSDEIEDKAVDLHVLKRSLE------ 157 (199)
T ss_pred CCeecCCCCcceEEEEC-------------------------CcEEEEECCCCcCCCcHHhhhchHHHHHHHHh------
Confidence 35899999999999973 57999999999999998888764433221110
Q ss_pred ccccCCCC-CCHHHHHHHHHHHHhcc
Q psy15664 107 YTVKRENY-PSYSLRKSFVETYLSRM 131 (174)
Q Consensus 107 ~~~~~~~~-p~~~~~~~fl~~Yl~~~ 131 (174)
...+ ...+....|+..|.+..
T Consensus 158 ----~~~~~~~~~~~~~fl~~Y~~~~ 179 (199)
T TIGR03724 158 ----STHPDKAEELFEAFLEGYREEF 179 (199)
T ss_pred ----hhCchhHHHHHHHHHHHHHhhc
Confidence 0111 13456778999998753
No 42
>PRK06149 hypothetical protein; Provisional
Probab=98.05 E-value=5.2e-05 Score=74.09 Aligned_cols=102 Identities=14% Similarity=0.041 Sum_probs=64.9
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF 104 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~ 104 (174)
.|..+||||++..|||+..+..+ ...-.-||||..++++++.+|||-.+.-|+.+-
T Consensus 206 L~~g~IH~Dl~~~Nilv~~~~~~-------------------~~~v~giIDFgD~~~~~~i~DLAial~~~~~~~----- 261 (972)
T PRK06149 206 LPLQAVHLDITDDNVVGSRDADG-------------------RWQPDGVIDFGDLVRTWRVADLAVTCASLLHHA----- 261 (972)
T ss_pred CcccccCCCCCcccEEEcCCCCC-------------------CcceeEEEEcccchhhhHHHHHHHHHHHHhccc-----
Confidence 47789999999999999862110 002257999999999999999998887665311
Q ss_pred CcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664 105 PHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWS 160 (174)
Q Consensus 105 p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWa 160 (174)
. +.......|++.|-+...-.+.+++.|. -+...+.+.-+.|+.|-
T Consensus 262 -------~--~dp~~~~~~l~GY~svrpLt~~E~~~L~-~li~~R~~~~~~~~~~~ 307 (972)
T PRK06149 262 -------G--GDPFSILPAVRAYHAVRPLSEAELKALW-PLVVARAAVLVASSEQQ 307 (972)
T ss_pred -------C--CCHHHHHHHHHHHHhcCCCCHHHHHHHH-HHHHHHHHHHHHHHHHH
Confidence 0 1223457899999877654334444332 23333444444444443
No 43
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=98.02 E-value=1.9e-05 Score=63.52 Aligned_cols=65 Identities=26% Similarity=0.360 Sum_probs=47.7
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc-----chhhHHHHHHHHhhhccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY-----RAFDIANHFVESVYDYSY 101 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----~~fDlan~f~E~~~dy~~ 101 (174)
..++|+||+++|||+.... ++.++.|||||-+.... +.-||+-......
T Consensus 137 ~gi~H~Dl~~~NILv~~~~---------------------~~~~~~lIDld~~~~~~~~~~~~~~dL~~L~rs~~----- 190 (206)
T PF06293_consen 137 AGIYHGDLNPSNILVDPDD---------------------GQYRFYLIDLDRMRFRPSSRRWRAKDLARLLRSLL----- 190 (206)
T ss_pred CcCCCCCCCcccEEEeCCC---------------------CceeEEEEcchhceeCCCChHHHHHhHHHHHHhcc-----
Confidence 4699999999999998732 23579999999988877 4556665543211
Q ss_pred CCCCcccccCCCCCCHHHHHHHHHHH
Q psy15664 102 KHFPHYTVKRENYPSYSLRKSFVETY 127 (174)
Q Consensus 102 ~~~p~~~~~~~~~p~~~~~~~fl~~Y 127 (174)
... -++++++.|+++|
T Consensus 191 ---------~~~-~~~~d~~~fl~~Y 206 (206)
T PF06293_consen 191 ---------RSG-WSERDRQRFLRGY 206 (206)
T ss_pred ---------ccC-CCHHHHHHHHhhC
Confidence 112 2788999999988
No 44
>COG3178 Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only]
Probab=97.88 E-value=6.9e-05 Score=64.63 Aligned_cols=73 Identities=16% Similarity=0.269 Sum_probs=58.7
Q ss_pred cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664 23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK 102 (174)
Q Consensus 23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~ 102 (174)
...|.|+||+|.++-|||....-. +..++-+|||.-|.++|.+||+++.+....
T Consensus 196 ~~~~~vlvhRDfh~~NLmw~~~~~--------------------g~~rvGvlDFQDA~iGP~aYDvasL~~DAr------ 249 (351)
T COG3178 196 LAQPKVLVHRDFHSRNLMWTADRA--------------------GADRVGVLDFQDALIGPIAYDVASLLRDAR------ 249 (351)
T ss_pred hcCCceeeeccccCccceecCCcc--------------------CCCCCceeehhhhhcCcchhhHHHHHhhcc------
Confidence 357899999999999999987311 246899999999999999999999986422
Q ss_pred CCCcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664 103 HFPHYTVKRENYPSYSLRKSFVETYLSRM 131 (174)
Q Consensus 103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~ 131 (174)
..-++|....++..|+.+.
T Consensus 250 ----------vt~~pe~~~~~l~rY~~~r 268 (351)
T COG3178 250 ----------VTWSPERELALLDRYWAAR 268 (351)
T ss_pred ----------ccCCHHHHHHHHHHHHHhh
Confidence 1125778889999999764
No 45
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=97.65 E-value=0.00078 Score=56.86 Aligned_cols=72 Identities=18% Similarity=0.258 Sum_probs=49.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC------ccchhhHHHHHHHHhhhcc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY------NYRAFDIANHFVESVYDYS 100 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~------n~~~fDlan~f~E~~~dy~ 100 (174)
..++|+||.++|||+...+..+ .++..+.|||||-+.. ..+.-||+-.....+
T Consensus 157 ~Gi~HgDL~~~NiLl~~~~~~~-----------------~~~~~~~LIDl~r~~~~~~~~~~~r~~dL~~L~~s~~---- 215 (268)
T PRK15123 157 AGINHRDCYICHFLLHLPFPGR-----------------EEDLKLSVIDLHRAQIRARVPRRWRDKDLAGLYFSAM---- 215 (268)
T ss_pred CcCccCCCChhhEEEeccccCC-----------------CCCceEEEEECCcccccCCCChHHHHHHHHHHHHHhc----
Confidence 3599999999999997521110 0246799999998832 245578887754321
Q ss_pred CCCCCcccccCCCCCCHHHHHHHHHHHHhc
Q psy15664 101 YKHFPHYTVKRENYPSYSLRKSFVETYLSR 130 (174)
Q Consensus 101 ~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~ 130 (174)
+..-+..++..|+++|.+.
T Consensus 216 -----------~~~ls~~d~~~fl~~Y~~~ 234 (268)
T PRK15123 216 -----------DIGLTQRDILRFLRVYFGR 234 (268)
T ss_pred -----------ccCCCHHHHHHHHHHHhCC
Confidence 1112788999999999985
No 46
>PF04655 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic resistance kinase; InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties []. Aminoglycoside phosphotransferases achieve inactivation of these enzymes by phosphorylation, utilising ATP. Likewise, hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0006468 protein phosphorylation, 0019748 secondary metabolic process
Probab=97.63 E-value=0.00039 Score=58.36 Aligned_cols=110 Identities=20% Similarity=0.248 Sum_probs=68.6
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
.|..+...+.+.+.....+.|+.|+|||.+|||-.. ...-+.||-. .-.++|+||
T Consensus 141 ~l~~~a~~~~~~Ll~~~~~~~lLHGDLH~~NIL~~~------------------------~~~WlaIDPk-gl~Gdp~yd 195 (253)
T PF04655_consen 141 RLVDAAAALARELLASPGEEVLLHGDLHHGNILAAG------------------------RRGWLAIDPK-GLVGDPAYD 195 (253)
T ss_pred HHHHHHHHHHHHHhcCCCcceeeccccchHhhhccC------------------------CCCceEeCCc-ccccccccC
Confidence 344444445445545566778999999999999764 2568899987 445899999
Q ss_pred HHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664 88 IANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSF 161 (174)
Q Consensus 88 lan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWal 161 (174)
++++|+...-+. + .. ...+...+.+..-.....- +.+ ++..|..+--..-++|++
T Consensus 196 ~a~~l~n~~~~~-----~------~~-~~~~~i~~r~~~la~~~gl---d~~----R~~~W~~~~~vlsa~W~~ 250 (253)
T PF04655_consen 196 LAPLLRNPLDEL-----P------DA-DDPERIRRRAALLAEAAGL---DRE----RILAWAFARAVLSAAWAL 250 (253)
T ss_pred HHHHHhCccccc-----c------cc-ccHHHHHHHHHHHHHHHCc---CHH----HHHHHHHHHHHHHHHHHh
Confidence 999998533110 0 00 1223344445555555432 223 556677766666677764
No 47
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=97.58 E-value=0.00048 Score=55.89 Aligned_cols=97 Identities=26% Similarity=0.323 Sum_probs=61.6
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
++-.++..+-..+.+. .+||+||-+.||++.. +++.||||=.+-.+.-.=|
T Consensus 96 ~~~r~vG~~vg~lH~~----givHGDLTtsNiIl~~-------------------------~~i~~IDfGLg~~s~~~Ed 146 (204)
T COG3642 96 DLLREVGRLVGKLHKA----GIVHGDLTTSNIILSG-------------------------GRIYFIDFGLGEFSDEVED 146 (204)
T ss_pred HHHHHHHHHHHHHHhc----CeecCCCccceEEEeC-------------------------CcEEEEECCcccccccHHh
Confidence 3445555555555443 5999999999999986 5699999988887765444
Q ss_pred HHH--HHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHH
Q psy15664 88 IAN--HFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVK 146 (174)
Q Consensus 88 lan--~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~ 146 (174)
.|- |.-|-.... .....++....|++.|.+..... .+|.+.+++|+
T Consensus 147 ~aVDl~Vleral~s------------th~~~e~l~~~f~~gY~~~~~~~-~~Vl~~~~eIr 194 (204)
T COG3642 147 KAVDLHVLERALES------------THEKAEELFAAFLEGYREEFGEA-KEVLERLEEIR 194 (204)
T ss_pred hhchHHHHHHHHHh------------ccccHHHHHHHHHHHHHHHhccH-HHHHHHHHHHH
Confidence 443 222322222 22224566789999999887642 24444455544
No 48
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=97.55 E-value=0.00035 Score=63.83 Aligned_cols=69 Identities=25% Similarity=0.304 Sum_probs=50.1
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPH 106 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~ 106 (174)
..++|+|++|.|||+.+ +.++||||+.|...+...|+|..+........
T Consensus 447 ~giiHrDlkp~NILl~~-------------------------~~~~liDFGla~~~~~~~d~a~~l~~~~~~~~------ 495 (535)
T PRK09605 447 AGIVHGDLTTSNFIVRD-------------------------DRLYLIDFGLGKYSDLIEDKAVDLHVLKQSLE------ 495 (535)
T ss_pred CCCccCCCChHHEEEEC-------------------------CcEEEEeCcccccCCchHhhhhhHHHHHHHhc------
Confidence 35899999999999943 67999999999999999999886543321111
Q ss_pred ccccCCCCCCHHHHHHHHHHHHhc
Q psy15664 107 YTVKRENYPSYSLRKSFVETYLSR 130 (174)
Q Consensus 107 ~~~~~~~~p~~~~~~~fl~~Yl~~ 130 (174)
...+...+....|++.|-..
T Consensus 496 ----~~~~~~~~~~~~fl~gY~~~ 515 (535)
T PRK09605 496 ----STHYDFEELWEAFLEGYRET 515 (535)
T ss_pred ----CCCCCHHHHHHHHHHhhccC
Confidence 11112355678899999654
No 49
>TIGR02905 spore_yutH spore coat protein YutH. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria.
Probab=97.47 E-value=0.00076 Score=57.71 Aligned_cols=68 Identities=22% Similarity=0.271 Sum_probs=50.9
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF 104 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~ 104 (174)
...++||+|+...|+| .+ +.+.+|+||++ +.++..||++++.-.+.-
T Consensus 187 ~~~~lCH~d~~~hn~l-~~-------------------------~~~~~i~~d~~-~D~~~~DL~~firk~~~k------ 233 (313)
T TIGR02905 187 DSGTICHERFGETTWL-ER-------------------------GGLIKPPTEWV-YDHPARDLAEWIRERYMG------ 233 (313)
T ss_pred ccCccccCccCccccc-cC-------------------------CCeEecccccc-cccchhHHHHHHHHHHHH------
Confidence 4569999999999987 32 57889999954 999999999999874411
Q ss_pred CcccccCCCCC-CHHHHHHHHHHHHhccCC
Q psy15664 105 PHYTVKRENYP-SYSLRKSFVETYLSRMNQ 133 (174)
Q Consensus 105 p~~~~~~~~~p-~~~~~~~fl~~Yl~~~~~ 133 (174)
.++ +-+.-..+|++|=+..+-
T Consensus 234 --------~~~~~~~~~~~~l~~Y~~~~pL 255 (313)
T TIGR02905 234 --------EIRQNQRAIASFLQEYEQAAPL 255 (313)
T ss_pred --------hccccHHHHHHHHHHhhhcCCC
Confidence 011 234678888888877544
No 50
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=97.19 E-value=0.0024 Score=52.61 Aligned_cols=32 Identities=28% Similarity=0.374 Sum_probs=27.1
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
.++|+|++|+|||+.. ++.++||||+-+....
T Consensus 162 GI~HrDlkp~NILv~~------------------------~~~v~LIDfg~~~~~~ 193 (239)
T PRK01723 162 GVYHADLNAHNILLDP------------------------DGKFWLIDFDRGELRT 193 (239)
T ss_pred CCCCCCCCchhEEEcC------------------------CCCEEEEECCCcccCC
Confidence 5899999999999975 3579999999887654
No 51
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []. Ketosamine-3-kinases (KT3K), of which fructosamine-3-kinase (FN3K) is the best-known example, catalyse the phosphorylation of the ketosamine moiety of glycated proteins. The instability of a phosphorylated ketosamine leads to its degradation, and KT3K is thus thought to be involved in protein repair []. The function of the prokaryotic members of this group has not been established. However, several lines of evidence indicate that they may function as fructosamine-3-kinases (FN3K). First, they are similar to characterised FN3K from mouse and human. Second, the Escherichia coli members are found in close proximity on the genome to fructose-6-phosphate kinase (PfkB). Last, FN3K activity has been found in a Anacystis montana (Gloeocapsa montana Kutzing 1843) [], indicating such activity-directly demonstrated in eukaryotes-is nonetheless not confined to eukaryotes. This family includes eukaryotic fructosamine-3-kinase enzymes [] which may initiate a process leading to the deglycation of fructoselysine and of glycated proteins and in the phosphorylation of 1-deoxy-1-morpholinofructose, fructoselysine, fructoseglycine, fructose and glycated lysozyme. The family also includes bacterial members that have not been characterised but probably have a similar or identical function. For additional information please see [].; PDB: 3JR1_B 3F7W_A.
Probab=97.12 E-value=0.00087 Score=57.19 Aligned_cols=65 Identities=23% Similarity=0.474 Sum_probs=38.2
Q ss_pred cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664 23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK 102 (174)
Q Consensus 23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~ 102 (174)
...+-+++|+||++||++.+. +++.+|||== +-+++|-+|||.. + ++
T Consensus 184 ~~~~PsLlHGDLW~GN~~~~~------------------------~g~p~l~DPa-~yygh~E~DLam~--~-lf----- 230 (288)
T PF03881_consen 184 REPKPSLLHGDLWSGNVGFDA------------------------DGEPVLFDPA-CYYGHREVDLAMT--R-LF----- 230 (288)
T ss_dssp S----EEE-SS-SGGGEEEET------------------------TE-EEE-S----EEE-CHHHHHHH--C-CC-----
T ss_pred CCCCceeeEcCccccceeecC------------------------CCCceeeccc-cccCchHhhhhhh--h-hh-----
Confidence 344569999999999999987 3568999987 8899999999953 2 11
Q ss_pred CCCcccccCCCCCCHHHHHHHHHHHHhccCCC
Q psy15664 103 HFPHYTVKRENYPSYSLRKSFVETYLSRMNQE 134 (174)
Q Consensus 103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~ 134 (174)
..+| ..|.++|.+..+.+
T Consensus 231 ---------ggf~-----~~f~~~Y~~~~Pl~ 248 (288)
T PF03881_consen 231 ---------GGFP-----DEFYDAYQEHYPLS 248 (288)
T ss_dssp ---------STTH-----HHHHHHHHHHS---
T ss_pred ---------CCCC-----HHHHHHHHhcCCCC
Confidence 2221 35889998887654
No 52
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=97.02 E-value=0.00079 Score=53.08 Aligned_cols=32 Identities=31% Similarity=0.343 Sum_probs=27.1
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
..+.|+|++|+|||+++ +.++||||-.|..-.
T Consensus 137 ~givHrDlkP~NIll~~-------------------------~~~~liDFG~a~~~~ 168 (190)
T cd05145 137 AGLVHGDLSEYNILYHD-------------------------GKPYIIDVSQAVELD 168 (190)
T ss_pred CCEecCCCChhhEEEEC-------------------------CCEEEEEcccceecC
Confidence 47999999999999973 579999999887633
No 53
>PRK09902 hypothetical protein; Provisional
Probab=96.99 E-value=0.003 Score=51.98 Aligned_cols=77 Identities=12% Similarity=-0.005 Sum_probs=51.2
Q ss_pred HHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc-----c
Q psy15664 10 NTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY-----R 84 (174)
Q Consensus 10 ~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----~ 84 (174)
..++..+-+.+.. ..++|.|+.+.||++... ++-.+.|||||-+.... +
T Consensus 134 l~~va~~ia~LH~----~Gv~Hgdly~khIll~~~----------------------g~~~v~lIDlEk~r~~l~~~~~~ 187 (216)
T PRK09902 134 LKAVALAFKKMHS----VNRQHGCCYVRHIYVKTE----------------------GKAEAGFLDLEKSRRRLRRDKAI 187 (216)
T ss_pred HHHHHHHHHHHHH----CCCcCCCCCHhheeecCC----------------------CCeeEEEEEhhccchhhhhhhhh
Confidence 3344444444433 359999999999999751 12359999999877544 3
Q ss_pred hhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHh
Q psy15664 85 AFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLS 129 (174)
Q Consensus 85 ~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~ 129 (174)
.-||+-..... .. .++.+++.|+.+|+.
T Consensus 188 ~~Dl~~l~r~~----------------~~-~s~~~~~~~~~~y~~ 215 (216)
T PRK09902 188 NHDFRQLEKYL----------------EP-IPKADWEQVKAYYYA 215 (216)
T ss_pred HhHHHHHHHhc----------------cC-CCHHHHHHHHHHHhc
Confidence 45666554220 11 278999999999984
No 54
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=96.88 E-value=0.0011 Score=52.81 Aligned_cols=29 Identities=34% Similarity=0.531 Sum_probs=24.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..+.|+|++|+|||+++ +.++||||--|.
T Consensus 137 ~giiHrDlkP~NIli~~-------------------------~~v~LiDFG~a~ 165 (190)
T cd05147 137 CRLVHADLSEYNLLYHD-------------------------GKLYIIDVSQSV 165 (190)
T ss_pred CCcccCCCCHHHEEEEC-------------------------CcEEEEEccccc
Confidence 35999999999999974 579999998765
No 55
>PRK12274 serine/threonine protein kinase; Provisional
Probab=96.83 E-value=0.0038 Score=51.44 Aligned_cols=34 Identities=35% Similarity=0.454 Sum_probs=27.6
Q ss_pred eeeeeccC-CCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 27 VTFCHNDL-QEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 27 ~v~cHNDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
..++|+|| +++|||++. ++.++||||.-|....+
T Consensus 110 ~GIvHrDL~kp~NILv~~------------------------~g~i~LIDFG~A~~~~~ 144 (218)
T PRK12274 110 CGVAHNDLAKEANWLVQE------------------------DGSPAVIDFQLAVRGNP 144 (218)
T ss_pred CcCccCCCCCcceEEEcC------------------------CCCEEEEECCCceecCC
Confidence 35999999 799999975 35799999998875543
No 56
>COG3570 StrB Streptomycin 6-kinase [Defense mechanisms]
Probab=96.78 E-value=0.0085 Score=49.78 Aligned_cols=103 Identities=22% Similarity=0.216 Sum_probs=64.5
Q ss_pred HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHH
Q psy15664 11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIAN 90 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan 90 (174)
-|...+-+.+-..+..++.-|+||+-+|||-.+ ...-.+||-- .-.+.|+||-||
T Consensus 145 v~aA~~A~~LL~~p~di~pLHGDlHH~Nild~~------------------------~rGWlvIDPk-gl~Gdrg~D~AN 199 (274)
T COG3570 145 VEAARAAQTLLDTPRDIRPLHGDLHHGNILDGD------------------------RRGWLVIDPK-GLIGDRGFDYAN 199 (274)
T ss_pred hhHHHHHHHHhcCccccccCcccccccccccCC------------------------cCceEEEccc-cccCccccchHh
Confidence 345555555555667788999999999999654 2457788864 556899999999
Q ss_pred HHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHH
Q psy15664 91 HFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFF 155 (174)
Q Consensus 91 ~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~ 155 (174)
.||.-. .+ .--.+....+-+.-...+.. .+-.+|++-+..|..+|--.
T Consensus 200 lf~Np~-------~~-------~~~~pgRi~rqlai~a~a~~---l~p~rLlqw~~Ay~gLSAaW 247 (274)
T COG3570 200 LFCNPL-------DD-------LALAPGRIARQLAIFAHALG---LDPRRLLQWAIAYGGLSAAW 247 (274)
T ss_pred hhcCCc-------hh-------hhhChHHHHHHHHHHHHHhc---cCHHHHHHHHHHHhhhhHHh
Confidence 998522 10 01112222333333333332 23457778888887766543
No 57
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=96.71 E-value=0.0033 Score=52.24 Aligned_cols=44 Identities=25% Similarity=0.248 Sum_probs=31.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc--cchhhHHHHHHHHhh
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN--YRAFDIANHFVESVY 97 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n--~~~fDlan~f~E~~~ 97 (174)
..+.|+|++|+|||+++ .+ ++||||-.+... ..+.|+ ++.|-.|
T Consensus 154 ~gi~H~Dikp~Nili~~------------------------~g-i~liDfg~~~~~~e~~a~d~--~vler~y 199 (232)
T PRK10359 154 HGMVSGDPHKGNFIVSK------------------------NG-LRIIDLSGKRCTAQRKAKDR--IDLERHY 199 (232)
T ss_pred cCCccCCCChHHEEEeC------------------------CC-EEEEECCCcccccchhhHHH--HHHHhHh
Confidence 36999999999999976 23 999998654433 455555 5555444
No 58
>KOG0667|consensus
Probab=96.66 E-value=0.0021 Score=59.64 Aligned_cols=35 Identities=29% Similarity=0.510 Sum_probs=28.2
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
...+.|+||+|.|||+.+. ...+|+||||=-|++-
T Consensus 307 ~l~IIHcDLKPENILL~~~----------------------~r~~vKVIDFGSSc~~ 341 (586)
T KOG0667|consen 307 ELGIIHCDLKPENILLKDP----------------------KRSRIKVIDFGSSCFE 341 (586)
T ss_pred hCCeeeccCChhheeeccC----------------------CcCceeEEeccccccc
Confidence 4679999999999999873 2358999999766653
No 59
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date. Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=96.47 E-value=0.0055 Score=49.18 Aligned_cols=28 Identities=36% Similarity=0.495 Sum_probs=21.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
..+.|+||.+.|||+.+ +++++|||+=+
T Consensus 126 ~givHGDLs~~NIlv~~-------------------------~~~~iIDf~qa 153 (188)
T PF01163_consen 126 AGIVHGDLSEYNILVDD-------------------------GKVYIIDFGQA 153 (188)
T ss_dssp TTEEESS-STTSEEEET-------------------------TCEEE--GTTE
T ss_pred cCceecCCChhhEEeec-------------------------ceEEEEecCcc
Confidence 46999999999999987 48999999644
No 60
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system [].; GO: 0009244 lipopolysaccharide core region biosynthetic process
Probab=96.36 E-value=0.0058 Score=50.72 Aligned_cols=28 Identities=29% Similarity=0.364 Sum_probs=24.1
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
..+-|+|+||||+|+++ +.+++||+.-.
T Consensus 154 ~G~~HGD~hpgNFlv~~-------------------------~~i~iID~~~k 181 (229)
T PF06176_consen 154 HGFYHGDPHPGNFLVSN-------------------------NGIRIIDTQGK 181 (229)
T ss_pred cCCccCCCCcCcEEEEC-------------------------CcEEEEECccc
Confidence 46999999999999986 57999999644
No 61
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=96.25 E-value=0.0048 Score=47.57 Aligned_cols=32 Identities=28% Similarity=0.336 Sum_probs=25.7
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.....++|+|++|+||++.+ +.+.+|||.-+.
T Consensus 131 h~~~~ivH~Dl~p~Nili~~-------------------------~~~~liDfg~a~ 162 (187)
T cd05119 131 YREAGLVHGDLSEYNILVDD-------------------------GKVYIIDVPQAV 162 (187)
T ss_pred hhccCcCcCCCChhhEEEEC-------------------------CcEEEEECcccc
Confidence 33356899999999999973 578999997664
No 62
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=96.24 E-value=0.0059 Score=45.78 Aligned_cols=56 Identities=20% Similarity=0.188 Sum_probs=37.1
Q ss_pred hhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664 6 SKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA 85 (174)
Q Consensus 6 ~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~ 85 (174)
.+.+..-+..+-+.+...... .++|+|++++||++.. ..+.++|+||+++......
T Consensus 91 ~~~~~~~~~~l~~~l~~lh~~-~~~H~dl~~~ni~~~~-----------------------~~~~~~l~d~~~~~~~~~~ 146 (215)
T cd00180 91 EDEILRILLQILEGLEYLHSN-GIIHRDLKPENILLDS-----------------------DNGKVKLADFGLSKLLTSD 146 (215)
T ss_pred HHHHHHHHHHHHHHHHHHHhC-CeeccCCCHhhEEEeC-----------------------CCCcEEEecCCceEEccCC
Confidence 333333344444444433322 7999999999999985 1368999999988765544
No 63
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=96.19 E-value=0.0039 Score=50.50 Aligned_cols=27 Identities=30% Similarity=0.458 Sum_probs=23.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY 78 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY 78 (174)
..++|+||.+.|||+.+ ++++||||.-
T Consensus 144 ~glVHGDLs~~NIL~~~-------------------------~~v~iIDF~q 170 (197)
T cd05146 144 CNLVHADLSEYNMLWHD-------------------------GKVWFIDVSQ 170 (197)
T ss_pred CCeecCCCCHHHEEEEC-------------------------CcEEEEECCC
Confidence 46999999999999975 5799999963
No 64
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=96.11 E-value=0.0097 Score=50.04 Aligned_cols=35 Identities=20% Similarity=0.393 Sum_probs=26.5
Q ss_pred hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 22 KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 22 ~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
...+...++|+||+|.|||++. ++.++|+||-.+.
T Consensus 110 ~lH~~~~ivHrDikp~NIll~~------------------------~~~~kL~Dfg~~~ 144 (325)
T cd05594 110 YLHSEKNVVYRDLKLENLMLDK------------------------DGHIKITDFGLCK 144 (325)
T ss_pred HHHhcCCEEecCCCCCeEEECC------------------------CCCEEEecCCCCe
Confidence 3333346899999999999975 3578899987654
No 65
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=96.10 E-value=0.011 Score=46.46 Aligned_cols=30 Identities=30% Similarity=0.408 Sum_probs=25.6
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|++|+||+++. +..++||||-.|.
T Consensus 144 ~gi~H~Dl~p~Nill~~------------------------~~~~~liDfg~~~ 173 (198)
T cd05144 144 HGIIHGDLSEFNILVDD------------------------DEKIYIIDWPQMV 173 (198)
T ss_pred CCCCcCCCCcccEEEcC------------------------CCcEEEEECCccc
Confidence 46999999999999975 4689999998663
No 66
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=95.97 E-value=0.01 Score=47.51 Aligned_cols=43 Identities=21% Similarity=0.240 Sum_probs=31.2
Q ss_pred HHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 14 DWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 14 ~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..+-+.+....++..++|+|+++.||+++. .+.++|+||..+.
T Consensus 107 ~~l~~~l~~lH~~~~i~H~dl~~~ni~~~~------------------------~~~~~l~d~g~~~ 149 (265)
T cd06605 107 VAVLKGLTYLHEKHKIIHRDVKPSNILVNS------------------------RGQIKLCDFGVSG 149 (265)
T ss_pred HHHHHHHHHHcCCCCeecCCCCHHHEEECC------------------------CCCEEEeecccch
Confidence 333344444455567999999999999986 3679999997653
No 67
>smart00090 RIO RIO-like kinase.
Probab=95.80 E-value=0.016 Score=47.77 Aligned_cols=28 Identities=36% Similarity=0.464 Sum_probs=24.4
Q ss_pred eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
+||+|++|+|||+.+ +.++||||..|..
T Consensus 170 iiH~Dikp~NIli~~-------------------------~~i~LiDFg~a~~ 197 (237)
T smart00090 170 LVHGDLSEYNILVHD-------------------------GKVVIIDVSQSVE 197 (237)
T ss_pred EEeCCCChhhEEEEC-------------------------CCEEEEEChhhhc
Confidence 899999999999973 5799999987774
No 68
>KOG0583|consensus
Probab=95.62 E-value=0.014 Score=51.44 Aligned_cols=34 Identities=26% Similarity=0.342 Sum_probs=28.6
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
..++|+||++.|||++.+ +..++|+||.++...+
T Consensus 139 ~gi~HRDLK~ENilld~~-----------------------~~~~Kl~DFG~s~~~~ 172 (370)
T KOG0583|consen 139 RGIVHRDLKPENILLDGN-----------------------EGNLKLSDFGLSAISP 172 (370)
T ss_pred CCEeeCCCCHHHEEecCC-----------------------CCCEEEeccccccccC
Confidence 468999999999999872 2689999999988654
No 69
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain; InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=95.60 E-value=0.0093 Score=47.43 Aligned_cols=29 Identities=34% Similarity=0.518 Sum_probs=25.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. ++.++||||..+.
T Consensus 118 ~i~H~dikp~NIl~~~------------------------~~~~~l~Dfg~~~ 146 (260)
T PF00069_consen 118 GIVHRDIKPENILLDE------------------------NGEVKLIDFGSSV 146 (260)
T ss_dssp TEEESSBSGGGEEEST------------------------TSEEEESSGTTTE
T ss_pred cccccccccccccccc------------------------ccccccccccccc
Confidence 5899999999999985 4678999998875
No 70
>PRK10345 hypothetical protein; Provisional
Probab=95.55 E-value=0.021 Score=46.49 Aligned_cols=16 Identities=25% Similarity=0.380 Sum_probs=14.2
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 125 ~IvhrDlKp~NILl~~ 140 (210)
T PRK10345 125 RIVTMELKPQNILCQR 140 (210)
T ss_pred CEeecCCCHHHEEEec
Confidence 3779999999999975
No 71
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core
Probab=95.49 E-value=0.021 Score=44.61 Aligned_cols=33 Identities=24% Similarity=0.365 Sum_probs=26.1
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
..++|+|+++.||++++ ++.++|+||..+....
T Consensus 117 ~~i~h~dl~p~ni~i~~------------------------~~~~~l~d~~~~~~~~ 149 (253)
T cd05122 117 NGIIHRDIKAANILLTS------------------------DGEVKLIDFGLSAQLS 149 (253)
T ss_pred CCEecCCCCHHHEEEcc------------------------CCeEEEeecccccccc
Confidence 45899999999999986 3568888887765443
No 72
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=95.47 E-value=0.02 Score=45.97 Aligned_cols=16 Identities=38% Similarity=0.640 Sum_probs=14.8
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 123 ~i~H~dl~p~Nil~~~ 138 (261)
T cd05068 123 NYIHRDLAARNVLVGE 138 (261)
T ss_pred CeeeccCCcceEEEcC
Confidence 5899999999999986
No 73
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=95.43 E-value=0.016 Score=47.25 Aligned_cols=29 Identities=28% Similarity=0.409 Sum_probs=23.5
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|++|.|||++. .+.++|+||..+.
T Consensus 128 ~ivH~dikp~Nili~~------------------------~~~~kl~dfg~~~ 156 (288)
T cd07863 128 CIVHRDLKPENILVTS------------------------GGQVKLADFGLAR 156 (288)
T ss_pred CeecCCCCHHHEEECC------------------------CCCEEECccCccc
Confidence 4899999999999975 3568888887654
No 74
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.41 E-value=0.023 Score=48.01 Aligned_cols=17 Identities=29% Similarity=0.462 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
-.++|+||++.|||+..
T Consensus 123 ~~ivH~dlkp~Nil~~~ 139 (331)
T cd06649 123 HQIMHRDVKPSNILVNS 139 (331)
T ss_pred CCEEcCCCChhhEEEcC
Confidence 35899999999999976
No 75
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=95.37 E-value=0.021 Score=46.54 Aligned_cols=31 Identities=23% Similarity=0.337 Sum_probs=24.4
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
...++|+||++.||+++. ++.++++||..+.
T Consensus 121 ~~~i~H~dl~p~nil~~~------------------------~~~~~l~dfg~~~ 151 (286)
T cd06622 121 EHNIIHRDVKPTNVLVNG------------------------NGQVKLCDFGVSG 151 (286)
T ss_pred cCCEeeCCCCHHHEEECC------------------------CCCEEEeecCCcc
Confidence 346999999999999976 3568888887553
No 76
>KOG0984|consensus
Probab=95.34 E-value=0.013 Score=48.76 Aligned_cols=43 Identities=23% Similarity=0.342 Sum_probs=34.2
Q ss_pred HHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 15 WLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 15 ~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.+-+.+...++++-+.|+|++|+|||++. ++++++-||--||+
T Consensus 156 Svv~al~~L~~kL~vIHRDvKPsNiLIn~------------------------~GqVKiCDFGIsG~ 198 (282)
T KOG0984|consen 156 SVVHALEFLHSKLSVIHRDVKPSNILINY------------------------DGQVKICDFGISGY 198 (282)
T ss_pred HHHHHHHHHHHHhhhhhccCCcceEEEcc------------------------CCcEEEccccccee
Confidence 34444445566788999999999999986 68899999988875
No 77
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=95.34 E-value=0.026 Score=44.94 Aligned_cols=29 Identities=21% Similarity=0.267 Sum_probs=23.5
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. ...++|+||..+.
T Consensus 122 ~i~H~di~p~nil~~~------------------------~~~~~l~df~~~~ 150 (257)
T cd08223 122 HILHRDLKTQNVFLTR------------------------TNIIKVGDLGIAR 150 (257)
T ss_pred CeeccCCCchhEEEec------------------------CCcEEEecccceE
Confidence 5899999999999975 3568888887664
No 78
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=95.34 E-value=0.028 Score=45.28 Aligned_cols=36 Identities=22% Similarity=0.377 Sum_probs=27.1
Q ss_pred hhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 21 LKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 21 ~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
........++|+|+++.||++.. +..++++||..+.
T Consensus 127 ~~lh~~~~i~H~dl~~~nil~~~------------------------~~~~~l~dfg~~~ 162 (269)
T cd08528 127 RYLHKEKRIVHRDLTPNNIMLGE------------------------DDKVTITDFGLAK 162 (269)
T ss_pred HHhccCCceeecCCCHHHEEECC------------------------CCcEEEeccccee
Confidence 33333346899999999999975 3578888888765
No 79
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=95.33 E-value=0.017 Score=48.57 Aligned_cols=30 Identities=30% Similarity=0.543 Sum_probs=24.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||++.|||+.. ++.++|+||..+.
T Consensus 115 ~givH~Dlkp~NIll~~------------------------~~~~kL~DfG~~~ 144 (325)
T cd05604 115 INIVYRDLKPENILLDS------------------------QGHVVLTDFGLCK 144 (325)
T ss_pred CCeeecCCCHHHeEECC------------------------CCCEEEeecCCcc
Confidence 35899999999999976 3578999998765
No 80
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=95.31 E-value=0.081 Score=44.75 Aligned_cols=63 Identities=21% Similarity=0.304 Sum_probs=47.8
Q ss_pred ccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 3 KILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 3 ~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
.+++-++..=+..+.+.+......-.+.|+||+.||.++.. +..+++|- =|-++
T Consensus 163 g~~f~did~~~~~v~elL~~hqpqPsLlHGDLW~gN~a~~~-------------------------~GPv~fDP-A~y~G 216 (286)
T COG3001 163 GLTFGDIDAIVEKIQELLADHQPQPSLLHGDLWSGNCAFGK-------------------------DGPVIFDP-ACYWG 216 (286)
T ss_pred CCCccCHHHHHHHHHHHHhcCCCCcceeecccccccccccC-------------------------CCCeeecc-ccccC
Confidence 34555665556667777777777778999999999999876 23678886 36679
Q ss_pred cchhhHHHH
Q psy15664 83 YRAFDIANH 91 (174)
Q Consensus 83 ~~~fDlan~ 91 (174)
+|-+|||..
T Consensus 217 DrE~Dlam~ 225 (286)
T COG3001 217 DRECDLAML 225 (286)
T ss_pred Ccccceehh
Confidence 999999853
No 81
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the
Probab=95.26 E-value=0.017 Score=48.67 Aligned_cols=31 Identities=29% Similarity=0.569 Sum_probs=26.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+||++.|||++. ++.++|+||..+..
T Consensus 120 ~giiH~Dlkp~NIll~~------------------------~~~~kL~Dfg~~~~ 150 (350)
T cd05573 120 LGFIHRDIKPDNILIDA------------------------DGHIKLADFGLCKK 150 (350)
T ss_pred CCeeccCCCHHHeEECC------------------------CCCEEeecCCCCcc
Confidence 46999999999999976 46799999987753
No 82
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=95.25 E-value=0.03 Score=44.35 Aligned_cols=30 Identities=33% Similarity=0.462 Sum_probs=24.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+|++++||+++. .+.++++||.++..
T Consensus 123 ~~~h~dl~~~nil~~~------------------------~~~~~l~dfg~~~~ 152 (258)
T smart00219 123 NFIHRDLAARNCLVGE------------------------NLVVKISDFGLSRD 152 (258)
T ss_pred CeeecccccceEEEcc------------------------CCeEEEcccCCcee
Confidence 5799999999999986 35688889887753
No 83
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They
Probab=95.23 E-value=0.023 Score=44.84 Aligned_cols=30 Identities=23% Similarity=0.281 Sum_probs=25.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+|+++.||++.+ .+.++|+||..+..
T Consensus 123 ~~~H~dl~~~nil~~~------------------------~~~~~l~d~~~~~~ 152 (258)
T cd08215 123 KILHRDIKPQNIFLTS------------------------NGLVKLGDFGISKV 152 (258)
T ss_pred CEecccCChHHeEEcC------------------------CCcEEECCccceee
Confidence 6899999999999986 36788889876654
No 84
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=95.20 E-value=0.019 Score=48.10 Aligned_cols=30 Identities=30% Similarity=0.516 Sum_probs=23.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||++.|||++. ++.++|+||..+.
T Consensus 115 ~~ivH~Dlkp~NIll~~------------------------~~~~kl~Dfg~~~ 144 (321)
T cd05603 115 LNIIYRDLKPENILLDS------------------------QGHVVLTDFGLCK 144 (321)
T ss_pred CCeEeccCCHHHeEECC------------------------CCCEEEccCCCCc
Confidence 35899999999999975 3568888887654
No 85
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=95.18 E-value=0.02 Score=48.12 Aligned_cols=30 Identities=23% Similarity=0.317 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+||++.|||+.. .+.++|+||..+..
T Consensus 116 ~ivHrDlkp~Nili~~------------------------~~~~kl~Dfg~a~~ 145 (330)
T cd05586 116 DIVYRDLKPENILLDA------------------------TGHIALCDFGLSKA 145 (330)
T ss_pred CeEeccCCHHHeEECC------------------------CCCEEEecCCcCcC
Confidence 4899999999999976 35688999887654
No 86
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=95.16 E-value=0.02 Score=48.05 Aligned_cols=16 Identities=25% Similarity=0.316 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||+..
T Consensus 125 ~ivHrDlkp~Nili~~ 140 (332)
T cd05614 125 GIVYRDIKLENILLDS 140 (332)
T ss_pred CcEecCCCHHHeEECC
Confidence 5899999999999976
No 87
>KOG0658|consensus
Probab=95.16 E-value=0.027 Score=49.51 Aligned_cols=17 Identities=29% Similarity=0.626 Sum_probs=15.8
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+||+|++|-|||++.
T Consensus 144 ~~IcHRDIKPqNlLvD~ 160 (364)
T KOG0658|consen 144 HGICHRDIKPQNLLVDP 160 (364)
T ss_pred cCcccCCCChheEEEcC
Confidence 57999999999999987
No 88
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=95.11 E-value=0.032 Score=44.88 Aligned_cols=16 Identities=38% Similarity=0.706 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 122 ~i~H~dl~~~Nill~~ 137 (260)
T cd05069 122 NYIHRDLRAANILVGD 137 (260)
T ss_pred CEeecccCcceEEEcC
Confidence 4899999999999976
No 89
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=95.11 E-value=0.015 Score=52.26 Aligned_cols=34 Identities=26% Similarity=0.422 Sum_probs=27.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
..++|+|++||||++.+ ++++++|||-.++.-++
T Consensus 276 ~g~~H~D~hPgNilv~~------------------------~g~i~liDfG~~~~l~~ 309 (437)
T TIGR01982 276 DGFFHADLHPGNIFVLK------------------------DGKIIALDFGIVGRLSE 309 (437)
T ss_pred CCceeCCCCcccEEECC------------------------CCcEEEEeCCCeeECCH
Confidence 35899999999999975 46899999988765543
No 90
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.10 E-value=0.031 Score=47.33 Aligned_cols=29 Identities=24% Similarity=0.417 Sum_probs=23.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. .+.++|+||..+.
T Consensus 124 ~ivH~dlkp~Nili~~------------------------~~~~kL~Dfg~~~ 152 (333)
T cd06650 124 KIMHRDVKPSNILVNS------------------------RGEIKLCDFGVSG 152 (333)
T ss_pred CEEecCCChhhEEEcC------------------------CCCEEEeeCCcch
Confidence 4899999999999975 3568888886553
No 91
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=95.10 E-value=0.03 Score=45.34 Aligned_cols=23 Identities=22% Similarity=0.400 Sum_probs=17.4
Q ss_pred hhcCCCeeeeeccCCCCCeeecC
Q psy15664 21 LKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 21 ~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
........++|+|+++.||+++.
T Consensus 117 ~~lH~~~~i~h~dlkp~nil~~~ 139 (283)
T cd06617 117 EYLHSKLSVIHRDVKPSNVLINR 139 (283)
T ss_pred HHHhhcCCeecCCCCHHHEEECC
Confidence 33334446899999999999975
No 92
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=95.06 E-value=0.032 Score=44.06 Aligned_cols=17 Identities=41% Similarity=0.538 Sum_probs=15.3
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 124 ~~i~H~di~p~nili~~ 140 (262)
T cd00192 124 KKFVHRDLAARNCLVGE 140 (262)
T ss_pred CCcccCccCcceEEECC
Confidence 45899999999999986
No 93
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=95.02 E-value=0.031 Score=44.33 Aligned_cols=32 Identities=28% Similarity=0.363 Sum_probs=26.5
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
...++|+|+++.||++.+ .+.++|+||..+..
T Consensus 128 ~~~i~h~dl~p~nili~~------------------------~~~~kl~d~g~~~~ 159 (265)
T cd08217 128 GNTVLHRDLKPANIFLDA------------------------NNNVKLGDFGLAKI 159 (265)
T ss_pred cCcceecCCCHHHEEEec------------------------CCCEEEeccccccc
Confidence 567899999999999986 36788888887664
No 94
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=95.01 E-value=0.033 Score=44.56 Aligned_cols=30 Identities=33% Similarity=0.423 Sum_probs=24.3
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|++|.||+++. ++.++|+||.++.
T Consensus 121 ~~i~H~dlkp~nil~~~------------------------~~~~kl~dfg~~~ 150 (256)
T cd05082 121 NNFVHRDLAARNVLVSE------------------------DNVAKVSDFGLTK 150 (256)
T ss_pred CCEeccccchheEEEcC------------------------CCcEEecCCccce
Confidence 35899999999999976 3568888887654
No 95
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=94.98 E-value=0.025 Score=48.33 Aligned_cols=30 Identities=27% Similarity=0.584 Sum_probs=25.3
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||+|.|||++. ++.++|+||..|.
T Consensus 120 ~givHrDLkp~NIli~~------------------------~~~vkL~DfG~~~ 149 (360)
T cd05627 120 LGFIHRDIKPDNLLLDA------------------------KGHVKLSDFGLCT 149 (360)
T ss_pred CCeEccCCCHHHEEECC------------------------CCCEEEeeccCCc
Confidence 35899999999999975 4679999998764
No 96
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=94.98 E-value=0.027 Score=45.91 Aligned_cols=19 Identities=26% Similarity=0.485 Sum_probs=15.8
Q ss_pred CCeeeeeccCCCCCeeecC
Q psy15664 25 SPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~ 43 (174)
+...++|+|+++.||++..
T Consensus 125 ~~~~i~H~dlkp~Nil~~~ 143 (288)
T cd06616 125 EELKIIHRDVKPSNILLDR 143 (288)
T ss_pred hcCCeeccCCCHHHEEEcc
Confidence 3346899999999999975
No 97
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=94.94 E-value=0.031 Score=47.82 Aligned_cols=30 Identities=27% Similarity=0.586 Sum_probs=25.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||++.|||++. .+.++|+||..|.
T Consensus 120 ~givHrDlKp~NILi~~------------------------~~~vkL~DFGla~ 149 (363)
T cd05628 120 LGFIHRDIKPDNLLLDS------------------------KGHVKLSDFGLCT 149 (363)
T ss_pred CCeEecCCCHHHeEECC------------------------CCCEEEeeccCcc
Confidence 35899999999999975 3679999998775
No 98
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=94.91 E-value=0.034 Score=44.44 Aligned_cols=31 Identities=32% Similarity=0.344 Sum_probs=24.8
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+|+++.||+++. ++.++|+||..+..
T Consensus 119 ~~~~H~dl~p~nili~~------------------------~~~~kl~Dfg~~~~ 149 (254)
T cd05083 119 KKLVHRDLAARNILVSE------------------------DGVAKVSDFGLARV 149 (254)
T ss_pred CCeeccccCcceEEEcC------------------------CCcEEECCCcccee
Confidence 35799999999999975 35688888876654
No 99
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=94.89 E-value=0.034 Score=45.16 Aligned_cols=16 Identities=31% Similarity=0.590 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+.+
T Consensus 129 ~iiH~dlkp~Nil~~~ 144 (279)
T cd05109 129 RLVHRDLAARNVLVKS 144 (279)
T ss_pred CeeccccccceEEEcC
Confidence 4899999999999975
No 100
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=94.87 E-value=0.033 Score=46.36 Aligned_cols=18 Identities=28% Similarity=0.427 Sum_probs=15.5
Q ss_pred CeeeeeccCCCCCeeecC
Q psy15664 26 PVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~ 43 (174)
...++|+|+++.|||+..
T Consensus 118 ~~~i~H~dl~p~nil~~~ 135 (308)
T cd06615 118 KHKIMHRDVKPSNILVNS 135 (308)
T ss_pred hCCEEECCCChHHEEEec
Confidence 345899999999999975
No 101
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found
Probab=94.78 E-value=0.037 Score=47.93 Aligned_cols=30 Identities=27% Similarity=0.512 Sum_probs=24.4
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||+|.|||++. .+.++|+||..|.
T Consensus 161 ~~IvHrDLKp~NILl~~------------------------~~~~kL~DFG~a~ 190 (370)
T cd05621 161 MGLIHRDVKPDNMLLDK------------------------HGHLKLADFGTCM 190 (370)
T ss_pred CCeEecCCCHHHEEECC------------------------CCCEEEEecccce
Confidence 35899999999999975 3678889987653
No 102
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=94.78 E-value=0.041 Score=44.29 Aligned_cols=17 Identities=41% Similarity=0.524 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++.+
T Consensus 123 ~~i~H~dlkp~nil~~~ 139 (263)
T cd05052 123 KNFIHRDLAARNCLVGE 139 (263)
T ss_pred CCEeecccCcceEEEcC
Confidence 35899999999999975
No 103
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=94.77 E-value=0.033 Score=46.74 Aligned_cols=30 Identities=20% Similarity=0.434 Sum_probs=24.6
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||++.|||++. .+.++|+||..+.
T Consensus 121 ~~i~H~Dlkp~NIll~~------------------------~~~~kL~Dfg~a~ 150 (330)
T cd05601 121 MGYVHRDIKPENVLIDR------------------------TGHIKLADFGSAA 150 (330)
T ss_pred CCeEcccCchHheEECC------------------------CCCEEeccCCCCe
Confidence 35899999999999975 3678899987663
No 104
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=94.76 E-value=0.036 Score=46.58 Aligned_cols=29 Identities=21% Similarity=0.453 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. ++.++|+||-.+.
T Consensus 115 ~ivHrDlkp~NIll~~------------------------~~~~kl~DfG~a~ 143 (323)
T cd05571 115 DVVYRDLKLENLMLDK------------------------DGHIKITDFGLCK 143 (323)
T ss_pred CeEeCCCCHHHEEECC------------------------CCCEEEeeCCCCc
Confidence 5899999999999975 3567888887654
No 105
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=94.76 E-value=0.043 Score=45.81 Aligned_cols=30 Identities=27% Similarity=0.423 Sum_probs=24.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+||+|.|||+.. .+.++|+||..+..
T Consensus 113 ~i~HrDlkp~Nili~~------------------------~~~~kl~Dfg~~~~ 142 (312)
T cd05585 113 NVIYRDLKPENILLDY------------------------QGHIALCDFGLCKL 142 (312)
T ss_pred CeEeCCCCHHHeEECC------------------------CCcEEEEECccccc
Confidence 4899999999999975 35688888876653
No 106
>PHA03212 serine/threonine kinase US3; Provisional
Probab=94.73 E-value=0.038 Score=48.42 Aligned_cols=28 Identities=25% Similarity=0.377 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.+.|+||+|.|||+.. .+.++|+||-.|
T Consensus 202 ~IvHrDiKP~NIll~~------------------------~~~vkL~DFG~a 229 (391)
T PHA03212 202 RIIHRDIKAENIFINH------------------------PGDVCLGDFGAA 229 (391)
T ss_pred CcccCCCChHhEEEcC------------------------CCCEEEEeCCcc
Confidence 5899999999999975 356888898765
No 107
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=94.72 E-value=0.03 Score=47.21 Aligned_cols=16 Identities=25% Similarity=0.314 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||++.
T Consensus 116 ~ivHrDlkp~Nili~~ 131 (327)
T cd05617 116 GIIYRDLKLDNVLLDA 131 (327)
T ss_pred CeeccCCCHHHEEEeC
Confidence 5899999999999976
No 108
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=94.72 E-value=0.032 Score=44.77 Aligned_cols=29 Identities=28% Similarity=0.515 Sum_probs=23.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.+ ...+.|+||..+.
T Consensus 122 ~i~H~di~p~Nili~~------------------------~~~~~l~dfg~~~ 150 (260)
T cd05070 122 NYIHRDLRSANILVGD------------------------GLVCKIADFGLAR 150 (260)
T ss_pred CcccCCCccceEEEeC------------------------CceEEeCCceeee
Confidence 4899999999999986 3567788887764
No 109
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=94.67 E-value=0.03 Score=47.19 Aligned_cols=16 Identities=13% Similarity=0.291 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||++.
T Consensus 115 ~ivH~Dlkp~NIll~~ 130 (323)
T cd05595 115 DVVYRDIKLENLMLDK 130 (323)
T ss_pred CeEecCCCHHHEEEcC
Confidence 5899999999999976
No 110
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk
Probab=94.66 E-value=0.04 Score=44.03 Aligned_cols=32 Identities=31% Similarity=0.440 Sum_probs=25.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
..++|+|+++.||+++. ++.++++||.++...
T Consensus 121 ~~i~H~di~p~Nili~~------------------------~~~~~l~d~g~~~~~ 152 (256)
T cd05039 121 KNFVHRDLAARNVLVSE------------------------DLVAKVSDFGLAKEA 152 (256)
T ss_pred CCccchhcccceEEEeC------------------------CCCEEEccccccccc
Confidence 35899999999999975 356788888766543
No 111
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=94.60 E-value=0.034 Score=46.70 Aligned_cols=16 Identities=19% Similarity=0.293 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||++.
T Consensus 121 ~ivHrDlkp~Nill~~ 136 (323)
T cd05616 121 GIIYRDLKLDNVMLDS 136 (323)
T ss_pred CEEecCCCHHHeEECC
Confidence 5899999999999976
No 112
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation,
Probab=94.58 E-value=0.036 Score=45.29 Aligned_cols=30 Identities=27% Similarity=0.392 Sum_probs=23.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||+++. ++.++|+||.++.
T Consensus 151 ~~ivH~dlkp~Nil~~~------------------------~~~~kL~Dfg~~~ 180 (293)
T cd05053 151 KKCIHRDLAARNVLVTE------------------------DHVMKIADFGLAR 180 (293)
T ss_pred CCccccccceeeEEEcC------------------------CCeEEeCcccccc
Confidence 35899999999999975 3567888887654
No 113
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=94.55 E-value=0.033 Score=46.10 Aligned_cols=16 Identities=31% Similarity=0.521 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 123 ~ivH~dlkp~Nill~~ 138 (303)
T cd07869 123 YILHRDLKPQNLLISD 138 (303)
T ss_pred CeecCCCCHHHEEECC
Confidence 4899999999999975
No 114
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding
Probab=94.54 E-value=0.031 Score=46.29 Aligned_cols=29 Identities=28% Similarity=0.592 Sum_probs=23.5
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. .+.++++||..+.
T Consensus 135 ~i~H~dL~p~Nili~~------------------------~~~~~l~Dfg~~~ 163 (297)
T cd06656 135 QVIHRDIKSDNILLGM------------------------DGSVKLTDFGFCA 163 (297)
T ss_pred CcccCCCCHHHEEECC------------------------CCCEEECcCccce
Confidence 5899999999999975 3568888887653
No 115
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=94.54 E-value=0.042 Score=43.72 Aligned_cols=26 Identities=23% Similarity=0.350 Sum_probs=19.1
Q ss_pred HHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664 18 KHLLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 18 ~~l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
+.+........++|+|+++.||++..
T Consensus 110 ~~l~~lh~~~~~~H~~l~~~ni~~~~ 135 (264)
T cd06623 110 KGLDYLHTKRHIIHRDIKPSNLLINS 135 (264)
T ss_pred HHHHHHhccCCCccCCCCHHHEEECC
Confidence 33444444367899999999999976
No 116
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=94.53 E-value=0.053 Score=45.80 Aligned_cols=29 Identities=24% Similarity=0.395 Sum_probs=24.1
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. ++.++|+||..+.
T Consensus 138 ~ivH~dlkp~NIll~~------------------------~~~~kl~Dfg~~~ 166 (329)
T PTZ00263 138 DIIYRDLKPENLLLDN------------------------KGHVKVTDFGFAK 166 (329)
T ss_pred CeeecCCCHHHEEECC------------------------CCCEEEeeccCce
Confidence 4899999999999975 3578899987654
No 117
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=94.53 E-value=0.042 Score=46.44 Aligned_cols=16 Identities=19% Similarity=0.337 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||++.
T Consensus 115 ~ivHrDikp~NIll~~ 130 (328)
T cd05593 115 KIVYRDLKLENLMLDK 130 (328)
T ss_pred CeEecccCHHHeEECC
Confidence 5899999999999975
No 118
>KOG0581|consensus
Probab=94.52 E-value=0.041 Score=48.48 Aligned_cols=48 Identities=25% Similarity=0.379 Sum_probs=35.8
Q ss_pred HhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHH
Q psy15664 20 LLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFV 93 (174)
Q Consensus 20 l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~ 93 (174)
|.......-+.|+|++|.|||++. .+.++|-||=-++.--.. +||-|.
T Consensus 191 L~YLh~~~~IIHRDIKPsNlLvNs------------------------kGeVKicDFGVS~~lvnS--~a~tfv 238 (364)
T KOG0581|consen 191 LSYLHEERKIIHRDIKPSNLLVNS------------------------KGEVKICDFGVSGILVNS--IANTFV 238 (364)
T ss_pred HHHHhhccCeeeccCCHHHeeecc------------------------CCCEEeccccccHHhhhh--hccccc
Confidence 344454577999999999999986 578999999877764444 666554
No 119
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=94.51 E-value=0.045 Score=43.66 Aligned_cols=16 Identities=44% Similarity=0.644 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 117 ~i~H~di~p~nil~~~ 132 (257)
T cd05040 117 RFIHRDLAARNILLAS 132 (257)
T ss_pred CccccccCcccEEEec
Confidence 5799999999999986
No 120
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=94.51 E-value=0.046 Score=46.56 Aligned_cols=16 Identities=25% Similarity=0.549 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||++.
T Consensus 188 ~ivHrDlkp~NIll~~ 203 (353)
T PLN00034 188 HIVHRDIKPSNLLINS 203 (353)
T ss_pred CEeecCCCHHHEEEcC
Confidence 5899999999999976
No 121
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt
Probab=94.50 E-value=0.043 Score=46.12 Aligned_cols=17 Identities=29% Similarity=0.432 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||++.|||++.
T Consensus 115 ~giiHrDlkp~Nili~~ 131 (325)
T cd05602 115 LNIVYRDLKPENILLDS 131 (325)
T ss_pred CCeEecCCCHHHeEECC
Confidence 35899999999999975
No 122
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=94.49 E-value=0.053 Score=44.98 Aligned_cols=30 Identities=27% Similarity=0.412 Sum_probs=25.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+|+++.||++.. .+.++|+||+.+..
T Consensus 123 ~i~H~dlkp~Nili~~------------------------~~~~~l~dfg~~~~ 152 (316)
T cd05574 123 GIVYRDLKPENILLHE------------------------SGHIMLSDFDLSKQ 152 (316)
T ss_pred CeeccCCChHHeEEcC------------------------CCCEEEeecchhhc
Confidence 4899999999999986 36789999998764
No 123
>PHA03209 serine/threonine kinase US3; Provisional
Probab=94.46 E-value=0.044 Score=46.97 Aligned_cols=29 Identities=17% Similarity=0.288 Sum_probs=23.6
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||+.. .+.++|+||..+.
T Consensus 177 ~ivHrDlkp~Nill~~------------------------~~~~kl~DfG~a~ 205 (357)
T PHA03209 177 RIIHRDVKTENIFIND------------------------VDQVCIGDLGAAQ 205 (357)
T ss_pred CeecCCCCHHHEEECC------------------------CCCEEEecCcccc
Confidence 4899999999999975 3567888887664
No 124
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=94.45 E-value=0.038 Score=45.58 Aligned_cols=17 Identities=35% Similarity=0.501 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||++.|||++.
T Consensus 123 ~~i~H~dlkp~Nil~~~ 139 (301)
T cd07873 123 RKVLHRDLKPQNLLINE 139 (301)
T ss_pred CCeeCCCCCHHHEEECC
Confidence 35899999999999976
No 125
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=94.45 E-value=0.048 Score=45.02 Aligned_cols=29 Identities=24% Similarity=0.418 Sum_probs=23.9
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||+|.|||++. .+.++|+||..+.
T Consensus 121 ~i~H~dlkp~NIli~~------------------------~~~~kl~Dfg~~~ 149 (291)
T cd05612 121 EIVYRDLKPENILLDK------------------------EGHIKLTDFGFAK 149 (291)
T ss_pred CeeecCCCHHHeEECC------------------------CCCEEEEecCcch
Confidence 5899999999999975 3578899987654
No 126
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=94.44 E-value=0.043 Score=46.09 Aligned_cols=29 Identities=31% Similarity=0.513 Sum_probs=23.5
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.|||++. ++.++|+||..+.
T Consensus 116 givH~dikp~NIll~~------------------------~~~~kl~Dfg~~~ 144 (323)
T cd05575 116 NIIYRDLKPENILLDS------------------------QGHVVLTDFGLCK 144 (323)
T ss_pred CeEeCCCCHHHeEECC------------------------CCcEEEeccCCCc
Confidence 4899999999999975 3568888887654
No 127
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=94.43 E-value=0.056 Score=46.33 Aligned_cols=29 Identities=31% Similarity=0.635 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. .+.++|+||-.|.
T Consensus 121 ~ivHrDlkp~Nill~~------------------------~~~ikL~DFG~a~ 149 (376)
T cd05598 121 GFIHRDIKPDNILIDR------------------------DGHIKLTDFGLCT 149 (376)
T ss_pred CeEeCCCCHHHEEECC------------------------CCCEEEEeCCCCc
Confidence 4899999999999975 4679999998764
No 128
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=94.42 E-value=0.04 Score=46.33 Aligned_cols=16 Identities=31% Similarity=0.362 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||++.
T Consensus 120 ~ivH~dlkp~Nil~~~ 135 (323)
T cd05584 120 GIIYRDLKPENILLDA 135 (323)
T ss_pred CeecCCCCHHHeEECC
Confidence 5899999999999975
No 129
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=94.42 E-value=0.051 Score=48.77 Aligned_cols=29 Identities=24% Similarity=0.374 Sum_probs=23.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||+|.|||++. .+.++|+||..|.
T Consensus 189 ~ivHrDlkp~NIll~~------------------------~~~~kL~DFgla~ 217 (478)
T PTZ00267 189 KMMHRDLKSANIFLMP------------------------TGIIKLGDFGFSK 217 (478)
T ss_pred CEEECCcCHHhEEECC------------------------CCcEEEEeCcCce
Confidence 5899999999999985 3568888887653
No 130
>PRK09188 serine/threonine protein kinase; Provisional
Probab=94.42 E-value=0.069 Score=47.10 Aligned_cols=40 Identities=30% Similarity=0.323 Sum_probs=30.4
Q ss_pred eeeeeccC-CCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHH
Q psy15664 27 VTFCHNDL-QEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIAN 90 (174)
Q Consensus 27 ~v~cHNDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan 90 (174)
..++|+|| +|+|||++. ++.++||||..|..-.+.-.++.
T Consensus 130 ~gIiHrDL~KP~NILv~~------------------------~~~ikLiDFGlA~~~~~~~~~~~ 170 (365)
T PRK09188 130 AGITHNDLAKPQNWLMGP------------------------DGEAAVIDFQLASVFRRRGALYR 170 (365)
T ss_pred CCCeeCCCCCcceEEEcC------------------------CCCEEEEECccceecccCcchhh
Confidence 36899999 899999964 35799999998886555443333
No 131
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=94.40 E-value=0.054 Score=44.94 Aligned_cols=16 Identities=38% Similarity=0.414 Sum_probs=14.3
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||+..
T Consensus 128 ~ivHrDlkp~Nil~~~ 143 (317)
T cd07868 128 WVLHRDLKPANILVMG 143 (317)
T ss_pred CEEcCCCCHHHEEEec
Confidence 4899999999999964
No 132
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of
Probab=94.39 E-value=0.049 Score=46.79 Aligned_cols=30 Identities=27% Similarity=0.474 Sum_probs=25.4
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||+|.|||++. ++.++|+||..|.
T Consensus 120 ~givHrDlkp~NIll~~------------------------~~~~kl~DfGla~ 149 (377)
T cd05629 120 LGFIHRDIKPDNILIDR------------------------GGHIKLSDFGLST 149 (377)
T ss_pred CCeeccCCCHHHEEECC------------------------CCCEEEeeccccc
Confidence 35999999999999975 4679999998774
No 133
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=94.38 E-value=0.051 Score=45.57 Aligned_cols=16 Identities=31% Similarity=0.314 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 116 ~ivHrDikp~Nill~~ 131 (321)
T cd05591 116 GVIYRDLKLDNILLDA 131 (321)
T ss_pred CeeccCCCHHHeEECC
Confidence 4899999999999975
No 134
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=94.38 E-value=0.045 Score=46.28 Aligned_cols=16 Identities=25% Similarity=0.318 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||++.
T Consensus 116 ~ivH~Dikp~Nili~~ 131 (329)
T cd05618 116 GIIYRDLKLDNVLLDS 131 (329)
T ss_pred CeeeCCCCHHHEEECC
Confidence 5899999999999975
No 135
>PHA02882 putative serine/threonine kinase; Provisional
Probab=94.37 E-value=0.057 Score=44.70 Aligned_cols=16 Identities=25% Similarity=0.470 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|++|.|||++.
T Consensus 146 ~iiHrDiKp~Nill~~ 161 (294)
T PHA02882 146 GISHGDIKPENIMVDG 161 (294)
T ss_pred CeecCCCCHHHEEEcC
Confidence 5899999999999975
No 136
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast
Probab=94.37 E-value=0.055 Score=42.71 Aligned_cols=30 Identities=23% Similarity=0.337 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+|+++.||++.. .+.++|+||.++..
T Consensus 119 ~i~H~dl~p~ni~i~~------------------------~~~~~l~d~~~~~~ 148 (254)
T cd06627 119 GVIHRDIKAANILTTK------------------------DGVVKLADFGVATK 148 (254)
T ss_pred CcccCCCCHHHEEECC------------------------CCCEEEecccccee
Confidence 5789999999999975 35789999987764
No 137
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=94.36 E-value=0.048 Score=46.97 Aligned_cols=29 Identities=31% Similarity=0.635 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||+|.|||++. .+.++|+||..|.
T Consensus 121 ~ivHrDlKp~NILl~~------------------------~g~~kL~DFGla~ 149 (382)
T cd05625 121 GFIHRDIKPDNILIDR------------------------DGHIKLTDFGLCT 149 (382)
T ss_pred CeecCCCCHHHEEECC------------------------CCCEEEeECCCCc
Confidence 4899999999999975 4679999998764
No 138
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=94.36 E-value=0.048 Score=46.55 Aligned_cols=29 Identities=28% Similarity=0.542 Sum_probs=24.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|++|.|||+.. ++.++|+||..+.
T Consensus 146 ~ivH~Dlkp~NIll~~------------------------~~~~kL~DfG~a~ 174 (364)
T cd07875 146 GIIHRDLKPSNIVVKS------------------------DCTLKILDFGLAR 174 (364)
T ss_pred CeecCCCCHHHEEECC------------------------CCcEEEEeCCCcc
Confidence 5899999999999975 3568888887764
No 139
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=94.35 E-value=0.042 Score=45.60 Aligned_cols=17 Identities=47% Similarity=0.614 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.|||++.
T Consensus 143 ~gi~H~dlkp~Nili~~ 159 (303)
T cd05088 143 KQFIHRDLAARNILVGE 159 (303)
T ss_pred CCccccccchheEEecC
Confidence 46899999999999975
No 140
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=94.34 E-value=0.054 Score=45.77 Aligned_cols=28 Identities=29% Similarity=0.628 Sum_probs=23.1
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.++|+||++.|||+.. .+.++|+||..+
T Consensus 122 ~ivH~dlkp~Nill~~------------------------~~~~kl~Dfg~~ 149 (331)
T cd05597 122 GYVHRDIKPDNVLLDK------------------------NGHIRLADFGSC 149 (331)
T ss_pred CeEECCCCHHHEEECC------------------------CCCEEEEECCce
Confidence 4789999999999975 356888998764
No 141
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=94.32 E-value=0.038 Score=45.47 Aligned_cols=17 Identities=35% Similarity=0.518 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||+|.|||++.
T Consensus 122 ~~ivH~dlkp~Nil~~~ 138 (288)
T cd07871 122 RKILHRDLKPQNLLINE 138 (288)
T ss_pred CCcccCCCCHHHEEECC
Confidence 35899999999999975
No 142
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is
Probab=94.31 E-value=0.051 Score=45.84 Aligned_cols=16 Identities=31% Similarity=0.495 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 138 ~ivHrdikp~Nil~~~ 153 (343)
T cd07878 138 GIIHRDLKPSNVAVNE 153 (343)
T ss_pred CeecccCChhhEEECC
Confidence 5899999999999975
No 143
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=94.31 E-value=0.048 Score=46.04 Aligned_cols=29 Identities=31% Similarity=0.607 Sum_probs=23.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
..++|+||++.|||++. ++.++|+||..+
T Consensus 121 ~~iiHrDlkp~Nili~~------------------------~~~~kL~DfG~a 149 (332)
T cd05623 121 LHYVHRDIKPDNILMDM------------------------NGHIRLADFGSC 149 (332)
T ss_pred CCeEecCCCHHHEEECC------------------------CCCEEEeecchh
Confidence 34899999999999975 356888888754
No 144
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=94.29 E-value=0.066 Score=44.99 Aligned_cols=16 Identities=44% Similarity=0.567 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||++.
T Consensus 194 ~ivHrDiKp~Nil~~~ 209 (338)
T cd05102 194 KCIHRDLAARNILLSE 209 (338)
T ss_pred CEECCCCccceEEEcC
Confidence 5899999999999975
No 145
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=94.29 E-value=0.052 Score=43.39 Aligned_cols=29 Identities=34% Similarity=0.525 Sum_probs=23.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. ++.++++||..+.
T Consensus 123 ~i~h~di~p~nili~~------------------------~~~~~l~d~g~~~ 151 (261)
T cd05034 123 NYIHRDLAARNILVGE------------------------NLVCKIADFGLAR 151 (261)
T ss_pred CcccCCcchheEEEcC------------------------CCCEEECccccce
Confidence 4899999999999976 3678888887654
No 146
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=94.28 E-value=0.048 Score=45.77 Aligned_cols=16 Identities=19% Similarity=0.289 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||++.
T Consensus 121 ~ivH~dlkp~Nill~~ 136 (324)
T cd05587 121 GIIYRDLKLDNVMLDA 136 (324)
T ss_pred CeEecCCCHHHeEEcC
Confidence 5899999999999976
No 147
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=94.28 E-value=0.047 Score=44.59 Aligned_cols=17 Identities=24% Similarity=0.311 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 124 ~~~~H~dl~p~nil~~~ 140 (288)
T cd05583 124 LGIIYRDIKLENILLDS 140 (288)
T ss_pred CCeeccCCCHHHeEECC
Confidence 35899999999999975
No 148
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular
Probab=94.28 E-value=0.062 Score=42.81 Aligned_cols=16 Identities=38% Similarity=0.430 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 114 ~i~H~dl~p~nil~~~ 129 (252)
T cd05084 114 HCIHRDLAARNCLVTE 129 (252)
T ss_pred CccccccchheEEEcC
Confidence 4799999999999975
No 149
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=94.27 E-value=0.05 Score=45.99 Aligned_cols=17 Identities=24% Similarity=0.591 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||++.|||++.
T Consensus 121 ~~iiHrDlkp~Nill~~ 137 (331)
T cd05624 121 LHYVHRDIKPDNVLLDM 137 (331)
T ss_pred CCeeeccCchHHEEEcC
Confidence 35899999999999975
No 150
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=94.26 E-value=0.055 Score=43.65 Aligned_cols=17 Identities=35% Similarity=0.538 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 128 ~~i~H~dl~p~nil~~~ 144 (284)
T cd05038 128 QRYIHRDLAARNILVES 144 (284)
T ss_pred CCeecCCCCHHhEEEcC
Confidence 35899999999999976
No 151
>KOG0594|consensus
Probab=94.26 E-value=0.077 Score=46.20 Aligned_cols=17 Identities=29% Similarity=0.419 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
-.+.|+||+|.|||+++
T Consensus 139 ~~IlHRDLKPQNlLi~~ 155 (323)
T KOG0594|consen 139 HGILHRDLKPQNLLISS 155 (323)
T ss_pred CCeecccCCcceEEECC
Confidence 35789999999999987
No 152
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=94.25 E-value=0.065 Score=43.61 Aligned_cols=16 Identities=31% Similarity=0.605 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|++|.|||+..
T Consensus 127 ~i~H~dlkp~Nili~~ 142 (283)
T cd05080 127 HYIHRDLAARNVLLDN 142 (283)
T ss_pred CeeccccChheEEEcC
Confidence 5899999999999975
No 153
>TIGR02457 TreS_Cterm trehalose synthase-fused probable maltokinase. Three pathways for the biosynthesis of trehalose, an osmoprotectant that in some species is also a precursor of certain cell wall glycolipids. Trehalose synthase, TreS, can interconvert maltose and trehalose, but while the equilibrium may favor trehalose, physiological concentrations of trehalose may be much greater than that of maltose and TreS may act largely in its degradation. This model describes a domain found only as a C-terminal fusion to TreS proteins. The most closely related proteins outside this family, Pep2 of Streptomyces coelicolor and Mak1 of Actinoplanes missouriensis, have known maltokinase activity. We suggest this domain acts as a maltokinase and helps drive conversion of trehalose to maltose.
Probab=94.24 E-value=0.058 Score=49.87 Aligned_cols=44 Identities=27% Similarity=0.249 Sum_probs=33.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc---------cCccchhhHHHHHHHHh
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC---------SYNYRAFDIANHFVESV 96 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa---------~~n~~~fDlan~f~E~~ 96 (174)
.=||+|+|.||+|+.. +..+|||||== ....+.=|+|..+..+-
T Consensus 380 ~RiHGD~HLgqvL~t~-------------------------~d~~IiDFEGEP~Rpl~ERR~k~sPLRDVAGMLRSf~ 432 (528)
T TIGR02457 380 IRIHGDFHLGQVLVVQ-------------------------DDAVLIDFEGEPARPLAERRAKRSPLRDVAGMLRSFD 432 (528)
T ss_pred EeEecCcchhcEEEeC-------------------------CCeEEEcCCCCCCCChHHhccCCChHHHHHHHHHHHH
Confidence 4499999999999875 46779999842 23456678888887744
No 154
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=94.24 E-value=0.047 Score=46.68 Aligned_cols=29 Identities=21% Similarity=0.368 Sum_probs=23.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||+|.|||++. ++.++|+||..+.
T Consensus 151 ~ivHrDLkp~NILl~~------------------------~~~ikL~DFG~a~ 179 (340)
T PTZ00426 151 NIVYRDLKPENLLLDK------------------------DGFIKMTDFGFAK 179 (340)
T ss_pred CeEccCCCHHHEEECC------------------------CCCEEEecCCCCe
Confidence 5899999999999975 3568888887664
No 155
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=94.23 E-value=0.038 Score=46.51 Aligned_cols=16 Identities=38% Similarity=0.656 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++++|||+..
T Consensus 125 givH~dlkp~Nili~~ 140 (332)
T cd07857 125 NVLHRDLKPGNLLVNA 140 (332)
T ss_pred CcccCCCCHHHeEEcC
Confidence 4899999999999976
No 156
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=94.22 E-value=0.048 Score=44.85 Aligned_cols=17 Identities=29% Similarity=0.425 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||++.||+++.
T Consensus 134 ~~i~H~dl~p~nill~~ 150 (296)
T cd06618 134 HGVIHRDVKPSNILLDA 150 (296)
T ss_pred CCEecCCCcHHHEEEcC
Confidence 35899999999999975
No 157
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=94.22 E-value=0.053 Score=43.85 Aligned_cols=16 Identities=31% Similarity=0.526 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 119 ~i~H~dl~p~ni~~~~ 134 (286)
T cd07832 119 GIMHRDLKPANLLISA 134 (286)
T ss_pred CeecCCcCHHHEEEcC
Confidence 4899999999999986
No 158
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=94.20 E-value=0.058 Score=44.56 Aligned_cols=29 Identities=34% Similarity=0.575 Sum_probs=23.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|++|.|||++. .+.++|+||-++.
T Consensus 158 ~ivH~dlkp~Nill~~------------------------~~~~kl~DfG~~~ 186 (304)
T cd05096 158 NFVHRDLATRNCLVGE------------------------NLTIKIADFGMSR 186 (304)
T ss_pred CccccCcchhheEEcC------------------------CccEEECCCccce
Confidence 4789999999999986 3567888887654
No 159
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=94.19 E-value=0.053 Score=44.74 Aligned_cols=17 Identities=41% Similarity=0.597 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.|||+..
T Consensus 138 ~~ivH~dlkp~Nill~~ 154 (297)
T cd05089 138 KQFIHRDLAARNVLVGE 154 (297)
T ss_pred CCcccCcCCcceEEECC
Confidence 35899999999999976
No 160
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=94.19 E-value=0.06 Score=45.25 Aligned_cols=16 Identities=25% Similarity=0.322 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||++.
T Consensus 116 ~ivH~dlkp~NIli~~ 131 (320)
T cd05590 116 GIIYRDLKLDNVLLDH 131 (320)
T ss_pred CeEeCCCCHHHeEECC
Confidence 5899999999999975
No 161
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=94.18 E-value=0.053 Score=44.47 Aligned_cols=31 Identities=19% Similarity=0.363 Sum_probs=24.8
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+|+++.|||+.. .+.++|+||.++..
T Consensus 120 ~~i~H~dl~p~nili~~------------------------~~~~kl~dfg~~~~ 150 (290)
T cd05580 120 LDIVYRDLKPENLLLDS------------------------DGYIKITDFGFAKR 150 (290)
T ss_pred CCEecCCCCHHHEEECC------------------------CCCEEEeeCCCccc
Confidence 45899999999999976 35688888876653
No 162
>KOG4250|consensus
Probab=94.18 E-value=0.062 Score=50.98 Aligned_cols=34 Identities=24% Similarity=0.343 Sum_probs=25.0
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
-.+||+||+||||++..+..+ +.--+|+||=||-
T Consensus 139 n~IvHRDlKP~NIvl~~Gedg--------------------q~IyKLtDfG~Ar 172 (732)
T KOG4250|consen 139 NGIVHRDLKPGNIVLQIGEDG--------------------QSIYKLTDFGAAR 172 (732)
T ss_pred cCceeccCCCCcEEEeecCCC--------------------ceEEeeecccccc
Confidence 469999999999999874221 2346788887664
No 163
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=94.16 E-value=0.053 Score=44.06 Aligned_cols=29 Identities=21% Similarity=0.408 Sum_probs=23.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|++|.|||+.+ ...++|+||..+.
T Consensus 144 gi~H~dlkp~Nil~~~------------------------~~~~kl~Dfg~~~ 172 (283)
T cd05091 144 HVVHKDLATRNVLVFD------------------------KLNVKISDLGLFR 172 (283)
T ss_pred CccccccchhheEecC------------------------CCceEeccccccc
Confidence 4799999999999975 3567888887543
No 164
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=94.16 E-value=0.055 Score=46.38 Aligned_cols=16 Identities=31% Similarity=0.621 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||++.
T Consensus 123 ~ivH~dlkp~Nili~~ 138 (372)
T cd07853 123 GILHRDIKPGNLLVNS 138 (372)
T ss_pred CeeCCCCChHHEEECC
Confidence 4899999999999976
No 165
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=94.14 E-value=0.049 Score=45.20 Aligned_cols=16 Identities=38% Similarity=0.573 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 124 ~ivH~dlkp~Nill~~ 139 (309)
T cd07872 124 KVLHRDLKPQNLLINE 139 (309)
T ss_pred CeecCCCCHHHEEECC
Confidence 5899999999999976
No 166
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=94.11 E-value=0.05 Score=43.75 Aligned_cols=16 Identities=38% Similarity=0.638 Sum_probs=14.3
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 132 ~i~H~dlkp~Nil~~~ 147 (272)
T cd05075 132 SFIHRDLAARNCMLNE 147 (272)
T ss_pred CeeccccchhheEEcC
Confidence 4799999999999975
No 167
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=94.10 E-value=0.048 Score=45.75 Aligned_cols=16 Identities=19% Similarity=0.297 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 116 ~ivHrDlkp~Nil~~~ 131 (316)
T cd05620 116 GIIYRDLKLDNVMLDR 131 (316)
T ss_pred CeEecCCCHHHeEECC
Confidence 5899999999999975
No 168
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis.
Probab=94.10 E-value=0.064 Score=45.12 Aligned_cols=29 Identities=24% Similarity=0.416 Sum_probs=24.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. .+.++|+||..+.
T Consensus 121 ~ivH~dlkp~Nil~~~------------------------~~~~kL~Dfg~a~ 149 (333)
T cd05600 121 GYIHRDLKPENFLIDA------------------------SGHIKLTDFGLSK 149 (333)
T ss_pred CccccCCCHHHEEECC------------------------CCCEEEEeCcCCc
Confidence 4899999999999975 3578999997664
No 169
>PTZ00036 glycogen synthase kinase; Provisional
Probab=94.10 E-value=0.058 Score=47.97 Aligned_cols=17 Identities=35% Similarity=0.641 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||+|.|||++.
T Consensus 189 ~~IiHrDLKp~NILl~~ 205 (440)
T PTZ00036 189 KFICHRDLKPQNLLIDP 205 (440)
T ss_pred CCEecCCcCHHHEEEcC
Confidence 35899999999999975
No 170
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds
Probab=94.09 E-value=0.076 Score=42.72 Aligned_cols=29 Identities=31% Similarity=0.383 Sum_probs=23.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.+.|+|++++||++.. ++.++++||..+.
T Consensus 120 ~i~H~dl~p~nili~~------------------------~~~~kl~d~g~~~ 148 (256)
T cd05113 120 QFIHRDLAARNCLVDD------------------------QGCVKVSDFGLSR 148 (256)
T ss_pred CeeccccCcceEEEcC------------------------CCCEEECCCccce
Confidence 5899999999999975 3568888887654
No 171
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=94.08 E-value=0.063 Score=43.76 Aligned_cols=28 Identities=29% Similarity=0.434 Sum_probs=23.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.++|+|++|.|||+.. ++.++|+||..+
T Consensus 130 ~iiH~dlkp~Nil~~~------------------------~~~~kl~Dfg~~ 157 (290)
T cd07862 130 RVVHRDLKPQNILVTS------------------------SGQIKLADFGLA 157 (290)
T ss_pred CeeeCCCCHHHEEEcC------------------------CCCEEEccccce
Confidence 4899999999999975 356888888655
No 172
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=94.08 E-value=0.084 Score=42.23 Aligned_cols=29 Identities=28% Similarity=0.441 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.|||+.. .+.++|+||..+.
T Consensus 115 ~i~H~di~p~nili~~------------------------~~~~kl~df~~~~ 143 (257)
T cd05060 115 HFVHRDLAARNVLLVN------------------------RHQAKISDFGMSR 143 (257)
T ss_pred CeeccCcccceEEEcC------------------------CCcEEeccccccc
Confidence 4899999999999975 3567888887654
No 173
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=94.08 E-value=0.061 Score=43.40 Aligned_cols=17 Identities=35% Similarity=0.601 Sum_probs=14.8
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.|||++.
T Consensus 125 ~~i~h~dlkp~nili~~ 141 (267)
T cd05066 125 MGYVHRDLAARNILVNS 141 (267)
T ss_pred CCEeehhhchhcEEECC
Confidence 35899999999999975
No 174
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=94.05 E-value=0.055 Score=45.70 Aligned_cols=16 Identities=25% Similarity=0.314 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||++.
T Consensus 116 ~ivH~dlkp~Nili~~ 131 (329)
T cd05588 116 GIIYRDLKLDNVLLDA 131 (329)
T ss_pred CeEecCCCHHHeEECC
Confidence 5899999999999975
No 175
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=94.00 E-value=0.057 Score=45.92 Aligned_cols=29 Identities=24% Similarity=0.573 Sum_probs=24.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. ++.++|+||..+.
T Consensus 121 ~ivH~Dlkp~NIl~~~------------------------~~~~kl~Dfg~~~ 149 (364)
T cd05599 121 GYIHRDIKPDNLLLDA------------------------KGHIKLSDFGLCT 149 (364)
T ss_pred CeEeccCCHHHeEECC------------------------CCCEEEeecccce
Confidence 4789999999999975 4679999998774
No 176
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=94.00 E-value=0.065 Score=44.68 Aligned_cols=16 Identities=38% Similarity=0.513 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 123 ~ivH~dlkp~NIll~~ 138 (338)
T cd07859 123 NVFHRDLKPKNILANA 138 (338)
T ss_pred CeecCCCCHHHeEECC
Confidence 4899999999999976
No 177
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=94.00 E-value=0.061 Score=44.97 Aligned_cols=29 Identities=28% Similarity=0.359 Sum_probs=24.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||++. ++.++|+||..+.
T Consensus 118 ~i~H~dlkp~Nil~~~------------------------~~~~kL~Dfg~~~ 146 (318)
T cd05582 118 GIIYRDLKPENILLDE------------------------EGHIKLTDFGLSK 146 (318)
T ss_pred CEecCCCCHHHeEECC------------------------CCcEEEeeccCCc
Confidence 5899999999999975 3578999997654
No 178
>PHA03207 serine/threonine kinase US3; Provisional
Probab=93.99 E-value=0.044 Score=47.61 Aligned_cols=16 Identities=31% Similarity=0.528 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||+..
T Consensus 205 givHrDlkp~Nill~~ 220 (392)
T PHA03207 205 GIIHRDVKTENIFLDE 220 (392)
T ss_pred CccccCCCHHHEEEcC
Confidence 5899999999999976
No 179
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=93.99 E-value=0.076 Score=45.92 Aligned_cols=17 Identities=29% Similarity=0.618 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||+|.|||++.
T Consensus 161 ~~ivHrDLkp~NIll~~ 177 (371)
T cd05622 161 MGFIHRDVKPDNMLLDK 177 (371)
T ss_pred CCEEeCCCCHHHEEECC
Confidence 35899999999999975
No 180
>KOG1166|consensus
Probab=93.98 E-value=0.12 Score=51.07 Aligned_cols=48 Identities=23% Similarity=0.361 Sum_probs=33.4
Q ss_pred HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
-++..+-+.|.. ..+.|+||+|.|+|+.......+ +...|+||||=+|
T Consensus 801 ~qml~ive~lH~----~~IIHgDiKPDNfll~~~~~~~~-----------------~~~~l~lIDfG~s 848 (974)
T KOG1166|consen 801 CQMLRIVEHLHA----MGIIHGDIKPDNFLLRREICADS-----------------DSKGLYLIDFGRS 848 (974)
T ss_pred HHHHHHHHHHHh----cceecccCCcceeEeecccCCCC-----------------cccceEEEecccc
Confidence 445555555544 45999999999999987433211 2477999999655
No 181
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=93.98 E-value=0.088 Score=41.98 Aligned_cols=30 Identities=23% Similarity=0.323 Sum_probs=24.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||++.. .+.++++||..+.
T Consensus 119 ~~i~H~dl~p~nili~~------------------------~~~~~l~dfg~~~ 148 (255)
T cd08219 119 KRVLHRDIKSKNIFLTQ------------------------NGKVKLGDFGSAR 148 (255)
T ss_pred CCcccCCCCcceEEECC------------------------CCcEEEcccCcce
Confidence 35899999999999975 3568888988664
No 182
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=93.97 E-value=0.08 Score=42.76 Aligned_cols=16 Identities=38% Similarity=0.466 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 142 ~i~h~dlkp~nili~~ 157 (280)
T cd05049 142 HFVHRDLATRNCLVGY 157 (280)
T ss_pred CeeccccccceEEEcC
Confidence 5789999999999976
No 183
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=93.97 E-value=0.067 Score=43.69 Aligned_cols=29 Identities=28% Similarity=0.379 Sum_probs=23.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
..++|+||++.|||+.. ++.++|+||..+
T Consensus 124 ~~i~H~dl~p~nil~~~------------------------~~~~kl~dfg~~ 152 (290)
T cd05613 124 LGIIYRDIKLENILLDS------------------------NGHVVLTDFGLS 152 (290)
T ss_pred CCeeccCCCHHHeEECC------------------------CCCEEEeeCccc
Confidence 35899999999999975 356888888655
No 184
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=93.97 E-value=0.067 Score=43.21 Aligned_cols=16 Identities=44% Similarity=0.748 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.||++.+
T Consensus 122 ~i~H~dl~p~Nill~~ 137 (262)
T cd05071 122 NYVHRDLRAANILVGE 137 (262)
T ss_pred CccccccCcccEEEcC
Confidence 4789999999999976
No 185
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=93.97 E-value=0.076 Score=43.12 Aligned_cols=17 Identities=29% Similarity=0.516 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 128 ~~i~H~di~p~nil~~~ 144 (279)
T cd05057 128 KRLVHRDLAARNVLVKT 144 (279)
T ss_pred CCEEecccCcceEEEcC
Confidence 46899999999999975
No 186
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=93.97 E-value=0.049 Score=44.65 Aligned_cols=16 Identities=38% Similarity=0.445 Sum_probs=14.3
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 117 ~ivH~dikp~Nil~~~ 132 (279)
T cd05633 117 FVVYRDLKPANILLDE 132 (279)
T ss_pred CcCCCCCCHHHEEECC
Confidence 3789999999999975
No 187
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=93.96 E-value=0.075 Score=43.61 Aligned_cols=16 Identities=38% Similarity=0.522 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 143 ~i~H~dlkp~Nil~~~ 158 (291)
T cd05094 143 HFVHRDLATRNCLVGA 158 (291)
T ss_pred CeeecccCcceEEEcc
Confidence 5899999999999986
No 188
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=93.96 E-value=0.054 Score=43.95 Aligned_cols=16 Identities=31% Similarity=0.532 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 119 ~i~H~dl~~~nil~~~ 134 (284)
T cd07839 119 NVLHRDLKPQNLLINK 134 (284)
T ss_pred CEecCCCCHHHEEEcC
Confidence 5899999999999976
No 189
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=93.95 E-value=0.074 Score=43.34 Aligned_cols=30 Identities=23% Similarity=0.482 Sum_probs=24.4
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||+++. .+.++|+||.++.
T Consensus 135 ~gi~H~dl~p~ni~i~~------------------------~~~~~l~d~~~~~ 164 (286)
T cd06614 135 QNVIHRDIKSDNILLSK------------------------DGSVKLADFGFAA 164 (286)
T ss_pred CCeeeCCCChhhEEEcC------------------------CCCEEECccchhh
Confidence 45899999999999985 3568888887654
No 190
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the
Probab=93.95 E-value=0.084 Score=41.71 Aligned_cols=31 Identities=23% Similarity=0.306 Sum_probs=24.6
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+|+++.||++.. .+.++++||..+..
T Consensus 112 ~~~~H~~l~p~ni~~~~------------------------~~~~~l~d~~~~~~ 142 (250)
T cd05123 112 LGIIYRDLKPENILLDA------------------------DGHIKLTDFGLAKE 142 (250)
T ss_pred CCceecCCCcceEEEcC------------------------CCcEEEeecCccee
Confidence 45899999999999976 35678888876643
No 191
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=93.95 E-value=0.075 Score=43.03 Aligned_cols=17 Identities=47% Similarity=0.614 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|++|.|||+..
T Consensus 131 ~~i~H~dikp~nili~~ 147 (270)
T cd05047 131 KQFIHRDLAARNILVGE 147 (270)
T ss_pred CCEeecccccceEEEcC
Confidence 46899999999999976
No 192
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=93.95 E-value=0.058 Score=45.80 Aligned_cols=29 Identities=28% Similarity=0.542 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|++|.|||+.. ++.++|+||..+.
T Consensus 139 givHrDikp~Nill~~------------------------~~~~kl~Dfg~~~ 167 (355)
T cd07874 139 GIIHRDLKPSNIVVKS------------------------DCTLKILDFGLAR 167 (355)
T ss_pred CcccCCCChHHEEECC------------------------CCCEEEeeCcccc
Confidence 5899999999999975 3567888887664
No 193
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=93.90 E-value=0.077 Score=42.38 Aligned_cols=29 Identities=34% Similarity=0.419 Sum_probs=23.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++++ +..++++||.++.
T Consensus 124 ~i~h~dl~~~nilv~~------------------------~~~~kl~d~g~~~ 152 (261)
T cd05148 124 NSIHRDLAARNILVGE------------------------DLVCKVADFGLAR 152 (261)
T ss_pred CeeccccCcceEEEcC------------------------CceEEEccccchh
Confidence 4899999999999976 3567888887764
No 194
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=93.88 E-value=0.057 Score=45.08 Aligned_cols=16 Identities=38% Similarity=0.565 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 123 gi~H~dlkp~nili~~ 138 (330)
T cd07834 123 NVIHRDLKPSNILVNS 138 (330)
T ss_pred CeecCCCCHHHEEEcC
Confidence 4899999999999986
No 195
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is
Probab=93.88 E-value=0.091 Score=42.99 Aligned_cols=16 Identities=31% Similarity=0.457 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 122 ~i~H~dl~p~nill~~ 137 (298)
T cd07841 122 WILHRDLKPNNLLIAS 137 (298)
T ss_pred CeeecCCChhhEEEcC
Confidence 4899999999999986
No 196
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=93.87 E-value=0.059 Score=44.15 Aligned_cols=16 Identities=25% Similarity=0.380 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 117 ~i~H~dlkp~Nili~~ 132 (280)
T cd05608 117 RIIYRDLKPENVLLDN 132 (280)
T ss_pred CcccCCCCHHHEEECC
Confidence 5899999999999975
No 197
>PTZ00284 protein kinase; Provisional
Probab=93.86 E-value=0.059 Score=47.99 Aligned_cols=22 Identities=27% Similarity=0.461 Sum_probs=17.1
Q ss_pred hcCCCeeeeeccCCCCCeeecC
Q psy15664 22 KIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 22 ~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
.......++|+||++.|||+..
T Consensus 246 yLH~~~gIiHrDlKP~NILl~~ 267 (467)
T PTZ00284 246 YFHTELHLMHTDLKPENILMET 267 (467)
T ss_pred HHHhcCCeecCCCCHHHEEEec
Confidence 3333356899999999999975
No 198
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=93.85 E-value=0.058 Score=45.97 Aligned_cols=16 Identities=31% Similarity=0.555 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||+..
T Consensus 143 ~ivHrDlkp~NIl~~~ 158 (359)
T cd07876 143 GIIHRDLKPSNIVVKS 158 (359)
T ss_pred CcccCCCCHHHEEECC
Confidence 5899999999999975
No 199
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=93.84 E-value=0.084 Score=48.94 Aligned_cols=30 Identities=23% Similarity=0.465 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||+|.|||++. ....++|+||-.|.
T Consensus 275 gIiHRDLKP~NILl~~-----------------------~~~~~KL~DFGlA~ 304 (566)
T PLN03225 275 GIVHRDVKPQNIIFSE-----------------------GSGSFKIIDLGAAA 304 (566)
T ss_pred CEEeCcCCHHHEEEeC-----------------------CCCcEEEEeCCCcc
Confidence 5899999999999975 23568999998774
No 200
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=93.83 E-value=0.068 Score=43.87 Aligned_cols=16 Identities=31% Similarity=0.407 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 122 ~iiH~dikp~Nili~~ 137 (285)
T cd05632 122 NTVYRDLKPENILLDD 137 (285)
T ss_pred CeeecCCCHHHEEECC
Confidence 4899999999999975
No 201
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=93.83 E-value=0.088 Score=41.74 Aligned_cols=17 Identities=18% Similarity=0.341 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 120 ~~i~h~dl~~~nili~~ 136 (256)
T cd08529 120 KKILHRDIKSLNLFLDA 136 (256)
T ss_pred CCcccCCCCcceEEEeC
Confidence 46899999999999986
No 202
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=93.82 E-value=0.085 Score=43.96 Aligned_cols=16 Identities=31% Similarity=0.584 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||+..
T Consensus 129 ~iiH~dlkp~Nill~~ 144 (316)
T cd05108 129 RLVHRDLAARNVLVKT 144 (316)
T ss_pred CeeccccchhheEecC
Confidence 4799999999999975
No 203
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic
Probab=93.82 E-value=0.059 Score=44.15 Aligned_cols=16 Identities=31% Similarity=0.557 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++++||++..
T Consensus 135 ~i~H~dl~p~nil~~~ 150 (311)
T cd07866 135 HILHRDIKAANILIDN 150 (311)
T ss_pred CeecCCCCHHHEEECC
Confidence 5899999999999976
No 204
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=93.81 E-value=0.079 Score=42.50 Aligned_cols=16 Identities=38% Similarity=0.627 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 115 ~i~H~dlkp~nill~~ 130 (257)
T cd05116 115 NFVHRDLAARNVLLVT 130 (257)
T ss_pred CEeecccchhhEEEcC
Confidence 4799999999999976
No 205
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=93.80 E-value=0.035 Score=51.37 Aligned_cols=37 Identities=27% Similarity=0.432 Sum_probs=27.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
-.|.|.|+|||||+++.+.. ..+++++|||=-++.-+
T Consensus 279 ~GffHaDpHPGNIlv~~~g~--------------------~~~~i~llDFGivg~l~ 315 (537)
T PRK04750 279 DGFFHADMHPGNIFVSYDPP--------------------ENPRYIALDFGIVGSLN 315 (537)
T ss_pred CCeeeCCCChHHeEEecCCC--------------------CCCeEEEEecceEEECC
Confidence 46999999999999986211 13589999997666443
No 206
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=93.78 E-value=0.078 Score=43.34 Aligned_cols=16 Identities=31% Similarity=0.443 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+||++.|||++.
T Consensus 123 ~i~H~dlkp~Nil~~~ 138 (291)
T cd07870 123 HILHRDLKPQNLLISY 138 (291)
T ss_pred CcccCCCChHHEEEcC
Confidence 5899999999999975
No 207
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=93.78 E-value=0.062 Score=45.11 Aligned_cols=17 Identities=24% Similarity=0.286 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||++.|||++.
T Consensus 115 ~~ivH~dlkp~Nill~~ 131 (316)
T cd05592 115 KGIIYRDLKLDNVLLDK 131 (316)
T ss_pred CCEEeCCCCHHHeEECC
Confidence 35899999999999975
No 208
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=93.71 E-value=0.087 Score=41.81 Aligned_cols=29 Identities=34% Similarity=0.379 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. +..++|+||..+.
T Consensus 113 ~~~H~dl~p~nili~~------------------------~~~~~l~d~g~~~ 141 (250)
T cd05085 113 NCIHRDLAARNCLVGE------------------------NNVLKISDFGMSR 141 (250)
T ss_pred CeeecccChheEEEcC------------------------CCeEEECCCccce
Confidence 5899999999999975 3567888887654
No 209
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=93.71 E-value=0.077 Score=43.30 Aligned_cols=17 Identities=29% Similarity=0.536 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|++|.||++..
T Consensus 128 ~gi~H~dlkp~Nil~~~ 144 (284)
T cd05079 128 RQYVHRDLAARNVLVES 144 (284)
T ss_pred CCeeecccchheEEEcC
Confidence 35899999999999975
No 210
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved
Probab=93.71 E-value=0.069 Score=44.82 Aligned_cols=16 Identities=25% Similarity=0.353 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+||++.|||++.
T Consensus 121 ~ivHrdlkp~Nill~~ 136 (324)
T cd05589 121 KIVYRDLKLDNLLLDT 136 (324)
T ss_pred CeEecCCCHHHeEECC
Confidence 4789999999999976
No 211
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=93.69 E-value=0.087 Score=43.86 Aligned_cols=17 Identities=35% Similarity=0.450 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.|||++.
T Consensus 153 ~gi~H~dlkp~Nill~~ 169 (314)
T cd05099 153 RRCIHRDLAARNVLVTE 169 (314)
T ss_pred CCeeeccccceeEEEcC
Confidence 35899999999999975
No 212
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=93.68 E-value=0.074 Score=42.37 Aligned_cols=29 Identities=34% Similarity=0.371 Sum_probs=23.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. .+.++++||..+.
T Consensus 120 ~i~h~dl~p~ni~i~~------------------------~~~~~l~d~g~~~ 148 (256)
T cd05112 120 NVIHRDLAARNCLVGE------------------------NQVVKVSDFGMTR 148 (256)
T ss_pred CccccccccceEEEcC------------------------CCeEEECCCccee
Confidence 4899999999999975 3567888887653
No 213
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=93.67 E-value=0.071 Score=43.26 Aligned_cols=16 Identities=38% Similarity=0.590 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||++.
T Consensus 139 ~~vH~dlkp~Nil~~~ 154 (277)
T cd05062 139 KFVHRDLAARNCMVAE 154 (277)
T ss_pred CcccCCcchheEEEcC
Confidence 4899999999999986
No 214
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=93.67 E-value=0.097 Score=42.17 Aligned_cols=16 Identities=31% Similarity=0.385 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||++.
T Consensus 120 ~ivH~dlkp~Nill~~ 135 (269)
T cd05042 120 DFIHSDLALRNCQLTA 135 (269)
T ss_pred CEecccccHhheEecC
Confidence 4789999999999976
No 215
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=93.63 E-value=0.09 Score=43.16 Aligned_cols=16 Identities=31% Similarity=0.459 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 122 ~iiH~dikp~Nill~~ 137 (285)
T cd05631 122 RIVYRDLKPENILLDD 137 (285)
T ss_pred CEEeCCCCHHHEEECC
Confidence 5899999999999975
No 216
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=93.62 E-value=0.091 Score=43.37 Aligned_cols=16 Identities=38% Similarity=0.526 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.|||+..
T Consensus 157 givH~dlkp~Nili~~ 172 (304)
T cd05101 157 KCIHRDLAARNVLVTE 172 (304)
T ss_pred CeeecccccceEEEcC
Confidence 5899999999999975
No 217
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=93.61 E-value=0.076 Score=43.11 Aligned_cols=29 Identities=24% Similarity=0.400 Sum_probs=23.6
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. .+.+.|+||..+.
T Consensus 144 ~i~H~dlkp~nili~~------------------------~~~~kl~dfg~~~ 172 (286)
T cd06638 144 KTIHRDVKGNNILLTT------------------------EGGVKLVDFGVSA 172 (286)
T ss_pred CccccCCCHHhEEECC------------------------CCCEEEccCCcee
Confidence 5899999999999986 3458888887653
No 218
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=93.61 E-value=0.068 Score=45.92 Aligned_cols=28 Identities=46% Similarity=0.579 Sum_probs=24.6
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeee
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFE 77 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfE 77 (174)
...+.|+|+.+-|||+++ ++.+++|||-
T Consensus 220 ~~GiVHGDlSefNIlV~~------------------------dg~~~vIDwP 247 (304)
T COG0478 220 RRGIVHGDLSEFNILVTE------------------------DGDIVVIDWP 247 (304)
T ss_pred HcCccccCCchheEEEec------------------------CCCEEEEeCc
Confidence 467999999999999986 4689999995
No 219
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=93.60 E-value=0.077 Score=43.01 Aligned_cols=16 Identities=31% Similarity=0.488 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 119 ~~~H~dl~p~nil~~~ 134 (283)
T cd07835 119 RVLHRDLKPQNLLIDR 134 (283)
T ss_pred CeeCCCCCHHHEEEcC
Confidence 5899999999999976
No 220
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=93.59 E-value=0.097 Score=43.23 Aligned_cols=16 Identities=38% Similarity=0.414 Sum_probs=14.2
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 128 ~ivH~Dlkp~Nil~~~ 143 (317)
T cd07867 128 WVLHRDLKPANILVMG 143 (317)
T ss_pred CEEcCCCCHHHEEEcc
Confidence 4899999999999964
No 221
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=93.58 E-value=0.092 Score=42.92 Aligned_cols=16 Identities=31% Similarity=0.524 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 148 ~ivH~dlkp~nili~~ 163 (291)
T cd06639 148 RIIHRDVKGNNILLTT 163 (291)
T ss_pred CeeccCCCHHHEEEcC
Confidence 5899999999999975
No 222
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=93.58 E-value=0.11 Score=41.29 Aligned_cols=29 Identities=34% Similarity=0.379 Sum_probs=23.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||+++. ++.++|+||..+.
T Consensus 113 ~i~h~di~p~nili~~------------------------~~~~~l~d~g~~~ 141 (251)
T cd05041 113 NCIHRDLAARNCLVGE------------------------NNVLKISDFGMSR 141 (251)
T ss_pred CEehhhcCcceEEEcC------------------------CCcEEEeeccccc
Confidence 5799999999999975 3568888886654
No 223
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=93.57 E-value=0.068 Score=41.28 Aligned_cols=32 Identities=28% Similarity=0.335 Sum_probs=26.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
.++|+|+.+.||++.+ .+.++++||..+..-.
T Consensus 107 ~i~h~~i~~~ni~~~~------------------------~~~~~l~d~~~~~~~~ 138 (244)
T smart00220 107 GIIHRDLKPENILLDE------------------------DGHVKLADFGLARQLD 138 (244)
T ss_pred CeecCCcCHHHeEECC------------------------CCcEEEccccceeeec
Confidence 6899999999999986 3578889988766543
No 224
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=93.57 E-value=0.078 Score=40.81 Aligned_cols=32 Identities=25% Similarity=0.314 Sum_probs=27.1
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
.++|+|+++.||+++. ...++++||+.+....
T Consensus 118 ~i~h~di~~~ni~v~~------------------------~~~~~l~d~g~~~~~~ 149 (225)
T smart00221 118 GIVHRDLKPENILLGM------------------------DGLVKLADFGLARFIH 149 (225)
T ss_pred CeecCCCCHHHEEEcC------------------------CCCEEEeeCceeeEec
Confidence 7899999999999986 3689999998776543
No 225
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=93.56 E-value=0.13 Score=42.05 Aligned_cols=17 Identities=35% Similarity=0.640 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 129 ~~i~H~dlkp~Nili~~ 145 (292)
T cd06644 129 MKIIHRDLKAGNVLLTL 145 (292)
T ss_pred CCeeecCCCcceEEEcC
Confidence 46889999999999975
No 226
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=93.55 E-value=0.085 Score=42.46 Aligned_cols=17 Identities=35% Similarity=0.632 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 125 ~~i~H~di~p~nili~~ 141 (266)
T cd05033 125 MNYVHRDLAARNILVNS 141 (266)
T ss_pred CCcccCCCCcceEEEcC
Confidence 35899999999999976
No 227
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly
Probab=93.53 E-value=0.1 Score=42.73 Aligned_cols=17 Identities=41% Similarity=0.532 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|++|.|||+..
T Consensus 139 ~~i~H~dlkp~Nili~~ 155 (288)
T cd05093 139 QHFVHRDLATRNCLVGE 155 (288)
T ss_pred CCeeecccCcceEEEcc
Confidence 35899999999999976
No 228
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=93.53 E-value=0.1 Score=41.49 Aligned_cols=30 Identities=30% Similarity=0.437 Sum_probs=23.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||++.||+++. .+.++|+||..+.
T Consensus 120 ~~i~h~dl~p~ni~i~~------------------------~~~~~l~d~g~~~ 149 (262)
T cd06613 120 TGKIHRDIKGANILLTE------------------------DGDVKLADFGVSA 149 (262)
T ss_pred CCceecCCChhhEEECC------------------------CCCEEECccccch
Confidence 35899999999999986 3567888887654
No 229
>KOG0596|consensus
Probab=93.53 E-value=0.11 Score=48.46 Aligned_cols=41 Identities=24% Similarity=0.276 Sum_probs=29.6
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHH
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVE 94 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E 94 (174)
-.+.|.||+|.|+|+-. +.|+||||--|. -..-|-.|...|
T Consensus 479 ~gIVHSDLKPANFLlVk-------------------------G~LKLIDFGIA~--aI~~DTTsI~kd 519 (677)
T KOG0596|consen 479 HGIVHSDLKPANFLLVK-------------------------GRLKLIDFGIAN--AIQPDTTSIVKD 519 (677)
T ss_pred hceeecCCCcccEEEEe-------------------------eeEEeeeechhc--ccCccccceeec
Confidence 45899999999999976 799999996443 233344444444
No 230
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=93.52 E-value=0.096 Score=43.07 Aligned_cols=16 Identities=38% Similarity=0.563 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 150 ~i~H~dlkp~Nili~~ 165 (296)
T cd05095 150 NFVHRDLATRNCLVGK 165 (296)
T ss_pred CeecccCChheEEEcC
Confidence 4899999999999975
No 231
>COG2187 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=93.51 E-value=1.4 Score=38.24 Aligned_cols=68 Identities=21% Similarity=0.249 Sum_probs=48.1
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeee----cccCccchhhHHHHHHHHhhhc
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFE----YCSYNYRAFDIANHFVESVYDY 99 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfE----Ya~~n~~~fDlan~f~E~~~dy 99 (174)
...++=||+||+.+||.+-+ +++.|.|.- --.+.++.+|+|-..++.-
T Consensus 206 ~g~IRecHGDLhl~ni~l~d-------------------------g~~~LFDCIEFNd~fr~iDv~~D~AFl~MDLe--- 257 (337)
T COG2187 206 EGFIRECHGDLHLRNICLWD-------------------------GEPALFDCIEFNDPFRFIDVLYDLAFLAMDLE--- 257 (337)
T ss_pred cCCceecccchhhcceeeec-------------------------CcceEEEEeecCCcchHHHHHHHHHHHHhhHh---
Confidence 46789999999999999986 677888862 2334566677776665432
Q ss_pred cCCCCCcccccCCCCCCHHHHHHHHHHHHhccC
Q psy15664 100 SYKHFPHYTVKRENYPSYSLRKSFVETYLSRMN 132 (174)
Q Consensus 100 ~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~ 132 (174)
..-.++.-..|+..|+.+.+
T Consensus 258 -------------~~gr~dla~~~ln~Yl~~tg 277 (337)
T COG2187 258 -------------FRGRKDLARRFLNTYLEETG 277 (337)
T ss_pred -------------hcCChHHHHHHHHHHHHHhC
Confidence 12245667889999997754
No 232
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=93.49 E-value=0.085 Score=45.52 Aligned_cols=30 Identities=30% Similarity=0.596 Sum_probs=25.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||+|.|||++. .+.++|+||..+.
T Consensus 120 ~givHrDlKp~Nili~~------------------------~~~~kL~DFGl~~ 149 (381)
T cd05626 120 MGFIHRDIKPDNILIDL------------------------DGHIKLTDFGLCT 149 (381)
T ss_pred CCeeecCCcHHHEEECC------------------------CCCEEEeeCcCCc
Confidence 35899999999999975 4679999998763
No 233
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=93.49 E-value=0.084 Score=42.23 Aligned_cols=30 Identities=33% Similarity=0.439 Sum_probs=24.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+|+++.||++.. +..++++||+++..
T Consensus 120 ~i~H~dl~p~ni~i~~------------------------~~~~kl~d~g~~~~ 149 (256)
T cd05114 120 SFIHRDLAARNCLVSS------------------------TGVVKVSDFGMTRY 149 (256)
T ss_pred CccccccCcceEEEcC------------------------CCeEEECCCCCccc
Confidence 4899999999999975 35688888887653
No 234
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=93.49 E-value=0.11 Score=42.33 Aligned_cols=16 Identities=31% Similarity=0.571 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.|||+..
T Consensus 129 ~iiH~dlkp~nili~~ 144 (279)
T cd05111 129 RMVHRNLAARNILLKS 144 (279)
T ss_pred CEeccccCcceEEEcC
Confidence 3899999999999975
No 235
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=93.45 E-value=0.079 Score=42.34 Aligned_cols=30 Identities=27% Similarity=0.440 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+||++.||+++. ++.++++||+.+..
T Consensus 120 ~i~h~dl~~~nil~~~------------------------~~~~~l~d~~~~~~ 149 (258)
T cd05578 120 GIIHRDIKPDNILLDE------------------------QGHVHITDFNIATK 149 (258)
T ss_pred CeeccCCCHHHeEEcC------------------------CCCEEEeecccccc
Confidence 5899999999999976 46788899887654
No 236
>KOG0603|consensus
Probab=93.42 E-value=0.12 Score=48.33 Aligned_cols=36 Identities=31% Similarity=0.349 Sum_probs=29.1
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA 85 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~ 85 (174)
..+.|+||+|+|||+.+ +.+.|+++||=++....+.
T Consensus 434 ~gvvhRDLkp~NIL~~~-----------------------~~g~lrltyFG~a~~~~~~ 469 (612)
T KOG0603|consen 434 QGVVHRDLKPGNILLDG-----------------------SAGHLRLTYFGFWSELERS 469 (612)
T ss_pred cCeeecCCChhheeecC-----------------------CCCcEEEEEechhhhCchh
Confidence 56889999999999963 2467999999888776665
No 237
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=93.42 E-value=0.091 Score=42.24 Aligned_cols=16 Identities=31% Similarity=0.528 Sum_probs=14.3
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 126 ~i~H~dl~p~nil~~~ 141 (265)
T cd06652 126 MIVHRDIKGANILRDS 141 (265)
T ss_pred CEecCCCCHHHEEecC
Confidence 3789999999999975
No 238
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=93.41 E-value=0.11 Score=41.28 Aligned_cols=17 Identities=24% Similarity=0.335 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.|||+..
T Consensus 120 ~~i~H~dlkp~Nill~~ 136 (259)
T cd05037 120 KKLVHGNVCGKNILVAR 136 (259)
T ss_pred CCeecccCccceEEEec
Confidence 35899999999999986
No 239
>KOG3087|consensus
Probab=93.37 E-value=0.37 Score=39.64 Aligned_cols=83 Identities=29% Similarity=0.370 Sum_probs=49.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc----cchhhHHHHHHHHhhhccCCC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN----YRAFDIANHFVESVYDYSYKH 103 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n----~~~fDlan~f~E~~~dy~~~~ 103 (174)
-+||+||-..|||+..+. ++-.+.+|||=.+..+ +.+.|| +..|-+.-.++++
T Consensus 133 diiHGDLTTSNill~~~~---------------------~~~~~~lIdfgls~~s~~~EDKgVDL--YVlErA~lsTh~~ 189 (229)
T KOG3087|consen 133 DIIHGDLTTSNILLRSDG---------------------NQITPILIDFGLSSVSRLPEDKGVDL--YVLERAVLSTHDK 189 (229)
T ss_pred CeecccccccceEEecCC---------------------CcCceEEEeecchhcccCccccccee--eeehHhHhccCcc
Confidence 599999999999998632 2244699999887665 445555 2223332222211
Q ss_pred CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHH
Q psy15664 104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVK 146 (174)
Q Consensus 104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~ 146 (174)
.......|+..|-..-++ ...|.+=+++|+
T Consensus 190 ------------~~~~fe~~~~~Y~~~~K~-~~avlkk~eeVR 219 (229)
T KOG3087|consen 190 ------------KALLFEGFLEGYRASGKQ-SKAVLKKLEEVR 219 (229)
T ss_pred ------------cHHHHHHHHHHHHhcchh-hHHHHHHHHHHh
Confidence 233568899999844332 234444455554
No 240
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=93.36 E-value=0.11 Score=42.04 Aligned_cols=16 Identities=44% Similarity=0.598 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 144 ~i~H~dlkp~Nil~~~ 159 (283)
T cd05048 144 HFVHRDLAARNCLVGE 159 (283)
T ss_pred CeeccccccceEEEcC
Confidence 4899999999999976
No 241
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=93.34 E-value=0.085 Score=44.41 Aligned_cols=17 Identities=18% Similarity=0.237 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|+++.|||++.
T Consensus 120 ~~ivHrDikp~Nill~~ 136 (323)
T cd05615 120 RGIIYRDLKLDNVMLDS 136 (323)
T ss_pred CCeeccCCCHHHeEECC
Confidence 35899999999999976
No 242
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=93.33 E-value=0.091 Score=41.60 Aligned_cols=31 Identities=32% Similarity=0.398 Sum_probs=25.0
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+|+++.||++.. ++.++++||..+..
T Consensus 112 ~~i~H~di~~~nil~~~------------------------~~~~~l~dfg~~~~ 142 (265)
T cd05579 112 NGIIHRDLKPDNILIDS------------------------NGHLKLTDFGLSKV 142 (265)
T ss_pred cCeecCCCCHHHeEEcC------------------------CCCEEEEecccchh
Confidence 45899999999999986 35788899876543
No 243
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=93.32 E-value=0.091 Score=43.49 Aligned_cols=29 Identities=24% Similarity=0.381 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. .+.++++||..+.
T Consensus 121 ~i~H~dl~p~NIll~~------------------------~~~~~l~dfg~~~ 149 (305)
T cd05609 121 GIVHRDLKPDNLLITS------------------------MGHIKLTDFGLSK 149 (305)
T ss_pred CccccCCchHHEEECC------------------------CCCEEEeeCCCcc
Confidence 5899999999999975 3567888887654
No 244
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=93.32 E-value=0.13 Score=41.40 Aligned_cols=30 Identities=27% Similarity=0.332 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+||++.||++.. .+.++|+||.++..
T Consensus 118 ~i~H~dl~p~nili~~------------------------~~~~~l~df~~~~~ 147 (283)
T cd05118 118 GILHRDLKPENLLINT------------------------EGVLKLADFGLARS 147 (283)
T ss_pred CeeecCcCHHHEEECC------------------------CCcEEEeeeeeeEe
Confidence 4899999999999975 36789999987643
No 245
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=93.32 E-value=0.047 Score=50.36 Aligned_cols=31 Identities=35% Similarity=0.540 Sum_probs=26.0
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
-.|-|.|+|||||++.. ++++.++||=-.|.
T Consensus 284 dgffHaDpHpGNi~v~~------------------------~g~i~~lDfGi~g~ 314 (517)
T COG0661 284 DGFFHADPHPGNILVRS------------------------DGRIVLLDFGIVGR 314 (517)
T ss_pred cCccccCCCccceEEec------------------------CCcEEEEcCcceec
Confidence 46999999999999986 47899999965554
No 246
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=93.30 E-value=0.09 Score=45.38 Aligned_cols=16 Identities=31% Similarity=0.623 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||++.
T Consensus 162 ~ivHrDLkp~NILl~~ 177 (370)
T cd05596 162 GFIHRDVKPDNMLLDK 177 (370)
T ss_pred CeeccCCCHHHEEEcC
Confidence 4899999999999975
No 247
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=93.29 E-value=0.078 Score=43.87 Aligned_cols=16 Identities=31% Similarity=0.538 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||++..
T Consensus 128 ~i~H~dl~p~nil~~~ 143 (309)
T cd07845 128 FIIHRDLKVSNLLLTD 143 (309)
T ss_pred CeecCCCCHHHEEECC
Confidence 4899999999999976
No 248
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=93.29 E-value=0.12 Score=42.06 Aligned_cols=16 Identities=31% Similarity=0.490 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 130 ~i~H~dl~~~nil~~~ 145 (295)
T cd07837 130 GVMHRDLKPQNLLVDK 145 (295)
T ss_pred CeeecCCChHHEEEec
Confidence 5899999999999975
No 249
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=93.28 E-value=0.093 Score=41.79 Aligned_cols=31 Identities=19% Similarity=0.210 Sum_probs=24.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+|+++.||++.. .+.++++||..+..
T Consensus 120 ~~i~h~dl~p~ni~~~~------------------------~~~~kl~d~~~~~~ 150 (256)
T cd08221 120 AGILHRDIKTLNIFLTK------------------------AGLIKLGDFGISKI 150 (256)
T ss_pred CCccccCCChHhEEEeC------------------------CCCEEECcCcceEE
Confidence 34789999999999986 35678888876543
No 250
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=93.27 E-value=0.16 Score=41.46 Aligned_cols=17 Identities=18% Similarity=0.427 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|+++.||++..
T Consensus 114 ~~ivH~dikp~Nili~~ 130 (277)
T cd05607 114 MDIVYRDMKPENVLLDD 130 (277)
T ss_pred CCEEEccCChHhEEEcC
Confidence 35899999999999976
No 251
>PHA03211 serine/threonine kinase US3; Provisional
Probab=93.26 E-value=0.093 Score=47.39 Aligned_cols=16 Identities=25% Similarity=0.470 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||+..
T Consensus 280 gIvHrDLKP~NILl~~ 295 (461)
T PHA03211 280 GIIHRDIKTENVLVNG 295 (461)
T ss_pred CEEECcCCHHHEEECC
Confidence 4889999999999975
No 252
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological
Probab=93.23 E-value=0.12 Score=41.56 Aligned_cols=17 Identities=35% Similarity=0.522 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|++|.||+++.
T Consensus 138 ~~i~H~di~p~nill~~ 154 (277)
T cd05032 138 KKFVHRDLAARNCMVAE 154 (277)
T ss_pred CCccccccChheEEEcC
Confidence 35799999999999986
No 253
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes
Probab=93.23 E-value=0.091 Score=42.76 Aligned_cols=16 Identities=25% Similarity=0.524 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||++..
T Consensus 120 ~i~H~dlkp~Nill~~ 135 (287)
T cd07848 120 DIVHRDIKPENLLISH 135 (287)
T ss_pred CeecCCCCHHHEEEcC
Confidence 4799999999999975
No 254
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=93.21 E-value=0.092 Score=42.86 Aligned_cols=16 Identities=38% Similarity=0.563 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.||++..
T Consensus 150 ~i~H~dlkp~Nili~~ 165 (296)
T cd05051 150 NFVHRDLATRNCLVGK 165 (296)
T ss_pred CccccccchhceeecC
Confidence 4789999999999986
No 255
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including
Probab=93.21 E-value=0.12 Score=42.54 Aligned_cols=17 Identities=35% Similarity=0.559 Sum_probs=14.8
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|++|.|||++.
T Consensus 148 ~~i~H~dlkp~Nill~~ 164 (295)
T cd05097 148 LNFVHRDLATRNCLVGN 164 (295)
T ss_pred cCeeccccChhhEEEcC
Confidence 35789999999999975
No 256
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=93.20 E-value=0.13 Score=41.41 Aligned_cols=16 Identities=38% Similarity=0.648 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+||++.|||+..
T Consensus 115 ~i~H~dlkp~nil~~~ 130 (257)
T cd05115 115 NFVHRDLAARNVLLVN 130 (257)
T ss_pred CeeecccchheEEEcC
Confidence 5899999999999975
No 257
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5,
Probab=93.20 E-value=0.094 Score=43.05 Aligned_cols=16 Identities=31% Similarity=0.459 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 122 ~ivH~dlkp~Nil~~~ 137 (285)
T cd05605 122 RIVYRDLKPENILLDD 137 (285)
T ss_pred CcEecCCCHHHEEECC
Confidence 5899999999999976
No 258
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=93.14 E-value=0.11 Score=41.51 Aligned_cols=29 Identities=34% Similarity=0.417 Sum_probs=23.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. .+.++++||..+.
T Consensus 120 ~i~H~dl~p~ni~i~~------------------------~~~~kl~dfg~~~ 148 (256)
T cd05059 120 GFIHRDLAARNCLVGE------------------------DNVVKVSDFGLAR 148 (256)
T ss_pred CcccccccHhhEEECC------------------------CCcEEECCcccce
Confidence 4799999999999976 3567888887654
No 259
>KOG1163|consensus
Probab=93.14 E-value=0.11 Score=44.27 Aligned_cols=32 Identities=28% Similarity=0.426 Sum_probs=25.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
..|.|+|++|.|+|..-+-. ..++.+|||-.|
T Consensus 130 r~fiHRDIKPdNFLMGlgrh---------------------~~kl~LIDFGLa 161 (341)
T KOG1163|consen 130 RNFIHRDIKPDNFLMGLGRH---------------------CNKLYLIDFGLA 161 (341)
T ss_pred hccccccCCccceeeccccc---------------------cceEEEEeccch
Confidence 47999999999999875322 368999999654
No 260
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=93.13 E-value=0.16 Score=41.29 Aligned_cols=30 Identities=23% Similarity=0.391 Sum_probs=24.0
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||++.. .+.++++||..+.
T Consensus 120 ~~i~h~dl~p~Ni~i~~------------------------~~~~~l~dfg~~~ 149 (277)
T cd06641 120 EKKIHRDIKAANVLLSE------------------------HGEVKLADFGVAG 149 (277)
T ss_pred CCeecCCCCHHhEEECC------------------------CCCEEEeecccce
Confidence 46899999999999975 3568888887653
No 261
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis. Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=93.12 E-value=0.12 Score=41.38 Aligned_cols=30 Identities=13% Similarity=0.163 Sum_probs=23.8
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||++.||++.. .+.+.++||..+.
T Consensus 125 ~~i~H~dl~~~nil~~~------------------------~~~~~l~d~g~~~ 154 (267)
T cd08228 125 RRVMHRDIKPANVFITA------------------------TGVVKLGDLGLGR 154 (267)
T ss_pred CCeeCCCCCHHHEEEcC------------------------CCCEEECccccce
Confidence 35899999999999975 3567888887654
No 262
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=93.11 E-value=0.13 Score=43.70 Aligned_cols=16 Identities=44% Similarity=0.567 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 193 ~ivHrDikp~Nill~~ 208 (337)
T cd05054 193 KCIHRDLAARNILLSE 208 (337)
T ss_pred CeecCCCCcceEEEeC
Confidence 5899999999999985
No 263
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=93.10 E-value=0.12 Score=41.30 Aligned_cols=16 Identities=44% Similarity=0.709 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.||++..
T Consensus 133 ~i~H~dlkp~Nil~~~ 148 (273)
T cd05035 133 NFIHRDLAARNCMLRE 148 (273)
T ss_pred CeeccccchheEEECC
Confidence 5799999999999975
No 264
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=93.07 E-value=0.11 Score=41.60 Aligned_cols=34 Identities=26% Similarity=0.337 Sum_probs=24.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||+++.+... ....++++||.++.
T Consensus 126 ~i~H~dl~p~nil~~~~~~~-------------------~~~~~~l~dfg~~~ 159 (269)
T cd05044 126 HFIHRDLAARNCLVSEKGYD-------------------ADRVVKIGDFGLAR 159 (269)
T ss_pred CcccCCCChheEEEecCCCC-------------------CCcceEECCccccc
Confidence 47999999999999863211 12368888987764
No 265
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding
Probab=93.06 E-value=0.077 Score=43.88 Aligned_cols=16 Identities=31% Similarity=0.488 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||++.
T Consensus 136 gi~H~dLkp~Nill~~ 151 (296)
T cd06654 136 QVIHRDIKSDNILLGM 151 (296)
T ss_pred CcccCCCCHHHEEEcC
Confidence 4899999999999975
No 266
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=93.06 E-value=0.12 Score=42.33 Aligned_cols=17 Identities=24% Similarity=0.411 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 134 ~~i~H~dl~p~Nil~~~ 150 (285)
T cd06648 134 QGVIHRDIKSDSILLTS 150 (285)
T ss_pred CCeecCCCChhhEEEcC
Confidence 35899999999999975
No 267
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=93.06 E-value=0.12 Score=41.48 Aligned_cols=31 Identities=23% Similarity=0.327 Sum_probs=24.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+|+++.||++.. ++.++|+||..+..
T Consensus 112 ~~~~h~dl~~~nilv~~------------------------~~~~~l~df~~~~~ 142 (262)
T cd05572 112 RGIIYRDLKPENLLLDS------------------------NGYVKLVDFGFAKK 142 (262)
T ss_pred CCcccCCCCHHHEEEcC------------------------CCCEEEeeCCcccc
Confidence 45899999999999975 35678888777653
No 268
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=93.05 E-value=0.14 Score=41.72 Aligned_cols=30 Identities=27% Similarity=0.614 Sum_probs=23.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++..+ .+.++++||..+.
T Consensus 129 ~i~H~dl~p~nil~~~~-----------------------~~~~~l~dfg~~~ 158 (267)
T PHA03390 129 NIIHNDIKLENVLYDRA-----------------------KDRIYLCDYGLCK 158 (267)
T ss_pred CeeeCCCCHHHEEEeCC-----------------------CCeEEEecCccce
Confidence 48999999999999862 2368889987653
No 269
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their
Probab=93.04 E-value=0.11 Score=41.66 Aligned_cols=16 Identities=25% Similarity=0.495 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 123 ~i~H~~i~~~nil~~~ 138 (268)
T cd06630 123 QIIHRDVKGANLLIDS 138 (268)
T ss_pred CeecCCCCHHHEEEcC
Confidence 5899999999999965
No 270
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with
Probab=93.04 E-value=0.11 Score=41.26 Aligned_cols=17 Identities=35% Similarity=0.483 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 120 ~~i~h~dl~~~nil~~~ 136 (256)
T cd08220 120 KLILHRDLKTQNILLDK 136 (256)
T ss_pred CCeecCCCCHHHEEEcC
Confidence 35899999999999975
No 271
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=93.02 E-value=0.099 Score=42.34 Aligned_cols=16 Identities=31% Similarity=0.499 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 121 ~i~H~dl~p~nil~~~ 136 (285)
T cd07861 121 RVLHRDLKPQNLLIDN 136 (285)
T ss_pred CeeecCCCHHHEEEcC
Confidence 5899999999999975
No 272
>PHA03210 serine/threonine kinase US3; Provisional
Probab=93.02 E-value=0.12 Score=46.90 Aligned_cols=28 Identities=25% Similarity=0.370 Sum_probs=23.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.++|+||++.|||++. ++.++|+||-.+
T Consensus 287 gIiHrDLKP~NILl~~------------------------~~~vkL~DFGla 314 (501)
T PHA03210 287 KLIHRDIKLENIFLNC------------------------DGKIVLGDFGTA 314 (501)
T ss_pred CeecCCCCHHHEEECC------------------------CCCEEEEeCCCc
Confidence 5899999999999975 356888888665
No 273
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=93.00 E-value=0.12 Score=41.76 Aligned_cols=17 Identities=29% Similarity=0.427 Sum_probs=14.6
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|+++.||++..
T Consensus 119 ~~i~H~dl~p~nil~~~ 135 (286)
T cd07847 119 HNCIHRDVKPENILITK 135 (286)
T ss_pred CCceecCCChhhEEEcC
Confidence 34689999999999975
No 274
>COG3231 Aph Aminoglycoside phosphotransferase [Translation, ribosomal structure and biogenesis]
Probab=92.98 E-value=0.31 Score=40.98 Aligned_cols=66 Identities=15% Similarity=0.072 Sum_probs=51.0
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF 104 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~ 104 (174)
..+|+||+|--.-|+|+.+ ..---+||+.-.|-++|.-|||--.-...++
T Consensus 183 edLVv~HGDACLPN~i~d~------------------------~rf~GfIDlGrlGVaDRh~DLala~~s~~~n------ 232 (266)
T COG3231 183 EDLVVTHGDACLPNFILDG------------------------WRFSGFIDLGRLGVADRHQDLALATWSLRFN------ 232 (266)
T ss_pred hhceeecCcccCcceEecC------------------------CceEEeeecCcccchHHHHhHHHHHHHHHhc------
Confidence 4689999999999999986 2345699999999999999998765443321
Q ss_pred CcccccCCCCCCHHHHHHHHHHHHh
Q psy15664 105 PHYTVKRENYPSYSLRKSFVETYLS 129 (174)
Q Consensus 105 p~~~~~~~~~p~~~~~~~fl~~Yl~ 129 (174)
++...-...|+..|..
T Consensus 233 ---------l~g~~~~~~fl~~Yg~ 248 (266)
T COG3231 233 ---------LGGDVWDDPFLDAYGR 248 (266)
T ss_pred ---------cCcchhhHHHHHHhCc
Confidence 2345556789999984
No 275
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=92.98 E-value=0.12 Score=42.02 Aligned_cols=16 Identities=38% Similarity=0.623 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 128 ~i~H~dlkp~nili~~ 143 (284)
T cd05081 128 RYVHRDLATRNILVES 143 (284)
T ss_pred CceeccCCHhhEEECC
Confidence 5899999999999975
No 276
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=92.98 E-value=0.12 Score=41.94 Aligned_cols=29 Identities=24% Similarity=0.429 Sum_probs=23.9
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||+++. ++.++|+||..+.
T Consensus 120 ~i~h~~l~p~ni~~~~------------------------~~~~~l~dfg~~~ 148 (286)
T cd07846 120 NIIHRDIKPENILVSQ------------------------SGVVKLCDFGFAR 148 (286)
T ss_pred CccccCCCHHHEEECC------------------------CCcEEEEeeeeee
Confidence 5899999999999975 3568888887654
No 277
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=92.97 E-value=0.14 Score=41.22 Aligned_cols=17 Identities=29% Similarity=0.540 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.|||+..
T Consensus 126 ~~~~H~dl~p~nili~~ 142 (270)
T cd05056 126 KRFVHRDIAARNVLVSS 142 (270)
T ss_pred CCeeccccChheEEEec
Confidence 35899999999999976
No 278
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding
Probab=92.96 E-value=0.088 Score=43.61 Aligned_cols=16 Identities=25% Similarity=0.470 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||+++.
T Consensus 135 ~i~H~dL~p~Nili~~ 150 (296)
T cd06655 135 QVIHRDIKSDNVLLGM 150 (296)
T ss_pred CcccCCCCHHHEEECC
Confidence 4789999999999975
No 279
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning
Probab=92.93 E-value=0.13 Score=41.51 Aligned_cols=30 Identities=30% Similarity=0.435 Sum_probs=24.8
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+|+++.||++.. +..++|+||..+..
T Consensus 120 ~i~H~dl~~~ni~~~~------------------------~~~~kl~d~g~~~~ 149 (288)
T cd07833 120 NIIHRDIKPENILVSE------------------------SGVLKLCDFGFARA 149 (288)
T ss_pred CeecCCCCHHHeEECC------------------------CCCEEEEeeecccc
Confidence 4899999999999986 36788899887654
No 280
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=92.91 E-value=0.16 Score=41.46 Aligned_cols=16 Identities=31% Similarity=0.488 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 122 ~i~H~dl~p~nill~~ 137 (294)
T PLN00009 122 RVLHRDLKPQNLLIDR 137 (294)
T ss_pred CeeCCCCCcceEEEEC
Confidence 4899999999999975
No 281
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=92.89 E-value=0.11 Score=42.96 Aligned_cols=28 Identities=25% Similarity=0.577 Sum_probs=22.9
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.+.|+|+++.||++.+ ++.++|+||..+
T Consensus 138 ~ivH~dlkp~Nill~~------------------------~~~~kL~dfg~~ 165 (292)
T cd06658 138 GVIHRDIKSDSILLTS------------------------DGRIKLSDFGFC 165 (292)
T ss_pred CEeecCCCHHHEEEcC------------------------CCCEEEccCcch
Confidence 4789999999999975 356888888765
No 282
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=92.89 E-value=0.12 Score=41.37 Aligned_cols=16 Identities=38% Similarity=0.723 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.||++..
T Consensus 123 ~i~H~dl~p~nili~~ 138 (261)
T cd05072 123 NYIHRDLRAANVLVSE 138 (261)
T ss_pred CeeccccchhhEEecC
Confidence 4799999999999986
No 283
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=92.89 E-value=0.1 Score=44.34 Aligned_cols=16 Identities=31% Similarity=0.555 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 138 gi~H~dlkp~Nil~~~ 153 (353)
T cd07850 138 GIIHRDLKPSNIVVKS 153 (353)
T ss_pred CeeeCCCCHHHEEECC
Confidence 5899999999999976
No 284
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=92.87 E-value=0.14 Score=41.11 Aligned_cols=16 Identities=38% Similarity=0.617 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.||++..
T Consensus 133 ~i~H~dikp~nili~~ 148 (273)
T cd05074 133 NFIHRDLAARNCMLNE 148 (273)
T ss_pred CEeecccchhhEEEcC
Confidence 5899999999999975
No 285
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment.
Probab=92.85 E-value=0.12 Score=41.84 Aligned_cols=16 Identities=31% Similarity=0.517 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 120 ~i~h~dl~p~ni~~~~ 135 (284)
T cd07836 120 RVLHRDLKPQNLLINK 135 (284)
T ss_pred CeeeCCCCHHHEEECC
Confidence 5899999999999975
No 286
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=92.85 E-value=0.11 Score=42.38 Aligned_cols=17 Identities=41% Similarity=0.530 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 149 ~~i~H~dl~p~nil~~~ 165 (288)
T cd05050 149 RKFVHRDLATRNCLVGE 165 (288)
T ss_pred CCeecccccHhheEecC
Confidence 36999999999999975
No 287
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=92.82 E-value=0.092 Score=43.49 Aligned_cols=17 Identities=35% Similarity=0.462 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 159 ~gi~H~dlkp~Nill~~ 175 (307)
T cd05098 159 KKCIHRDLAARNVLVTE 175 (307)
T ss_pred CCcccccccHHheEEcC
Confidence 36899999999999975
No 288
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in
Probab=92.78 E-value=0.12 Score=43.37 Aligned_cols=16 Identities=31% Similarity=0.353 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 116 ~ivHrdikp~Nil~~~ 131 (316)
T cd05619 116 GIVYRDLKLDNILLDT 131 (316)
T ss_pred CeEeCCCCHHHEEECC
Confidence 5899999999999976
No 289
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=92.78 E-value=0.19 Score=42.68 Aligned_cols=30 Identities=33% Similarity=0.408 Sum_probs=24.2
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..+.|+|++|.|||+.. ...++++||..+.
T Consensus 198 ~~i~H~dikp~Nil~~~------------------------~~~~kl~dfg~~~ 227 (343)
T cd05103 198 RKCIHRDLAARNILLSE------------------------NNVVKICDFGLAR 227 (343)
T ss_pred CCeecCCCccCeEEEcC------------------------CCcEEEEeccccc
Confidence 36899999999999975 3568888887654
No 290
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=92.75 E-value=0.17 Score=41.07 Aligned_cols=29 Identities=34% Similarity=0.604 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.+.|+||++.|||+.. .+.++++||..+.
T Consensus 123 ~i~H~dlkp~nili~~------------------------~~~~kl~dfg~~~ 151 (282)
T cd06643 123 KIIHRDLKAGNILFTL------------------------DGDIKLADFGVSA 151 (282)
T ss_pred CeeecCCCcccEEEcc------------------------CCCEEEccccccc
Confidence 5899999999999975 3568888887654
No 291
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated
Probab=92.74 E-value=0.11 Score=41.67 Aligned_cols=16 Identities=31% Similarity=0.501 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||++..
T Consensus 126 ~i~H~dlkp~nili~~ 141 (267)
T cd06645 126 GKMHRDIKGANILLTD 141 (267)
T ss_pred CeecCCCCHHHEEECC
Confidence 4899999999999975
No 292
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=92.73 E-value=0.17 Score=41.11 Aligned_cols=16 Identities=31% Similarity=0.453 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 136 ~ivH~dlkp~nil~~~ 151 (277)
T cd05036 136 HFIHRDIAARNCLLTC 151 (277)
T ss_pred CEeecccchheEEEec
Confidence 4899999999999976
No 293
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=92.73 E-value=0.19 Score=40.42 Aligned_cols=16 Identities=25% Similarity=0.534 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 128 ~i~h~dl~p~nil~~~ 143 (268)
T cd06624 128 QIVHRDIKGDNVLVNT 143 (268)
T ss_pred CEeecCCCHHHEEEcC
Confidence 5899999999999975
No 294
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=92.72 E-value=0.2 Score=40.40 Aligned_cols=16 Identities=38% Similarity=0.511 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 120 ~i~H~dlkp~nil~~~ 135 (269)
T cd05087 120 NFIHSDLALRNCLLTA 135 (269)
T ss_pred CEeccccCcceEEEcC
Confidence 5899999999999976
No 295
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the
Probab=92.71 E-value=0.11 Score=42.28 Aligned_cols=16 Identities=38% Similarity=0.557 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 123 ~i~H~dl~p~nil~~~ 138 (291)
T cd07844 123 RVLHRDLKPQNLLISE 138 (291)
T ss_pred CeecccCCHHHEEEcC
Confidence 4899999999999976
No 296
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=92.69 E-value=0.18 Score=43.66 Aligned_cols=16 Identities=25% Similarity=0.493 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||+++
T Consensus 232 giiHrDLkp~Nil~~~ 247 (374)
T cd05106 232 NCIHRDVAARNVLLTD 247 (374)
T ss_pred CEEeccCchheEEEeC
Confidence 4799999999999975
No 297
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=92.67 E-value=0.16 Score=40.70 Aligned_cols=17 Identities=41% Similarity=0.665 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 121 ~~i~H~dl~p~ni~i~~ 137 (260)
T cd05067 121 KNYIHRDLRAANILVSE 137 (260)
T ss_pred CCeecccccHHhEEEcC
Confidence 35799999999999986
No 298
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=92.66 E-value=0.14 Score=41.58 Aligned_cols=16 Identities=50% Similarity=0.683 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 144 ~i~H~dlkp~nili~~ 159 (283)
T cd05090 144 FFVHKDLAARNILIGE 159 (283)
T ss_pred CeehhccccceEEEcC
Confidence 4899999999999976
No 299
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of
Probab=92.63 E-value=0.11 Score=42.28 Aligned_cols=16 Identities=25% Similarity=0.441 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 115 ~i~H~di~p~Nil~~~ 130 (277)
T cd05577 115 RIVYRDLKPENVLLDD 130 (277)
T ss_pred CcccCCCCHHHEEECC
Confidence 5789999999999976
No 300
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored
Probab=92.61 E-value=0.14 Score=41.18 Aligned_cols=16 Identities=38% Similarity=0.638 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 127 ~i~H~dlkp~Nili~~ 142 (268)
T cd05063 127 NYVHRDLAARNILVNS 142 (268)
T ss_pred CeeccccchhhEEEcC
Confidence 4899999999999975
No 301
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated
Probab=92.60 E-value=0.13 Score=41.34 Aligned_cols=16 Identities=31% Similarity=0.501 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++++||++..
T Consensus 126 ~i~H~dl~p~nill~~ 141 (267)
T cd06646 126 GKMHRDIKGANILLTD 141 (267)
T ss_pred CccccCCCHHHEEECC
Confidence 5899999999999975
No 302
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=92.58 E-value=0.1 Score=41.99 Aligned_cols=29 Identities=28% Similarity=0.559 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||+++. .+.++++||..+.
T Consensus 131 ~ivh~dl~~~nili~~------------------------~~~~~l~Dfg~~~ 159 (272)
T cd06637 131 KVIHRDIKGQNVLLTE------------------------NAEVKLVDFGVSA 159 (272)
T ss_pred CCccCCCCHHHEEECC------------------------CCCEEEccCCCce
Confidence 4899999999999986 3567888887654
No 303
>KOG0588|consensus
Probab=92.58 E-value=0.092 Score=49.80 Aligned_cols=49 Identities=22% Similarity=0.430 Sum_probs=35.9
Q ss_pred HHHHHHHHHHhhc--CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 11 TEADWLKKHLLKI--KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 11 ~e~~~l~~~l~~~--~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
+.+.++++.+... -...-+||+||++.|+|++. ++.|++=||-.|+.-.
T Consensus 113 eaa~ff~QIi~gv~yCH~~~icHRDLKpENlLLd~------------------------~~nIKIADFGMAsLe~ 163 (786)
T KOG0588|consen 113 EAAHFFRQILDGVSYCHAFNICHRDLKPENLLLDV------------------------KNNIKIADFGMASLEV 163 (786)
T ss_pred HHHHHHHHHHHHHHHHhhhcceeccCCchhhhhhc------------------------ccCEeeeccceeeccc
Confidence 4566677776532 24567999999999999987 3559999997666533
No 304
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=92.57 E-value=0.11 Score=42.42 Aligned_cols=16 Identities=31% Similarity=0.573 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 139 ~i~H~dl~p~nil~~~ 154 (310)
T cd07865 139 KILHRDMKAANILITK 154 (310)
T ss_pred CeeccCCCHHHEEECC
Confidence 5899999999999976
No 305
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=92.56 E-value=0.14 Score=41.08 Aligned_cols=17 Identities=35% Similarity=0.589 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 121 ~~i~H~dl~p~ni~i~~ 137 (260)
T cd05073 121 RNYIHRDLRAANILVSA 137 (260)
T ss_pred CCccccccCcceEEEcC
Confidence 35799999999999976
No 306
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1
Probab=92.55 E-value=0.14 Score=40.79 Aligned_cols=30 Identities=30% Similarity=0.455 Sum_probs=24.3
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+||++.||++++ ++.++|+||.++.
T Consensus 121 ~~i~h~~l~p~ni~~~~------------------------~~~~~l~df~~~~ 150 (267)
T cd06610 121 NGQIHRDIKAGNILLGE------------------------DGSVKIADFGVSA 150 (267)
T ss_pred CCeecCCCCHHhEEEcC------------------------CCCEEEcccchHH
Confidence 35899999999999986 3568888887654
No 307
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=92.55 E-value=0.18 Score=41.77 Aligned_cols=16 Identities=31% Similarity=0.590 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.|||+..
T Consensus 129 ~ivH~dikp~Nill~~ 144 (303)
T cd05110 129 RLVHRDLAARNVLVKS 144 (303)
T ss_pred CeeccccccceeeecC
Confidence 5799999999999975
No 308
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=92.55 E-value=0.18 Score=41.65 Aligned_cols=16 Identities=25% Similarity=0.490 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 121 ~ivH~dlk~~Nili~~ 136 (314)
T cd08216 121 GFIHRSVKASHILLSG 136 (314)
T ss_pred CeecCCCCcceEEEec
Confidence 4899999999999986
No 309
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=92.53 E-value=0.13 Score=43.09 Aligned_cols=17 Identities=24% Similarity=0.260 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+||++.|||++.
T Consensus 115 ~~ivH~dlkp~Nill~~ 131 (318)
T cd05570 115 RGIIYRDLKLDNVLLDS 131 (318)
T ss_pred CCeEccCCCHHHeEECC
Confidence 35899999999999976
No 310
>KOG0608|consensus
Probab=92.52 E-value=0.18 Score=48.13 Aligned_cols=32 Identities=28% Similarity=0.584 Sum_probs=28.1
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++.|.|+|+++.|||++. ++-|+|-||-.|.
T Consensus 746 HkmGFIHRDiKPDNILIDr------------------------dGHIKLTDFGLCT 777 (1034)
T KOG0608|consen 746 HKMGFIHRDIKPDNILIDR------------------------DGHIKLTDFGLCT 777 (1034)
T ss_pred HhccceecccCccceEEcc------------------------CCceeeeeccccc
Confidence 3578999999999999986 5789999998885
No 311
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=92.50 E-value=0.13 Score=42.10 Aligned_cols=17 Identities=35% Similarity=0.595 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|++|.|||+.+
T Consensus 146 ~~ivH~dikp~nill~~ 162 (290)
T cd05045 146 MKLVHRDLAARNVLVAE 162 (290)
T ss_pred CCeehhhhhhheEEEcC
Confidence 35899999999999976
No 312
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=92.50 E-value=0.14 Score=40.91 Aligned_cols=30 Identities=27% Similarity=0.500 Sum_probs=24.1
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||+++. ++.++|+||..+.
T Consensus 132 ~~i~H~~l~p~ni~~~~------------------------~~~~~l~d~~~~~ 161 (275)
T cd06608 132 NKVIHRDIKGQNILLTK------------------------NAEVKLVDFGVSA 161 (275)
T ss_pred CCcccCCCCHHHEEEcc------------------------CCeEEECCCccce
Confidence 35899999999999986 3568888887654
No 313
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=92.44 E-value=0.19 Score=41.98 Aligned_cols=16 Identities=44% Similarity=0.794 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 141 gi~H~dl~p~nili~~ 156 (313)
T cd06633 141 NMIHRDIKAGNILLTE 156 (313)
T ss_pred CeecCCCChhhEEECC
Confidence 4899999999999975
No 314
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=92.42 E-value=0.13 Score=42.66 Aligned_cols=29 Identities=24% Similarity=0.560 Sum_probs=23.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||+++. .+.+.++||..+.
T Consensus 136 givH~dl~p~Nilv~~------------------------~~~~~l~dfg~~~ 164 (292)
T cd06657 136 GVIHRDIKSDSILLTH------------------------DGRVKLSDFGFCA 164 (292)
T ss_pred CeecCCCCHHHEEECC------------------------CCCEEEcccccce
Confidence 4899999999999975 3568888887653
No 315
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=92.40 E-value=0.19 Score=40.01 Aligned_cols=29 Identities=24% Similarity=0.335 Sum_probs=23.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.+.|+|+++.||++.. ++.++|+||..+.
T Consensus 124 ~i~H~dl~p~nilv~~------------------------~~~~~l~dfg~~~ 152 (263)
T cd06625 124 MIVHRDIKGANILRDS------------------------AGNVKLGDFGASK 152 (263)
T ss_pred CeecCCCCHHHEEEcC------------------------CCCEEEeecccce
Confidence 5789999999999975 3568888887653
No 316
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=92.39 E-value=0.15 Score=48.12 Aligned_cols=30 Identities=23% Similarity=0.382 Sum_probs=25.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+||++.|||+.. .+.++|+||-.+..
T Consensus 124 gIiHrDLKP~NILl~~------------------------~g~vkL~DFGls~~ 153 (669)
T cd05610 124 GIIHRDLKPDNMLISN------------------------EGHIKLTDFGLSKV 153 (669)
T ss_pred CEEeCCccHHHEEEcC------------------------CCCEEEEeCCCCcc
Confidence 5899999999999975 36799999988764
No 317
>KOG2345|consensus
Probab=92.39 E-value=0.26 Score=41.99 Aligned_cols=16 Identities=31% Similarity=0.735 Sum_probs=14.9
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
-+.|+|++|+|||+++
T Consensus 149 ~yAH~DiKP~NILls~ 164 (302)
T KOG2345|consen 149 PYAHRDIKPANILLSD 164 (302)
T ss_pred cccccCCCcceeEecC
Confidence 5999999999999987
No 318
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=92.35 E-value=0.16 Score=40.61 Aligned_cols=16 Identities=25% Similarity=0.503 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||++..
T Consensus 117 ~i~H~dl~p~nil~~~ 132 (260)
T cd05611 117 GIIHRDIKPENLLIDQ 132 (260)
T ss_pred CeecCCCCHHHeEECC
Confidence 5899999999999975
No 319
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as
Probab=92.31 E-value=0.17 Score=41.65 Aligned_cols=30 Identities=20% Similarity=0.276 Sum_probs=23.8
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||+++. .+.+.++||..+.
T Consensus 121 ~~iiH~dikp~Nil~~~------------------------~~~~~l~Dfg~~~ 150 (285)
T cd05630 121 ERIVYRDLKPENILLDD------------------------HGHIRISDLGLAV 150 (285)
T ss_pred CCEEeCCCCHHHEEECC------------------------CCCEEEeecccee
Confidence 35789999999999975 3568888887653
No 320
>KOG0592|consensus
Probab=92.31 E-value=0.18 Score=46.73 Aligned_cols=18 Identities=33% Similarity=0.464 Sum_probs=16.0
Q ss_pred eeeeeccCCCCCeeecCC
Q psy15664 27 VTFCHNDLQEGNILYRES 44 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~ 44 (174)
..+.|+||+|.|||++.+
T Consensus 193 ~GIIHRDlKPENILLd~d 210 (604)
T KOG0592|consen 193 NGIIHRDLKPENILLDKD 210 (604)
T ss_pred cCceeccCChhheeEcCC
Confidence 469999999999999874
No 321
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=92.30 E-value=0.12 Score=41.41 Aligned_cols=30 Identities=27% Similarity=0.482 Sum_probs=24.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||++.. ++.++++||..+.
T Consensus 121 ~~~~H~dl~~~ni~i~~------------------------~~~~~l~df~~~~ 150 (280)
T cd05581 121 KGIIHRDLKPENILLDK------------------------DMHIKITDFGTAK 150 (280)
T ss_pred CCeeecCCCHHHeEECC------------------------CCCEEecCCcccc
Confidence 35899999999999975 4678899988765
No 322
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=92.28 E-value=0.14 Score=41.93 Aligned_cols=16 Identities=38% Similarity=0.661 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++++
T Consensus 136 ~i~H~dl~p~nili~~ 151 (302)
T cd07864 136 NFLHRDIKCSNILLNN 151 (302)
T ss_pred CeecCCCCHHHEEECC
Confidence 5899999999999976
No 323
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=92.28 E-value=0.12 Score=41.51 Aligned_cols=16 Identities=31% Similarity=0.534 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 120 ~~~h~dl~p~nil~~~ 135 (287)
T cd07840 120 GILHRDIKGSNILINN 135 (287)
T ss_pred CceeccCcHHHeEEcC
Confidence 5899999999999986
No 324
>PRK14705 glycogen branching enzyme; Provisional
Probab=92.27 E-value=2.1 Score=43.54 Aligned_cols=83 Identities=17% Similarity=0.209 Sum_probs=51.5
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec---------ccCccchhhHHHHHHHH
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY---------CSYNYRAFDIANHFVES 95 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY---------a~~n~~~fDlan~f~E~ 95 (174)
.+..=||+|+|.|.+|+..+... .....+|||||= -..-.|.=|+|-.+..+
T Consensus 329 ~~~~RIHGD~HLGQVL~t~~D~~-------------------~~~~~~IIDFEGEP~RpL~ERR~k~sPLRDVAGMLRSF 389 (1224)
T PRK14705 329 GQLQRIHGDLHLGQILQVPGAEG-------------------QPERWAILDFEGEPLRPIDERNSPDVPLRDVTGMLRSF 389 (1224)
T ss_pred cceEEEecccccccEEEecCCCC-------------------ccCCEEEEecCCCCCCChhhhccCCChHHHHHHHHHHH
Confidence 46678999999999998752111 135699999983 23445677899888874
Q ss_pred hhhccCCCCCcccccCC-------CCCCHHHHHHHHHHHHhccCC
Q psy15664 96 VYDYSYKHFPHYTVKRE-------NYPSYSLRKSFVETYLSRMNQ 133 (174)
Q Consensus 96 ~~dy~~~~~p~~~~~~~-------~~p~~~~~~~fl~~Yl~~~~~ 133 (174)
- |.-.. ..... .+ ...-+..||++|.+....
T Consensus 390 d--YAa~~----~l~~~~~~~~a~~W-~~~~~~aFL~gY~~~~~g 427 (1224)
T PRK14705 390 D--YAAGA----ATRENEGAHVPESW-VDDCAAAFLAGYSEVTPG 427 (1224)
T ss_pred H--HHHHH----HhhccchhHHHHHH-HHHHHHHHHHHHHHhccC
Confidence 4 31100 00000 00 123467899999987643
No 325
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a
Probab=92.26 E-value=0.18 Score=39.95 Aligned_cols=16 Identities=44% Similarity=0.694 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++++||+++.
T Consensus 119 ~i~H~dl~~~ni~~~~ 134 (256)
T cd06612 119 KKIHRDIKAGNILLNE 134 (256)
T ss_pred CcccCCCCcceEEECC
Confidence 4799999999999976
No 326
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=92.25 E-value=0.27 Score=39.77 Aligned_cols=16 Identities=31% Similarity=0.465 Sum_probs=14.2
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 119 ~i~H~dikp~nil~~~ 134 (268)
T cd05086 119 NFLHSDLALRNCFLTS 134 (268)
T ss_pred CeeccCCccceEEEcC
Confidence 4789999999999975
No 327
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=92.21 E-value=0.25 Score=39.02 Aligned_cols=30 Identities=27% Similarity=0.282 Sum_probs=24.0
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||++.. ++.++|+||..+.
T Consensus 122 ~~i~h~~l~~~ni~~~~------------------------~~~~kl~d~g~~~ 151 (256)
T cd08530 122 QKILHRDLKSANILLVA------------------------NDLVKIGDLGISK 151 (256)
T ss_pred CCcccCCCCcceEEEec------------------------CCcEEEeeccchh
Confidence 35799999999999986 3568888886553
No 328
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=92.21 E-value=0.15 Score=41.66 Aligned_cols=16 Identities=31% Similarity=0.513 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 126 ~i~H~dl~p~nili~~ 141 (293)
T cd07843 126 WILHRDLKTSNLLLNN 141 (293)
T ss_pred CeeeccCCHHHEEECC
Confidence 4899999999999976
No 329
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=92.21 E-value=0.15 Score=41.71 Aligned_cols=16 Identities=38% Similarity=0.445 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 117 ~i~H~di~p~nili~~ 132 (278)
T cd05606 117 FVVYRDLKPANILLDE 132 (278)
T ss_pred CEEcCCCCHHHEEECC
Confidence 4899999999999975
No 330
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=92.21 E-value=0.19 Score=40.00 Aligned_cols=17 Identities=18% Similarity=0.423 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|+++.||+++.
T Consensus 125 ~~i~h~dl~p~nil~~~ 141 (267)
T cd08224 125 KRIMHRDIKPANVFITA 141 (267)
T ss_pred CCEecCCcChhhEEECC
Confidence 35899999999999975
No 331
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=92.20 E-value=0.16 Score=42.29 Aligned_cols=29 Identities=34% Similarity=0.424 Sum_probs=23.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+||++.|||+.. .+.++++||.++.
T Consensus 135 ~i~H~dl~p~nil~~~------------------------~~~~kl~dfg~~~ 163 (308)
T cd06634 135 NMIHRDVKAGNILLSE------------------------PGLVKLGDFGSAS 163 (308)
T ss_pred CcccCCCCHHhEEECC------------------------CCcEEECCcccce
Confidence 5899999999999975 3567888887654
No 332
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=92.20 E-value=0.22 Score=41.51 Aligned_cols=16 Identities=44% Similarity=0.794 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||++..
T Consensus 145 ~i~H~dL~p~Nil~~~ 160 (317)
T cd06635 145 NMIHRDIKAGNILLTE 160 (317)
T ss_pred CcccCCCCcccEEECC
Confidence 5799999999999975
No 333
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=92.19 E-value=0.15 Score=43.27 Aligned_cols=29 Identities=31% Similarity=0.550 Sum_probs=24.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||+++. .+.++|+||..+.
T Consensus 138 gi~H~dlkp~Nill~~------------------------~~~~kL~dfg~~~ 166 (343)
T cd07851 138 GIIHRDLKPSNIAVNE------------------------DCELKILDFGLAR 166 (343)
T ss_pred CeecCCCCHHHeEECC------------------------CCCEEEccccccc
Confidence 4899999999999986 3568899987665
No 334
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=92.19 E-value=0.14 Score=40.80 Aligned_cols=17 Identities=29% Similarity=0.403 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|++|.||++..
T Consensus 104 ~~i~H~dlkp~Nil~~~ 120 (237)
T cd05576 104 EGIVCRDLNPNNILLDD 120 (237)
T ss_pred CCeeccCCCHHHEEEcC
Confidence 45899999999999986
No 335
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=92.15 E-value=0.15 Score=42.40 Aligned_cols=16 Identities=31% Similarity=0.490 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 161 ~ivH~dlkp~Nil~~~ 176 (302)
T cd05055 161 NCIHRDLAARNVLLTH 176 (302)
T ss_pred CeehhhhccceEEEcC
Confidence 4899999999999975
No 336
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=92.14 E-value=0.2 Score=39.97 Aligned_cols=17 Identities=35% Similarity=0.550 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.|||++.
T Consensus 117 ~~i~H~dlk~~nili~~ 133 (262)
T cd05058 117 KKFVHRDLAARNCMLDE 133 (262)
T ss_pred CCccccccCcceEEEcC
Confidence 35899999999999976
No 337
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=92.09 E-value=0.18 Score=41.80 Aligned_cols=28 Identities=25% Similarity=0.529 Sum_probs=23.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.+.|+|+++.||+++. ++.++|+||..+
T Consensus 137 ~ivH~dl~p~Nill~~------------------------~~~~kL~dfg~~ 164 (297)
T cd06659 137 GVIHRDIKSDSILLTL------------------------DGRVKLSDFGFC 164 (297)
T ss_pred CeecCCCCHHHeEEcc------------------------CCcEEEeechhH
Confidence 4789999999999975 367888888765
No 338
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=92.07 E-value=0.18 Score=42.83 Aligned_cols=30 Identities=30% Similarity=0.588 Sum_probs=24.3
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||++.. .+.++++||..+.
T Consensus 137 ~gi~H~dlkp~Nill~~------------------------~~~~kl~dfg~~~ 166 (343)
T cd07880 137 AGIIHRDLKPGNLAVNE------------------------DCELKILDFGLAR 166 (343)
T ss_pred CCeecCCCCHHHEEEcC------------------------CCCEEEeeccccc
Confidence 34899999999999975 3568888887664
No 339
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=92.06 E-value=0.16 Score=40.69 Aligned_cols=17 Identities=18% Similarity=0.399 Sum_probs=14.8
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 125 ~~i~H~dl~p~nili~~ 141 (267)
T cd08229 125 RRVMHRDIKPANVFITA 141 (267)
T ss_pred CCeecCCCCHHHEEEcC
Confidence 35899999999999975
No 340
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=92.05 E-value=0.22 Score=40.15 Aligned_cols=29 Identities=28% Similarity=0.446 Sum_probs=23.6
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.||++.. ++.++|+||..+.
T Consensus 127 ~i~h~~l~~~nili~~------------------------~~~~~l~dfg~~~ 155 (287)
T cd07838 127 RIVHRDLKPQNILVTS------------------------DGQVKIADFGLAR 155 (287)
T ss_pred CeeeccCChhhEEEcc------------------------CCCEEEeccCcce
Confidence 4899999999999986 3568888887653
No 341
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=92.02 E-value=0.21 Score=40.65 Aligned_cols=17 Identities=24% Similarity=0.491 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||++.|||++.
T Consensus 114 ~~i~H~dlkp~Nill~~ 130 (279)
T cd06619 114 LKILHRDVKPSNMLVNT 130 (279)
T ss_pred CCEeeCCCCHHHEEECC
Confidence 35899999999999976
No 342
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=92.02 E-value=0.22 Score=39.65 Aligned_cols=30 Identities=20% Similarity=0.329 Sum_probs=25.0
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||++.. +..+.++||.++.
T Consensus 120 ~~i~h~~l~~~nil~~~------------------------~~~~~l~d~~~~~ 149 (256)
T cd08218 120 RKILHRDIKSQNIFLTK------------------------DGTIKLGDFGIAR 149 (256)
T ss_pred CCEecCCCCHHHEEEcC------------------------CCCEEEeecccee
Confidence 35899999999999975 3568999998775
No 343
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=91.98 E-value=0.17 Score=42.79 Aligned_cols=29 Identities=31% Similarity=0.607 Sum_probs=23.4
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.|||++. .+.++|+||..+.
T Consensus 137 ~i~H~dlkp~NIll~~------------------------~~~~kL~dfg~~~ 165 (342)
T cd07879 137 GIIHRDLKPGNLAVNE------------------------DCELKILDFGLAR 165 (342)
T ss_pred CcccCCCCHHHEEECC------------------------CCCEEEeeCCCCc
Confidence 4799999999999975 3568888887654
No 344
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=91.96 E-value=0.12 Score=40.43 Aligned_cols=17 Identities=29% Similarity=0.458 Sum_probs=15.3
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+.+.||++..
T Consensus 120 ~~~~h~dl~p~ni~i~~ 136 (260)
T cd06606 120 NGIVHRDIKGANILVDS 136 (260)
T ss_pred CCccccCCCHHHEEEcC
Confidence 46899999999999986
No 345
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=91.91 E-value=0.15 Score=41.15 Aligned_cols=17 Identities=35% Similarity=0.559 Sum_probs=15.3
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+.+.||++..
T Consensus 120 ~~i~H~dl~p~ni~i~~ 136 (277)
T cd06917 120 VGVIHRDIKAANILVTN 136 (277)
T ss_pred CCcccCCcCHHHEEEcC
Confidence 46899999999999986
No 346
>KOG0983|consensus
Probab=91.88 E-value=0.23 Score=43.07 Aligned_cols=25 Identities=32% Similarity=0.434 Sum_probs=19.5
Q ss_pred HhhcCCCeeeeeccCCCCCeeecCC
Q psy15664 20 LLKIKSPVTFCHNDLQEGNILYRES 44 (174)
Q Consensus 20 l~~~~~~~v~cHNDl~~gNiL~~~~ 44 (174)
|...+.+-.+.|+|++|.|||++++
T Consensus 204 L~YLKeKH~viHRDvKPSNILlDe~ 228 (391)
T KOG0983|consen 204 LYYLKEKHGVIHRDVKPSNILLDER 228 (391)
T ss_pred HHHHHHhcceeecccCccceEEccC
Confidence 3444555678999999999999873
No 347
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=91.87 E-value=0.23 Score=40.16 Aligned_cols=16 Identities=38% Similarity=0.600 Sum_probs=14.8
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||++..
T Consensus 119 ~i~H~dl~~~ni~i~~ 134 (283)
T cd07830 119 GFFHRDLKPENLLVSG 134 (283)
T ss_pred CcccCCCChhhEEEcC
Confidence 5899999999999986
No 348
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=91.81 E-value=0.17 Score=40.61 Aligned_cols=29 Identities=24% Similarity=0.405 Sum_probs=23.1
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.+.|+||++.||++.. .+.++++||..+.
T Consensus 122 ~i~H~dl~p~nil~~~------------------------~~~~~l~dfg~~~ 150 (265)
T cd06631 122 CVVHRDIKGNNVMLMP------------------------NGIIKLIDFGCAR 150 (265)
T ss_pred CcccCCcCHHhEEECC------------------------CCeEEeccchhhH
Confidence 3789999999999975 3568888887654
No 349
>KOG0668|consensus
Probab=91.77 E-value=0.17 Score=42.96 Aligned_cols=51 Identities=20% Similarity=0.232 Sum_probs=32.3
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
+++.-+-.|.+.|+-.. ...+.|+|++|.|++++. ...+++||||-.|-+-
T Consensus 133 dIryY~~elLkALdyCH-S~GImHRDVKPhNvmIdh-----------------------~~rkLrlIDWGLAEFY 183 (338)
T KOG0668|consen 133 DIRYYIYELLKALDYCH-SMGIMHRDVKPHNVMIDH-----------------------ELRKLRLIDWGLAEFY 183 (338)
T ss_pred hHHHHHHHHHHHHhHHH-hcCcccccCCcceeeech-----------------------hhceeeeeecchHhhc
Confidence 33333334444443322 356899999999999986 4567888888655443
No 350
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=91.75 E-value=0.21 Score=45.33 Aligned_cols=16 Identities=31% Similarity=0.542 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||+..
T Consensus 163 ~IiHrDLKP~NILl~~ 178 (496)
T PTZ00283 163 HMIHRDIKSANILLCS 178 (496)
T ss_pred CEecCCCCHHHEEEeC
Confidence 4799999999999975
No 351
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex
Probab=91.75 E-value=0.19 Score=40.67 Aligned_cols=16 Identities=31% Similarity=0.490 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 120 ~i~H~~l~p~nill~~ 135 (284)
T cd07860 120 RVLHRDLKPQNLLINT 135 (284)
T ss_pred CeecCCCCHHHEEECC
Confidence 4899999999999986
No 352
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=91.73 E-value=0.32 Score=39.09 Aligned_cols=30 Identities=23% Similarity=0.274 Sum_probs=23.9
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++|+|++++||++.. .+.++++||..+..
T Consensus 128 ~i~H~dl~~~nil~~~------------------------~~~~~l~d~~~~~~ 157 (272)
T cd06629 128 GILHRDLKADNLLVDA------------------------DGICKISDFGISKK 157 (272)
T ss_pred CeeecCCChhhEEEcC------------------------CCeEEEeecccccc
Confidence 5899999999999975 35677888876653
No 353
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=91.72 E-value=0.23 Score=41.71 Aligned_cols=16 Identities=38% Similarity=0.526 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.|||+..
T Consensus 154 givH~dlkp~Nill~~ 169 (334)
T cd05100 154 KCIHRDLAARNVLVTE 169 (334)
T ss_pred CeeccccccceEEEcC
Confidence 5799999999999975
No 354
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the
Probab=91.71 E-value=0.21 Score=41.03 Aligned_cols=33 Identities=21% Similarity=0.166 Sum_probs=24.1
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.|||+..+.. ..+.++++||..+.
T Consensus 128 ~i~h~dlkp~Nil~~~~~~--------------------~~~~~kl~Dfg~~~ 160 (316)
T cd07842 128 WVLHRDLKPANILVMGEGP--------------------ERGVVKIGDLGLAR 160 (316)
T ss_pred CEeeCCCCHHHEEEcCCCC--------------------ccceEEECCCcccc
Confidence 4889999999999976211 23568888887544
No 355
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=91.70 E-value=0.22 Score=40.44 Aligned_cols=17 Identities=29% Similarity=0.470 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||+++||+++.
T Consensus 120 ~~ivH~dl~p~Nil~~~ 136 (277)
T cd06640 120 EKKIHRDIKAANVLLSE 136 (277)
T ss_pred CCccCcCCChhhEEEcC
Confidence 35789999999999975
No 356
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=91.59 E-value=0.16 Score=40.28 Aligned_cols=17 Identities=24% Similarity=0.450 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++.+
T Consensus 120 ~~i~H~dl~~~nil~~~ 136 (257)
T cd08225 120 RKILHRDIKSQNIFLSK 136 (257)
T ss_pred CCcccccCCHHHEEEcC
Confidence 35899999999999976
No 357
>KOG1006|consensus
Probab=91.55 E-value=0.065 Score=46.17 Aligned_cols=33 Identities=30% Similarity=0.557 Sum_probs=27.1
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
+..+-+.|+|++|.|||++. .+.++|-||--||
T Consensus 184 K~~lkiIHRDvKPSNILldr------------------------~G~vKLCDFGIcG 216 (361)
T KOG1006|consen 184 KEELKIIHRDVKPSNILLDR------------------------HGDVKLCDFGICG 216 (361)
T ss_pred HHHhhhhhccCChhheEEec------------------------CCCEeeecccchH
Confidence 34456899999999999986 5789999997665
No 358
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=91.52 E-value=0.17 Score=42.60 Aligned_cols=16 Identities=31% Similarity=0.549 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||++.
T Consensus 126 ~ivH~dlkp~Nill~~ 141 (336)
T cd07849 126 NVLHRDLKPSNLLLNT 141 (336)
T ss_pred CeeccCCCHHHEEECC
Confidence 4899999999999976
No 359
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=91.50 E-value=0.34 Score=40.08 Aligned_cols=16 Identities=44% Similarity=0.681 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 135 ~i~H~dl~p~nIl~~~ 150 (307)
T cd06607 135 ERIHRDIKAGNILLTE 150 (307)
T ss_pred CceecCCCcccEEECC
Confidence 4789999999999976
No 360
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=91.49 E-value=0.19 Score=42.34 Aligned_cols=16 Identities=31% Similarity=0.551 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||++..
T Consensus 128 ~i~H~dlkp~Nil~~~ 143 (337)
T cd07858 128 NVLHRDLKPSNLLLNA 143 (337)
T ss_pred CEecCCCCHHHEEEcC
Confidence 5899999999999975
No 361
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=91.45 E-value=0.19 Score=39.76 Aligned_cols=17 Identities=29% Similarity=0.425 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 121 ~~i~H~dl~~~ni~~~~ 137 (258)
T cd06632 121 RNTVHRDIKGANILVDT 137 (258)
T ss_pred CCcccCCCCHHHEEECC
Confidence 35899999999999975
No 362
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=91.39 E-value=0.19 Score=40.47 Aligned_cols=16 Identities=31% Similarity=0.528 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 126 ~i~H~dl~p~ni~i~~ 141 (264)
T cd06653 126 MIVHRDIKGANILRDS 141 (264)
T ss_pred CEecCCCCHHHEEEcC
Confidence 4899999999999975
No 363
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=91.39 E-value=0.3 Score=39.32 Aligned_cols=17 Identities=35% Similarity=0.632 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 125 ~g~~H~dl~p~nili~~ 141 (269)
T cd05065 125 MNYVHRDLAARNILVNS 141 (269)
T ss_pred CCEeecccChheEEEcC
Confidence 35799999999999975
No 364
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=91.38 E-value=0.23 Score=40.03 Aligned_cols=17 Identities=29% Similarity=0.454 Sum_probs=14.7
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||+++.
T Consensus 125 ~~i~H~~l~p~nil~~~ 141 (266)
T cd06651 125 NMIVHRDIKGANILRDS 141 (266)
T ss_pred CCeeeCCCCHHHEEECC
Confidence 35899999999999975
No 365
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=91.29 E-value=0.29 Score=41.12 Aligned_cols=16 Identities=38% Similarity=0.588 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 127 ~i~H~dl~p~nill~~ 142 (337)
T cd07852 127 NVIHRDLKPSNILLNS 142 (337)
T ss_pred CeecCCCCHHHEEEcC
Confidence 5899999999999976
No 366
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=91.26 E-value=0.22 Score=40.40 Aligned_cols=30 Identities=27% Similarity=0.519 Sum_probs=24.5
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++|+|+++.||++.+ .+.++|+||.++.
T Consensus 140 ~~ivH~dl~~~nili~~------------------------~~~~~l~dfg~~~ 169 (282)
T cd06636 140 HKVIHRDIKGQNVLLTE------------------------NAEVKLVDFGVSA 169 (282)
T ss_pred CCcccCCCCHHHEEECC------------------------CCCEEEeeCcchh
Confidence 35899999999999986 3568899987654
No 367
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=91.23 E-value=0.31 Score=39.27 Aligned_cols=16 Identities=38% Similarity=0.547 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||+..
T Consensus 137 ~i~H~dlkp~Nili~~ 152 (275)
T cd05046 137 RFVHRDLAARNCLVSS 152 (275)
T ss_pred CcccCcCccceEEEeC
Confidence 4899999999999976
No 368
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the
Probab=91.18 E-value=0.26 Score=41.40 Aligned_cols=16 Identities=38% Similarity=0.611 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 127 ~ivH~dlkp~Nil~~~ 142 (334)
T cd07855 127 NVIHRDLKPSNLLVNE 142 (334)
T ss_pred CeecCCCCHHHEEEcC
Confidence 4899999999999976
No 369
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=91.16 E-value=0.22 Score=40.58 Aligned_cols=17 Identities=35% Similarity=0.559 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|+++.|||+.+
T Consensus 141 ~~i~H~dlkp~nil~~~ 157 (280)
T cd05092 141 LHFVHRDLATRNCLVGQ 157 (280)
T ss_pred CCeecccccHhhEEEcC
Confidence 35899999999999975
No 370
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=91.16 E-value=0.23 Score=41.89 Aligned_cols=16 Identities=44% Similarity=0.634 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 128 ~iiH~dl~p~Nili~~ 143 (328)
T cd07856 128 GVVHRDLKPSNILINE 143 (328)
T ss_pred CcccCCCCHHHEeECC
Confidence 4899999999999975
No 371
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=91.08 E-value=0.31 Score=42.16 Aligned_cols=16 Identities=38% Similarity=0.509 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.|||++.
T Consensus 234 ~ivH~Dlkp~Nill~~ 249 (375)
T cd05104 234 NCIHRDLAARNILLTH 249 (375)
T ss_pred CeeccCCchhhEEEEC
Confidence 4799999999999976
No 372
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=90.89 E-value=0.25 Score=39.44 Aligned_cols=17 Identities=29% Similarity=0.513 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 125 ~~i~h~~l~~~nili~~ 141 (260)
T cd08222 125 RRILHRDLKAKNIFLKN 141 (260)
T ss_pred cCccccCCChhheEeec
Confidence 46899999999999965
No 373
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=90.87 E-value=0.21 Score=39.99 Aligned_cols=16 Identities=31% Similarity=0.524 Sum_probs=14.3
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 126 ~ivH~di~p~nil~~~ 141 (267)
T cd06628 126 GIIHRDIKGANILVDN 141 (267)
T ss_pred CcccccCCHHHEEEcC
Confidence 4789999999999975
No 374
>KOG1167|consensus
Probab=90.87 E-value=0.35 Score=43.40 Aligned_cols=54 Identities=20% Similarity=0.249 Sum_probs=34.8
Q ss_pred cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
+++.++..-+..|-+.++. -....+.|+|++|+|+|++. ..++-+||||-.|..
T Consensus 129 l~~~~i~~Yl~~ll~Al~~-~h~~GIvHRDiKpsNFL~n~-----------------------~t~rg~LvDFgLA~~ 182 (418)
T KOG1167|consen 129 LSLAEIRWYLRNLLKALAH-LHKNGIVHRDIKPSNFLYNR-----------------------RTQRGVLVDFGLAQR 182 (418)
T ss_pred CCHHHHHHHHHHHHHHhhh-hhccCccccCCCcccccccc-----------------------ccCCceEEechhHHH
Confidence 3444444333333333332 23457899999999999987 346778999987763
No 375
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25
Probab=90.85 E-value=0.46 Score=38.42 Aligned_cols=17 Identities=29% Similarity=0.464 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|+++.||++..
T Consensus 120 ~~ivH~dl~p~ni~i~~ 136 (277)
T cd06642 120 ERKIHRDIKAANVLLSE 136 (277)
T ss_pred CCeeccCCChheEEEeC
Confidence 35889999999999975
No 376
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=90.81 E-value=0.3 Score=41.48 Aligned_cols=16 Identities=31% Similarity=0.511 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 140 ~ivH~dlkp~NIll~~ 155 (345)
T cd07877 140 DIIHRDLKPSNLAVNE 155 (345)
T ss_pred CeeecCCChHHEEEcC
Confidence 5899999999999976
No 377
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=90.81 E-value=0.4 Score=44.14 Aligned_cols=29 Identities=24% Similarity=0.407 Sum_probs=24.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|+++.|||+.. +..++++||-.+.
T Consensus 329 ~ivHrDLKp~NILl~~------------------------~~~~kL~DFGla~ 357 (507)
T PLN03224 329 GIVHRDIKPENLLVTV------------------------DGQVKIIDFGAAV 357 (507)
T ss_pred CeecCCCchHhEEECC------------------------CCcEEEEeCcCcc
Confidence 4789999999999976 3568999997763
No 378
>KOG1235|consensus
Probab=90.80 E-value=0.18 Score=46.76 Aligned_cols=33 Identities=33% Similarity=0.633 Sum_probs=25.2
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.|-|+|.|||||+++.++. .+.++++.|+=-..
T Consensus 321 GffHaDPHPGNilv~~~~~--------------------~~~~ivllDhGl~~ 353 (538)
T KOG1235|consen 321 GFFHADPHPGNILVRPNPE--------------------GDEEIVLLDHGLYA 353 (538)
T ss_pred CCccCCCCCCcEEEecCCC--------------------CCccEEEEcccccc
Confidence 4999999999999996432 35778999975433
No 379
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It
Probab=90.76 E-value=0.27 Score=39.80 Aligned_cols=17 Identities=24% Similarity=0.317 Sum_probs=14.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 136 ~~i~H~di~p~nil~~~ 152 (280)
T cd05043 136 RGVIHKDIAARNCVIDE 152 (280)
T ss_pred CCEeecccCHhhEEEcC
Confidence 35899999999999976
No 380
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=90.74 E-value=0.3 Score=39.93 Aligned_cols=16 Identities=31% Similarity=0.524 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|++|.|||+..
T Consensus 139 ~i~H~dikp~nili~~ 154 (288)
T cd05061 139 KFVHRDLAARNCMVAH 154 (288)
T ss_pred CCcCCCCChheEEEcC
Confidence 5899999999999976
No 381
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=90.65 E-value=0.29 Score=39.41 Aligned_cols=16 Identities=31% Similarity=0.617 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 120 ~i~H~dl~p~ni~l~~ 135 (282)
T cd07831 120 GIFHRDIKPENILIKD 135 (282)
T ss_pred CceecccCHHHEEEcC
Confidence 4899999999999975
No 382
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=90.64 E-value=0.35 Score=42.59 Aligned_cols=16 Identities=31% Similarity=0.532 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 257 ~ivH~dikp~Nill~~ 272 (400)
T cd05105 257 NCVHRDLAARNVLLAQ 272 (400)
T ss_pred CeeCCCCChHhEEEeC
Confidence 4899999999999976
No 383
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=90.64 E-value=0.3 Score=48.14 Aligned_cols=29 Identities=28% Similarity=0.367 Sum_probs=23.6
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.++|+|++|.|||++. .+.++++||..+.
T Consensus 133 GIIHRDLKPeNILLd~------------------------dg~vKLiDFGLAk 161 (932)
T PRK13184 133 GVLHRDLKPDNILLGL------------------------FGEVVILDWGAAI 161 (932)
T ss_pred CccccCCchheEEEcC------------------------CCCEEEEecCcce
Confidence 5899999999999975 3567888887664
No 384
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=90.64 E-value=0.26 Score=40.59 Aligned_cols=16 Identities=31% Similarity=0.488 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.||+++.
T Consensus 135 gi~H~dL~p~Nili~~ 150 (293)
T cd06647 135 QVIHRDIKSDNILLGM 150 (293)
T ss_pred CEeeccCCHHHEEEcC
Confidence 4899999999999976
No 385
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the
Probab=90.62 E-value=0.35 Score=38.86 Aligned_cols=16 Identities=38% Similarity=0.544 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++.+
T Consensus 118 ~i~H~~l~~~ni~~~~ 133 (282)
T cd07829 118 RILHRDLKPQNILINR 133 (282)
T ss_pred CcccCCCChheEEEcC
Confidence 4789999999999986
No 386
>KOG0610|consensus
Probab=90.59 E-value=0.42 Score=43.11 Aligned_cols=44 Identities=25% Similarity=0.267 Sum_probs=32.9
Q ss_pred HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
.|+--..++|.. +.+.=+||+|.|||+++ ++-|.|.||+.+--.
T Consensus 186 AEvl~ALEYLHm----lGivYRDLKPENILvre------------------------dGHIMLsDFDLS~~~ 229 (459)
T KOG0610|consen 186 AEVLLALEYLHM----LGIVYRDLKPENILVRE------------------------DGHIMLSDFDLSLRC 229 (459)
T ss_pred HHHHHHHHHHHh----hceeeccCCcceeEEec------------------------CCcEEeeeccccccC
Confidence 444444555544 45888999999999997 578999999987643
No 387
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=90.53 E-value=0.33 Score=39.70 Aligned_cols=31 Identities=23% Similarity=0.333 Sum_probs=25.0
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
..++|+|+++.||++.. .+.++++||.++..
T Consensus 124 ~~i~H~dl~~~nil~~~------------------------~~~~~l~dfg~~~~ 154 (287)
T cd06621 124 RKIIHRDIKPSNILLTR------------------------KGQVKLCDFGVSGE 154 (287)
T ss_pred CCcccCCCCHHHEEEec------------------------CCeEEEeecccccc
Confidence 45899999999999975 35688999987653
No 388
>PLN00181 protein SPA1-RELATED; Provisional
Probab=90.30 E-value=0.43 Score=45.60 Aligned_cols=17 Identities=0% Similarity=0.077 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+||+|.|||+..
T Consensus 99 ~gIvHrDlKP~NiLl~~ 115 (793)
T PLN00181 99 QGIVVHNVRPSCFVMSS 115 (793)
T ss_pred CCeeeccCCchhEEEcc
Confidence 46999999999999964
No 389
>KOG0595|consensus
Probab=90.25 E-value=0.5 Score=42.44 Aligned_cols=52 Identities=21% Similarity=0.301 Sum_probs=35.3
Q ss_pred HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
++++...++|... -+.|+||+|.|||+..+.... ....+++=||=+|..-.+
T Consensus 116 ~QLA~alq~L~~~----~IiHRDLKPQNiLLs~~~~~~------------------~~~~LKIADFGfAR~L~~ 167 (429)
T KOG0595|consen 116 QQLASALQFLHEN----NIIHRDLKPQNILLSTTARND------------------TSPVLKIADFGFARFLQP 167 (429)
T ss_pred HHHHHHHHHHHHC----CeeeccCCcceEEeccCCCCC------------------CCceEEecccchhhhCCc
Confidence 4455555555543 489999999999998743221 115699999998876553
No 390
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=90.21 E-value=0.38 Score=38.24 Aligned_cols=16 Identities=25% Similarity=0.524 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+||++.||++..
T Consensus 119 ~i~H~dl~~~nil~~~ 134 (264)
T cd06626 119 GIVHRDIKPANIFLDH 134 (264)
T ss_pred CcccCCCCHHHEEECC
Confidence 4799999999999986
No 391
>KOG0598|consensus
Probab=90.08 E-value=0.25 Score=43.52 Aligned_cols=29 Identities=28% Similarity=0.165 Sum_probs=22.8
Q ss_pred HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664 11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
.||...-.+|.+. .+.|+||+|.|||++.
T Consensus 132 aEi~lAL~~LH~~----gIiyRDlKPENILLd~ 160 (357)
T KOG0598|consen 132 AEIVLALGYLHSK----GIIYRDLKPENILLDE 160 (357)
T ss_pred HHHHHHHHHHHhC----CeeeccCCHHHeeecC
Confidence 5666666666654 4899999999999986
No 392
>KOG0578|consensus
Probab=90.07 E-value=0.49 Score=43.84 Aligned_cols=33 Identities=24% Similarity=0.442 Sum_probs=27.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
..+.|+|++..|||+.. ++.++|.||=+|+.-.
T Consensus 388 ~gIiHrDIKSDnILL~~------------------------~g~vKltDFGFcaqi~ 420 (550)
T KOG0578|consen 388 RGIIHRDIKSDNILLTM------------------------DGSVKLTDFGFCAQIS 420 (550)
T ss_pred cceeeeccccceeEecc------------------------CCcEEEeeeeeeeccc
Confidence 46899999999999986 4779999999987543
No 393
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=90.05 E-value=0.53 Score=41.52 Aligned_cols=16 Identities=38% Similarity=0.524 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 259 ~ivHrdlkp~NiLl~~ 274 (401)
T cd05107 259 NCVHRDLAARNVLICE 274 (401)
T ss_pred CcCcccCCcceEEEeC
Confidence 4799999999999975
No 394
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=89.97 E-value=0.26 Score=41.71 Aligned_cols=16 Identities=25% Similarity=0.501 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||+++.
T Consensus 134 givH~dikp~Nili~~ 149 (342)
T cd07854 134 NVLHRDLKPANVFINT 149 (342)
T ss_pred CcccCCCCHHHEEEcC
Confidence 5899999999999974
No 395
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=89.94 E-value=0.63 Score=37.60 Aligned_cols=17 Identities=24% Similarity=0.368 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|++|.|||+..
T Consensus 124 ~~ivH~dlkp~Nill~~ 140 (262)
T cd05077 124 KDLVHGNVCTKNILLAR 140 (262)
T ss_pred CCeECCCCCcccEEEec
Confidence 35899999999999975
No 396
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=89.93 E-value=0.33 Score=39.12 Aligned_cols=16 Identities=38% Similarity=0.532 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 118 ~i~h~dl~p~ni~i~~ 133 (274)
T cd06609 118 GKIHRDIKAANILLSE 133 (274)
T ss_pred CcccCCCCHHHEEECC
Confidence 4899999999999986
No 397
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=89.81 E-value=0.29 Score=40.98 Aligned_cols=17 Identities=35% Similarity=0.518 Sum_probs=15.0
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..++|+|+++.||++..
T Consensus 138 ~~i~H~dl~~~nill~~ 154 (335)
T PTZ00024 138 WYFMHRDLSPANIFINS 154 (335)
T ss_pred CCeecccccHHHeEECC
Confidence 35899999999999976
No 398
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=89.74 E-value=0.33 Score=39.52 Aligned_cols=16 Identities=31% Similarity=0.549 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.||++.+
T Consensus 124 ~i~H~dl~p~nil~~~ 139 (284)
T cd06620 124 RIMHRDIKPSNILVNS 139 (284)
T ss_pred CeeccCCCHHHEEECC
Confidence 4899999999999976
No 399
>PHA02988 hypothetical protein; Provisional
Probab=89.69 E-value=0.37 Score=39.70 Aligned_cols=15 Identities=20% Similarity=0.080 Sum_probs=13.2
Q ss_pred eeeccCCCCCeeecC
Q psy15664 29 FCHNDLQEGNILYRE 43 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~ 43 (174)
..|+|+++.|||++.
T Consensus 144 ~~Hrdlkp~nill~~ 158 (283)
T PHA02988 144 KPYKNLTSVSFLVTE 158 (283)
T ss_pred CCCCcCChhhEEECC
Confidence 449999999999986
No 400
>KOG0660|consensus
Probab=89.58 E-value=0.27 Score=43.31 Aligned_cols=33 Identities=30% Similarity=0.540 Sum_probs=26.0
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
.-...|+||+|+|+|++. +..+++-||=+|...
T Consensus 143 SAnViHRDLKPsNll~n~------------------------~c~lKI~DFGLAR~~ 175 (359)
T KOG0660|consen 143 SANVIHRDLKPSNLLLNA------------------------DCDLKICDFGLARYL 175 (359)
T ss_pred cccccccccchhheeecc------------------------CCCEEeccccceeec
Confidence 446789999999999986 356778888777655
No 401
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=89.55 E-value=0.38 Score=38.91 Aligned_cols=16 Identities=44% Similarity=0.646 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.||++..
T Consensus 123 ~i~h~dl~p~nili~~ 138 (280)
T cd06611 123 KVIHRDLKAGNILLTL 138 (280)
T ss_pred CcccCCCChhhEEECC
Confidence 4789999999999975
No 402
>KOG0593|consensus
Probab=89.51 E-value=0.49 Score=41.49 Aligned_cols=28 Identities=29% Similarity=0.456 Sum_probs=22.9
Q ss_pred eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..|+|++|.|||++. ++.+.|-||-||.
T Consensus 122 ~IHRDIKPENILit~------------------------~gvvKLCDFGFAR 149 (396)
T KOG0593|consen 122 CIHRDIKPENILITQ------------------------NGVVKLCDFGFAR 149 (396)
T ss_pred eecccCChhheEEec------------------------CCcEEeccchhhH
Confidence 779999999999986 4667888887653
No 403
>KOG0607|consensus
Probab=89.30 E-value=0.59 Score=41.40 Aligned_cols=32 Identities=22% Similarity=0.235 Sum_probs=23.5
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
.+.++|....+++... .+.|+||+|.|||-..
T Consensus 180 ~vvkdia~aLdFlH~k----gIAHRDlKPENiLC~~ 211 (463)
T KOG0607|consen 180 RVVKDIASALDFLHTK----GIAHRDLKPENILCES 211 (463)
T ss_pred HHHHHHHHHHHHHhhc----CcccccCCccceeecC
Confidence 4456666666666554 4999999999999764
No 404
>KOG0670|consensus
Probab=89.24 E-value=0.63 Score=43.50 Aligned_cols=29 Identities=31% Similarity=0.287 Sum_probs=21.2
Q ss_pred HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664 11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
+++-...++|.+ +.+.|.|++|.|||+++
T Consensus 543 qQLflALklLK~----c~vlHaDIKPDNiLVNE 571 (752)
T KOG0670|consen 543 QQLFLALKLLKK----CGVLHADIKPDNILVNE 571 (752)
T ss_pred HHHHHHHHHHHh----cCeeecccCccceEecc
Confidence 344444455555 45899999999999998
No 405
>KOG0616|consensus
Probab=89.17 E-value=0.59 Score=40.76 Aligned_cols=41 Identities=22% Similarity=0.312 Sum_probs=30.4
Q ss_pred HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.|+...-+++.. .-+..+||+|.|||++. .+-|.++||-+|
T Consensus 151 AeivlAleylH~----~~iiYRDLKPENiLlD~------------------------~G~iKitDFGFA 191 (355)
T KOG0616|consen 151 AEIVLALEYLHS----LDIIYRDLKPENLLLDQ------------------------NGHIKITDFGFA 191 (355)
T ss_pred HHHHHHHHHHHh----cCeeeccCChHHeeecc------------------------CCcEEEEeccce
Confidence 445444455544 34889999999999986 477999999776
No 406
>KOG0604|consensus
Probab=89.15 E-value=0.52 Score=41.31 Aligned_cols=54 Identities=22% Similarity=0.356 Sum_probs=34.4
Q ss_pred HHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 9 LNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 9 L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
+-++|...-+++.. .-+.|+||++.|+|+..... +-.++|-||-||--..+-.|
T Consensus 166 I~~qI~~Av~~lH~----~nIAHRDlKpENLLyt~t~~---------------------na~lKLtDfGFAK~t~~~~~ 219 (400)
T KOG0604|consen 166 IMKQIGLAVRYLHS----MNIAHRDLKPENLLYTTTSP---------------------NAPLKLTDFGFAKETQEPGD 219 (400)
T ss_pred HHHHHHHHHHHHHh----cchhhccCChhheeeecCCC---------------------CcceEecccccccccCCCcc
Confidence 33444444444444 34899999999999987422 24577888877765553333
No 407
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=88.82 E-value=0.53 Score=38.01 Aligned_cols=16 Identities=19% Similarity=0.430 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.|||+..
T Consensus 127 ~iiH~dikp~nili~~ 142 (266)
T cd05064 127 GYVHKGLAAHKVLVNS 142 (266)
T ss_pred CEeeccccHhhEEEcC
Confidence 4789999999999976
No 408
>KOG0599|consensus
Probab=88.79 E-value=0.4 Score=41.66 Aligned_cols=41 Identities=22% Similarity=0.388 Sum_probs=34.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHH
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHF 92 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f 92 (174)
-+.|+||++.|||+++ +-.+++=||-+|.--.|+=-|-+.+
T Consensus 143 ~IVHRDLKpENILldd------------------------n~~i~isDFGFa~~l~~GekLrelC 183 (411)
T KOG0599|consen 143 NIVHRDLKPENILLDD------------------------NMNIKISDFGFACQLEPGEKLRELC 183 (411)
T ss_pred hhhhcccChhheeecc------------------------ccceEEeccceeeccCCchhHHHhc
Confidence 4789999999999987 4679999999999888877665543
No 409
>KOG0582|consensus
Probab=88.66 E-value=0.66 Score=42.34 Aligned_cols=33 Identities=24% Similarity=0.212 Sum_probs=22.4
Q ss_pred hhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664 7 KDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 7 ~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
..+.+|+-.-..+|.+. .-.|+|+++||||++.
T Consensus 129 a~iLre~LkaL~YLH~~----G~IHRdvKAgnILi~~ 161 (516)
T KOG0582|consen 129 ATILREVLKALDYLHQN----GHIHRDVKAGNILIDS 161 (516)
T ss_pred HHHHHHHHHHHHHHHhc----CceecccccccEEEcC
Confidence 33444444444455443 4789999999999986
No 410
>COG3281 Ble Uncharacterized protein, probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]
Probab=88.33 E-value=0.26 Score=43.80 Aligned_cols=45 Identities=24% Similarity=0.230 Sum_probs=34.8
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc---------cCccchhhHHHHHHHHh
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC---------SYNYRAFDIANHFVESV 96 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa---------~~n~~~fDlan~f~E~~ 96 (174)
+.=.|+|||.|-+|+.. ++.+|||||=- -.-.|.=|+|..+....
T Consensus 284 l~RvHGDLHLgQVLvt~-------------------------g~~~liDFEGEPsRpl~err~~~sPlrDvAgllRS~D 337 (438)
T COG3281 284 LQRVHGDLHLGQVLVTP-------------------------GRALLIDFEGEPSRPLDERRAPDSPLRDVAGLLRSFD 337 (438)
T ss_pred HHHHhccceehheeeeC-------------------------CcEEEEecCCCCCCChhhccCCCCchHHHHHHHHHhH
Confidence 44579999999999976 78999999832 23456778998887733
No 411
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity
Probab=88.13 E-value=0.71 Score=37.01 Aligned_cols=18 Identities=17% Similarity=0.274 Sum_probs=15.6
Q ss_pred eeeeeccCCCCCeeecCC
Q psy15664 27 VTFCHNDLQEGNILYRES 44 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~ 44 (174)
..++|+|+++.|||+..+
T Consensus 119 ~~iiH~dlkp~nili~~~ 136 (258)
T cd05078 119 KGLTHGNVCAKNVLLIRE 136 (258)
T ss_pred CCeecCCCccceEEEecc
Confidence 358999999999999863
No 412
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=87.88 E-value=1 Score=36.75 Aligned_cols=16 Identities=25% Similarity=0.439 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||++.|||+..
T Consensus 137 ~iiH~dlkp~Nill~~ 152 (274)
T cd05076 137 NLVHGNVCAKNILLAR 152 (274)
T ss_pred CccCCCCCcccEEEec
Confidence 4799999999999975
No 413
>KOG0615|consensus
Probab=87.60 E-value=0.73 Score=41.68 Aligned_cols=19 Identities=26% Similarity=0.434 Sum_probs=16.6
Q ss_pred CeeeeeccCCCCCeeecCC
Q psy15664 26 PVTFCHNDLQEGNILYRES 44 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~ 44 (174)
...+||+|++|.|||+...
T Consensus 294 ~~GI~HRDiKPeNILl~~~ 312 (475)
T KOG0615|consen 294 SQGIIHRDIKPENILLSND 312 (475)
T ss_pred HcCcccccCCcceEEeccC
Confidence 3579999999999999874
No 414
>KOG1187|consensus
Probab=86.94 E-value=0.77 Score=40.27 Aligned_cols=19 Identities=37% Similarity=0.553 Sum_probs=16.5
Q ss_pred eeeeccCCCCCeeecCCCC
Q psy15664 28 TFCHNDLQEGNILYRESPN 46 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~ 46 (174)
.+.|+|+++.|||++.+..
T Consensus 197 ~iiHrDiKssNILLD~~~~ 215 (361)
T KOG1187|consen 197 PIIHRDIKSSNILLDEDFN 215 (361)
T ss_pred CEecCCCCHHHeeECCCCC
Confidence 6899999999999997544
No 415
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=86.80 E-value=0.78 Score=41.40 Aligned_cols=62 Identities=23% Similarity=0.310 Sum_probs=47.4
Q ss_pred cchhhHHHHHHHHHHHHh---hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 4 ILSKDLNTEADWLKKHLL---KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 4 ~~~~~L~~e~~~l~~~l~---~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
+..++..+++..+...+. ......-|-|+||.-+|||+++ +.+.||||-.|.
T Consensus 315 ik~~~~~e~lsff~s~~sil~~lekkf~fehrnlt~~niLId~-------------------------GnvtLIDfklsR 369 (488)
T COG5072 315 IKADRSEEELSFFWSCISILDILEKKFPFEHRNLTLDNILIDE-------------------------GNVTLIDFKLSR 369 (488)
T ss_pred eecccHHHHHHHHHHHHHHHhhhhhcCCcccccccccceeeec-------------------------CceEEEEeeeee
Confidence 344566677777665543 4556778999999999999985 789999999999
Q ss_pred CccchhhHHH
Q psy15664 81 YNYRAFDIAN 90 (174)
Q Consensus 81 ~n~~~fDlan 90 (174)
.++..=+|-+
T Consensus 370 l~~~q~~isy 379 (488)
T COG5072 370 LSYSQGIISY 379 (488)
T ss_pred cccCCceeec
Confidence 8877766543
No 416
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]
Probab=86.76 E-value=0.59 Score=39.69 Aligned_cols=26 Identities=35% Similarity=0.473 Sum_probs=22.7
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeee
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFE 77 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfE 77 (174)
..+.|.||..-|||+.+ +..++||+=
T Consensus 186 a~LVHgDLSEyNiL~~~-------------------------~~p~iID~~ 211 (268)
T COG1718 186 AGLVHGDLSEYNILVHD-------------------------GEPYIIDVS 211 (268)
T ss_pred cCcccccchhhheEEEC-------------------------CeEEEEECc
Confidence 35899999999999986 678999993
No 417
>KOG0198|consensus
Probab=86.61 E-value=1 Score=39.07 Aligned_cols=17 Identities=29% Similarity=0.440 Sum_probs=15.5
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+|+++.|||+..
T Consensus 136 ~g~vH~DiK~~NiLl~~ 152 (313)
T KOG0198|consen 136 KGIVHCDIKPANILLDP 152 (313)
T ss_pred CCEeccCcccceEEEeC
Confidence 46999999999999987
No 418
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP. PhoP controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multi-component loop in Salmonella sp., where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner [].
Probab=86.58 E-value=1.8 Score=35.01 Aligned_cols=45 Identities=29% Similarity=0.375 Sum_probs=30.7
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEee
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDF 76 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDf 76 (174)
.+.+-++.+++.+-... ++.+|+.++||++....++ ..++++||-
T Consensus 122 ~~~~~L~~f~~~l~~~~----Iv~~dl~~~NIv~~~~~~~--------------------~~~lvlIDG 166 (199)
T PF10707_consen 122 ELRQALDEFKRYLLDHH----IVIRDLNPHNIVVQRRDSG--------------------EFRLVLIDG 166 (199)
T ss_pred HHHHHHHHHHHHHHHcC----CeecCCCcccEEEEecCCC--------------------ceEEEEEeC
Confidence 45555666666665433 4555999999999874322 247999997
No 419
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=86.42 E-value=0.98 Score=37.78 Aligned_cols=16 Identities=19% Similarity=0.436 Sum_probs=14.4
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+||++.|||+..
T Consensus 121 ~iiH~dlkp~Nil~~~ 136 (327)
T cd08227 121 GYVHRSVKASHILISV 136 (327)
T ss_pred CEecCCCChhhEEEec
Confidence 4889999999999976
No 420
>KOG2268|consensus
Probab=86.36 E-value=1.2 Score=39.68 Aligned_cols=43 Identities=30% Similarity=0.375 Sum_probs=30.4
Q ss_pred hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664 8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY 78 (174)
Q Consensus 8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY 78 (174)
.|...+.-+.--+.+. .+.|+|.+.-|||+.+ +..+++|||-=
T Consensus 206 ~ly~~lm~~Iv~la~~----GlIHgDFNEFNimv~d------------------------d~~i~vIDFPQ 248 (465)
T KOG2268|consen 206 TLYDDLMGLIVRLANH----GLIHGDFNEFNIMVKD------------------------DDKIVVIDFPQ 248 (465)
T ss_pred HHHHHHHHHHHHHHHc----CceecccchheeEEec------------------------CCCEEEeechH
Confidence 3444444444444454 4899999999999986 46799999953
No 421
>KOG1164|consensus
Probab=86.34 E-value=1 Score=38.31 Aligned_cols=36 Identities=22% Similarity=0.395 Sum_probs=26.6
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
...+.|+|++|+|+++...... ....+.+|||-.|.
T Consensus 140 ~~G~iHRDiKp~N~~~g~~~~~-------------------~~~~~~llDfGlar 175 (322)
T KOG1164|consen 140 SKGFIHRDIKPENFVVGQSSRS-------------------EVRTLYLLDFGLAR 175 (322)
T ss_pred hcCcccCCcCHHHeeecCCCCc-------------------ccceEEEEecCCCc
Confidence 4679999999999999863211 12569999996554
No 422
>KOG1035|consensus
Probab=85.74 E-value=0.94 Score=45.76 Aligned_cols=17 Identities=29% Similarity=0.432 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
.++.|+||+|.||.++.
T Consensus 716 ~giIHRDLKP~NIFLd~ 732 (1351)
T KOG1035|consen 716 QGIIHRDLKPRNIFLDS 732 (1351)
T ss_pred CceeeccCCcceeEEcC
Confidence 34999999999999986
No 423
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=85.43 E-value=0.88 Score=38.10 Aligned_cols=16 Identities=19% Similarity=0.493 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|+++.|||+..
T Consensus 121 ~ivHrDlkp~Nill~~ 136 (328)
T cd08226 121 GYIHRNIKASHILISG 136 (328)
T ss_pred CeecCCCCHHHEEEeC
Confidence 5899999999999975
No 424
>KOG0586|consensus
Probab=85.26 E-value=0.9 Score=42.56 Aligned_cols=31 Identities=32% Similarity=0.701 Sum_probs=26.3
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
-.+||+||+..|||++. +..+.+-||+++..
T Consensus 174 k~ivHrdLk~eNilL~~------------------------~mnikIaDfgfS~~ 204 (596)
T KOG0586|consen 174 KNIVHRDLKAENILLDE------------------------NMNIKIADFGFSTF 204 (596)
T ss_pred cceeccccchhhccccc------------------------ccceeeecccccee
Confidence 46999999999999986 34489999998874
No 425
>KOG0659|consensus
Probab=85.15 E-value=1.1 Score=38.54 Aligned_cols=16 Identities=31% Similarity=0.466 Sum_probs=14.3
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
-+-|+|++|+|+|++.
T Consensus 121 ~IlHRDlKPnNLLis~ 136 (318)
T KOG0659|consen 121 WILHRDLKPNNLLISS 136 (318)
T ss_pred hhhcccCCccceEEcC
Confidence 4679999999999986
No 426
>KOG0032|consensus
Probab=85.01 E-value=1.1 Score=39.84 Aligned_cols=38 Identities=21% Similarity=0.358 Sum_probs=29.4
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
..++|.|++|.|+|+.....+ ...+.++||--|....+
T Consensus 154 ~gvvHrDlKpEN~L~~~~~~~--------------------~~~ik~~DFGla~~~~~ 191 (382)
T KOG0032|consen 154 LGVVHRDLKPENLLLASKDEG--------------------SGRIKLIDFGLAKFIKP 191 (382)
T ss_pred CCceeccCCHHHeeeccccCC--------------------CCcEEEeeCCCceEccC
Confidence 779999999999999873221 24799999987776555
No 427
>KOG0579|consensus
Probab=84.31 E-value=0.53 Score=45.14 Aligned_cols=16 Identities=44% Similarity=0.673 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
-+.|+||+.||||++-
T Consensus 150 ~iIHRDLKAGNiL~Tl 165 (1187)
T KOG0579|consen 150 NIIHRDLKAGNILLTL 165 (1187)
T ss_pred chhhhhccccceEEEe
Confidence 4789999999999986
No 428
>KOG0605|consensus
Probab=83.87 E-value=1.3 Score=40.96 Aligned_cols=31 Identities=19% Similarity=0.424 Sum_probs=26.7
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
...+.|+|++|.|+|++. .+-|+|=||=.|.
T Consensus 259 ~~gyIHRDIKPdNlLiD~------------------------~GHiKLSDFGLs~ 289 (550)
T KOG0605|consen 259 QLGYIHRDIKPDNLLIDA------------------------KGHIKLSDFGLST 289 (550)
T ss_pred HcCcccccCChhheeecC------------------------CCCEeeccccccc
Confidence 467999999999999986 4779999998874
No 429
>KOG4236|consensus
Probab=83.71 E-value=1.6 Score=41.07 Aligned_cols=33 Identities=21% Similarity=0.383 Sum_probs=26.3
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
-+.|+||+|.|+|+... ..=.+++|-||-||..
T Consensus 684 nIvHCDLKPENVLLas~---------------------~~FPQvKlCDFGfARi 716 (888)
T KOG4236|consen 684 NIVHCDLKPENVLLASA---------------------SPFPQVKLCDFGFARI 716 (888)
T ss_pred ceeeccCCchheeeccC---------------------CCCCceeeccccceee
Confidence 47899999999999762 1236799999988764
No 430
>KOG0577|consensus
Probab=83.55 E-value=0.5 Score=44.85 Aligned_cols=35 Identities=31% Similarity=0.298 Sum_probs=26.9
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA 85 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~ 85 (174)
....|+|++.||||+++ ++-+.|-||--|++..|+
T Consensus 145 ~~~IHRDiKAGNILLse------------------------~g~VKLaDFGSAsi~~PA 179 (948)
T KOG0577|consen 145 HNRIHRDIKAGNILLSE------------------------PGLVKLADFGSASIMAPA 179 (948)
T ss_pred hhHHhhhccccceEecC------------------------CCeeeeccccchhhcCch
Confidence 35789999999999987 466788888776665443
No 431
>KOG0591|consensus
Probab=82.98 E-value=2.2 Score=37.26 Aligned_cols=40 Identities=28% Similarity=0.288 Sum_probs=26.2
Q ss_pred cchhhHHHHHHHHHHHHhhcCC--Ce-eeeeccCCCCCeeecC
Q psy15664 4 ILSKDLNTEADWLKKHLLKIKS--PV-TFCHNDLQEGNILYRE 43 (174)
Q Consensus 4 ~~~~~L~~e~~~l~~~l~~~~~--~~-v~cHNDl~~gNiL~~~ 43 (174)
|+...+.+=+..|-..|....+ |. .+-|+|++|+||.++.
T Consensus 121 ipE~~Vwk~f~QL~~AL~~cH~~~~r~~VmHRDIKPaNIFl~~ 163 (375)
T KOG0591|consen 121 IPEKTVWKYFVQLCRALYHCHSKIPRGTVMHRDIKPANIFLTA 163 (375)
T ss_pred CchHHHHHHHHHHHHHHHHHhccccccceeeccCcchheEEcC
Confidence 3444444444555555555544 33 5789999999999986
No 432
>KOG0671|consensus
Probab=82.51 E-value=2.7 Score=37.68 Aligned_cols=50 Identities=26% Similarity=0.319 Sum_probs=28.4
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCC-CCCCCCCCCCceEEEeeeccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNN-VNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~lIDfEYa~ 80 (174)
.+.+.|-||+|.|||+..+.-.+. -.... +--........|++|||--|.
T Consensus 210 ~~kl~HTDLKPENILfvss~~~~~-----~~~k~~~~~~r~~ks~~I~vIDFGsAt 260 (415)
T KOG0671|consen 210 DLKLTHTDLKPENILFVSSEYFKT-----YNPKKKVCFIRPLKSTAIKVIDFGSAT 260 (415)
T ss_pred hcceeecCCChheEEEeccceEEE-----eccCCccceeccCCCcceEEEecCCcc
Confidence 356999999999999986311100 00000 000122345679999996443
No 433
>KOG0663|consensus
Probab=82.38 E-value=2.3 Score=37.86 Aligned_cols=17 Identities=29% Similarity=0.421 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
.-+.|+||++.|+|++.
T Consensus 196 ~wilHRDLK~SNLLm~~ 212 (419)
T KOG0663|consen 196 NWILHRDLKTSNLLLSH 212 (419)
T ss_pred ceeEecccchhheeecc
Confidence 45889999999999986
No 434
>KOG0612|consensus
Probab=81.08 E-value=2.1 Score=43.22 Aligned_cols=19 Identities=26% Similarity=0.613 Sum_probs=16.6
Q ss_pred CeeeeeccCCCCCeeecCC
Q psy15664 26 PVTFCHNDLQEGNILYRES 44 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~ 44 (174)
...+.|+|++|.|||++..
T Consensus 193 ~mgyVHRDiKPDNvLld~~ 211 (1317)
T KOG0612|consen 193 SMGYVHRDIKPDNVLLDKS 211 (1317)
T ss_pred hccceeccCCcceeEeccc
Confidence 4679999999999999864
No 435
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=80.02 E-value=2.1 Score=42.70 Aligned_cols=16 Identities=31% Similarity=0.478 Sum_probs=14.5
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+||+|.|||+..
T Consensus 145 ~IVHRDLKPeNILL~s 160 (1021)
T PTZ00266 145 RVLHRDLKPQNIFLST 160 (1021)
T ss_pred CceeccCcHHHeEeec
Confidence 4899999999999975
No 436
>PHA03111 Ser/Thr kinase; Provisional
Probab=79.96 E-value=3.1 Score=37.24 Aligned_cols=22 Identities=36% Similarity=0.436 Sum_probs=18.1
Q ss_pred cCCCeeeeeccCCCCCeeecCC
Q psy15664 23 IKSPVTFCHNDLQEGNILYRES 44 (174)
Q Consensus 23 ~~~~~v~cHNDl~~gNiL~~~~ 44 (174)
.+..--|.|+||+|.|||+-++
T Consensus 298 lp~c~nF~H~DLKPdNILiFds 319 (444)
T PHA03111 298 LPCCDNFLHVDLKPDNILIFDS 319 (444)
T ss_pred CCCcceeeeccCCCCcEEEecC
Confidence 3444579999999999999985
No 437
>KOG0694|consensus
Probab=79.41 E-value=2.1 Score=40.81 Aligned_cols=56 Identities=20% Similarity=0.202 Sum_probs=42.7
Q ss_pred HHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHH
Q psy15664 10 NTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIA 89 (174)
Q Consensus 10 ~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDla 89 (174)
..|+....++|...+ +.++||+..|||++. ++-++|.||=.|--+--.-|-+
T Consensus 474 aAev~l~L~fLH~~~----IIYRDlKLdNiLLD~------------------------eGh~kiADFGlcKe~m~~g~~T 525 (694)
T KOG0694|consen 474 AAEVVLGLQFLHENG----IIYRDLKLDNLLLDT------------------------EGHVKIADFGLCKEGMGQGDRT 525 (694)
T ss_pred HHHHHHHHHHHHhcC----ceeeecchhheEEcc------------------------cCcEEecccccccccCCCCCcc
Confidence 357777777776644 889999999999986 5778999998887766555666
Q ss_pred HHHH
Q psy15664 90 NHFV 93 (174)
Q Consensus 90 n~f~ 93 (174)
+.||
T Consensus 526 sTfC 529 (694)
T KOG0694|consen 526 STFC 529 (694)
T ss_pred cccc
Confidence 6665
No 438
>KOG0590|consensus
Probab=79.40 E-value=1.7 Score=40.86 Aligned_cols=20 Identities=30% Similarity=0.499 Sum_probs=17.4
Q ss_pred CCeeeeeccCCCCCeeecCC
Q psy15664 25 SPVTFCHNDLQEGNILYRES 44 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~ 44 (174)
...+++|+|+++.|+++..+
T Consensus 437 h~~GiahrdlK~enll~~~~ 456 (601)
T KOG0590|consen 437 HSMGLAHRDLKLENLLVTEN 456 (601)
T ss_pred HhcCceeccCccccEEEecC
Confidence 45789999999999999873
No 439
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain; InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []: Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction []. Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases []. ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=79.27 E-value=3.1 Score=33.49 Aligned_cols=15 Identities=33% Similarity=0.541 Sum_probs=13.2
Q ss_pred eeeccCCCCCeeecC
Q psy15664 29 FCHNDLQEGNILYRE 43 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~ 43 (174)
++|+||.+.||+++.
T Consensus 124 iiH~~l~~~nill~~ 138 (259)
T PF07714_consen 124 IIHGNLSPSNILLDS 138 (259)
T ss_dssp EEEST-SGGGEEEET
T ss_pred ccccccccccccccc
Confidence 899999999999986
No 440
>KOG0665|consensus
Probab=79.20 E-value=1.2 Score=39.25 Aligned_cols=36 Identities=22% Similarity=0.380 Sum_probs=26.5
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA 85 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~ 85 (174)
...+.|+||+|.||++.. +..+.+.||=+|.--...
T Consensus 136 s~~IihRdLkPsnivv~~------------------------~~~lKi~dfg~ar~e~~~ 171 (369)
T KOG0665|consen 136 SAGIIHRDLKPSNIVVNS------------------------DCTLKILDFGLARTEDTD 171 (369)
T ss_pred hcceeecccCcccceecc------------------------hhheeeccchhhcccCcc
Confidence 457999999999999986 355777777776544333
No 441
>KOG0192|consensus
Probab=78.73 E-value=2.9 Score=36.82 Aligned_cols=17 Identities=35% Similarity=0.448 Sum_probs=15.5
Q ss_pred eeeccCCCCCeeecCCC
Q psy15664 29 FCHNDLQEGNILYRESP 45 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~ 45 (174)
+.|+||++.|||+....
T Consensus 164 iIHrDLK~~NiLv~~~~ 180 (362)
T KOG0192|consen 164 IIHRDLKSDNILVDLKG 180 (362)
T ss_pred eeecccChhhEEEcCCC
Confidence 99999999999999853
No 442
>KOG0664|consensus
Probab=78.58 E-value=1.5 Score=38.14 Aligned_cols=30 Identities=30% Similarity=0.511 Sum_probs=23.7
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
-.+-|+|++|||+|++. +--+++-||-.+.
T Consensus 175 A~ILHRDIKPGNLLVNS------------------------NCvLKICDFGLAR 204 (449)
T KOG0664|consen 175 ANILHRDIKPGNLLVNS------------------------NCILKICDFGLAR 204 (449)
T ss_pred cchhhccCCCccEEecc------------------------CceEEeccccccc
Confidence 35789999999999986 2458888887654
No 443
>KOG1027|consensus
Probab=78.38 E-value=2.4 Score=41.35 Aligned_cols=17 Identities=35% Similarity=0.528 Sum_probs=15.9
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
+-+.|+||+|.|||+..
T Consensus 625 l~iVHRDLkPQNILI~~ 641 (903)
T KOG1027|consen 625 LKIVHRDLKPQNILISV 641 (903)
T ss_pred cccccccCCCceEEEEc
Confidence 78999999999999986
No 444
>KOG1151|consensus
Probab=78.32 E-value=4.1 Score=37.79 Aligned_cols=17 Identities=41% Similarity=0.628 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecCC
Q psy15664 28 TFCHNDLQEGNILYRES 44 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~ 44 (174)
-+.|=||+|||||+-++
T Consensus 590 PIIHYDLKPgNILLv~G 606 (775)
T KOG1151|consen 590 PIIHYDLKPGNILLVNG 606 (775)
T ss_pred CeeeeccCCccEEEecC
Confidence 36899999999999864
No 445
>KOG0193|consensus
Probab=76.81 E-value=2.4 Score=40.08 Aligned_cols=17 Identities=35% Similarity=0.585 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
.-+.|.||+.+||++.+
T Consensus 507 K~IIHrDLKSnNIFl~~ 523 (678)
T KOG0193|consen 507 KNIIHRDLKSNNIFLHE 523 (678)
T ss_pred hhhhhhhccccceEEcc
Confidence 35899999999999987
No 446
>KOG0600|consensus
Probab=76.25 E-value=4.4 Score=37.63 Aligned_cols=18 Identities=28% Similarity=0.418 Sum_probs=15.7
Q ss_pred CeeeeeccCCCCCeeecC
Q psy15664 26 PVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~ 43 (174)
...+-|+|++..|||+++
T Consensus 236 ~~gvlHRDIK~SNiLidn 253 (560)
T KOG0600|consen 236 SRGVLHRDIKGSNILIDN 253 (560)
T ss_pred hcCeeeccccccceEEcC
Confidence 346889999999999987
No 447
>PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly. ; GO: 0004672 protein kinase activity, 0005524 ATP binding
Probab=76.19 E-value=2.7 Score=37.68 Aligned_cols=23 Identities=35% Similarity=0.450 Sum_probs=18.5
Q ss_pred cCCCeeeeeccCCCCCeeecCCC
Q psy15664 23 IKSPVTFCHNDLQEGNILYRESP 45 (174)
Q Consensus 23 ~~~~~v~cHNDl~~gNiL~~~~~ 45 (174)
.+..--|.|+||+|.|||+-++.
T Consensus 294 lp~c~nF~H~DLKPdNILiFds~ 316 (434)
T PF05445_consen 294 LPCCTNFLHVDLKPDNILIFDSK 316 (434)
T ss_pred CCCcceeeecccCcCcEEEecCC
Confidence 34445799999999999998853
No 448
>KOG0661|consensus
Probab=75.86 E-value=1.5 Score=40.29 Aligned_cols=19 Identities=37% Similarity=0.485 Sum_probs=16.4
Q ss_pred CCeeeeeccCCCCCeeecC
Q psy15664 25 SPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~ 43 (174)
..-.|-|+|++|.|||+..
T Consensus 127 Hk~GfFHRDlKPENiLi~~ 145 (538)
T KOG0661|consen 127 HKHGFFHRDLKPENILISG 145 (538)
T ss_pred HhcCcccccCChhheEecc
Confidence 3457999999999999984
No 449
>KOG0575|consensus
Probab=75.52 E-value=3.5 Score=38.71 Aligned_cols=17 Identities=35% Similarity=0.655 Sum_probs=15.4
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
..+.|+||+.|||++++
T Consensus 137 ~~IiHRDLKLGNlfL~~ 153 (592)
T KOG0575|consen 137 LGIIHRDLKLGNLFLNE 153 (592)
T ss_pred cCceecccchhheeecC
Confidence 45899999999999987
No 450
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=75.26 E-value=4.6 Score=31.30 Aligned_cols=16 Identities=31% Similarity=0.515 Sum_probs=14.7
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.++|+|++|.||++..
T Consensus 121 ~~~hrd~kp~nil~~~ 136 (384)
T COG0515 121 GIIHRDIKPENILLDR 136 (384)
T ss_pred CeeccCCCHHHeeecC
Confidence 3999999999999986
No 451
>KOG0585|consensus
Probab=74.27 E-value=2 Score=39.66 Aligned_cols=17 Identities=24% Similarity=0.493 Sum_probs=15.2
Q ss_pred eeeeccCCCCCeeecCC
Q psy15664 28 TFCHNDLQEGNILYRES 44 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~ 44 (174)
.+.|+|++|.|+|+...
T Consensus 230 giiHRDIKPsNLLl~~~ 246 (576)
T KOG0585|consen 230 GIIHRDIKPSNLLLSSD 246 (576)
T ss_pred CeeccccchhheEEcCC
Confidence 58999999999999873
No 452
>KOG1989|consensus
Probab=73.97 E-value=3.6 Score=39.74 Aligned_cols=34 Identities=21% Similarity=0.274 Sum_probs=25.6
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
.=+.|+||+-.|||+.. ++..+|-||==|+-..+
T Consensus 165 pPiIHRDLKiENvLls~------------------------~g~~KLCDFGSatt~~~ 198 (738)
T KOG1989|consen 165 PPIIHRDLKIENVLLSA------------------------DGNYKLCDFGSATTKIL 198 (738)
T ss_pred CccchhhhhhhheEEcC------------------------CCCEEeCcccccccccC
Confidence 34799999999999986 46788888865544333
No 453
>KOG0666|consensus
Probab=73.09 E-value=2.6 Score=37.25 Aligned_cols=15 Identities=40% Similarity=0.518 Sum_probs=13.8
Q ss_pred eeeccCCCCCeeecC
Q psy15664 29 FCHNDLQEGNILYRE 43 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~ 43 (174)
+.|+||+|.|||+..
T Consensus 153 vlHRDLKPaNIlvmg 167 (438)
T KOG0666|consen 153 VLHRDLKPANILVMG 167 (438)
T ss_pred eeeccCCcceEEEec
Confidence 679999999999986
No 454
>KOG3021|consensus
Probab=73.03 E-value=12 Score=31.84 Aligned_cols=40 Identities=20% Similarity=0.272 Sum_probs=27.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHH
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHF 92 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f 92 (174)
++.|+||+.||+-.+.. +.-++.|- -+.|+..-||+|-..
T Consensus 211 aLlHGDLW~GNva~D~~------------------------~ePiIfDP-asfYgh~Efefgia~ 250 (313)
T KOG3021|consen 211 ALLHGDLWSGNVAEDGA------------------------GEPIIFDP-ASFYGHSEFEFGIAK 250 (313)
T ss_pred hhhccccccCcccccCC------------------------CCceEeCc-hhhcCCcHHHHHHHH
Confidence 57799999999877652 22356564 245778888887543
No 455
>KOG1165|consensus
Probab=69.52 E-value=12 Score=33.60 Aligned_cols=34 Identities=18% Similarity=0.301 Sum_probs=25.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
-+.-+|++|.|+|+...... ...-|.+|||-.|-
T Consensus 144 ~LIYRDIKPdNFLIGrp~~k-------------------~~n~IhiiDFGmAK 177 (449)
T KOG1165|consen 144 DLIYRDIKPDNFLIGRPGTK-------------------DANVIHIIDFGMAK 177 (449)
T ss_pred ceeecccCccceeecCCCCC-------------------CCceEEEEeccchh
Confidence 47789999999999763211 34679999996554
No 456
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=67.94 E-value=8.5 Score=33.02 Aligned_cols=38 Identities=21% Similarity=0.264 Sum_probs=23.2
Q ss_pred HHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 14 DWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 14 ~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
-.+-+.+...+ +.|+|+++.|++++. ++.+.|=||...
T Consensus 155 I~lvA~Lh~~G----lVHgdi~~~nfll~~------------------------~G~v~Lg~F~~~ 192 (288)
T PF14531_consen 155 IRLVANLHSYG----LVHGDIKPENFLLDQ------------------------DGGVFLGDFSSL 192 (288)
T ss_dssp HHHHHHHHHTT----EEEST-SGGGEEE-T------------------------TS-EEE--GGGE
T ss_pred HHHHHHHhhcc----eEecccceeeEEEcC------------------------CCCEEEcChHHH
Confidence 33444444534 999999999999986 467888887654
No 457
>KOG1345|consensus
Probab=64.58 E-value=11 Score=32.97 Aligned_cols=31 Identities=26% Similarity=0.420 Sum_probs=24.0
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
-+.|+||+..|||+-.. +-.++.|-||--..
T Consensus 141 nlVHRdlK~eNiLif~~----------------------df~rvKlcDFG~t~ 171 (378)
T KOG1345|consen 141 NLVHRDLKAENILIFDA----------------------DFYRVKLCDFGLTR 171 (378)
T ss_pred chhhcccccceEEEecC----------------------CccEEEeeeccccc
Confidence 37899999999998863 34678888885443
No 458
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st
Probab=63.44 E-value=6.5 Score=32.54 Aligned_cols=32 Identities=25% Similarity=0.120 Sum_probs=26.9
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++.=+|-+++|||++. ..+.+.-|||.++-
T Consensus 135 ~YilglgDRH~~NIli~~-----------------------~tG~v~HIDfg~~f 166 (235)
T cd05172 135 HWILGIGDRHLSNFLVDL-----------------------ETGGLVGIDFGHAF 166 (235)
T ss_pred hheeeccCCCcccEEEEC-----------------------CCCcEEEEeeHhhh
Confidence 468999999999999985 35789999997553
No 459
>PF02604 PhdYeFM_antitox: Antitoxin Phd_YefM, type II toxin-antitoxin system; InterPro: IPR006442 This entry is represented by Bacteriophage P1, prevent-host-death protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family of proteins is characterised by a region of about 55 amino acids toward the N-terminal end of bacterial proteins which are themselves only 85 amino acids, or thereabouts, in length. The best-characterised member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (IPR006440 from INTERPRO) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family. ; PDB: 3DBO_A 2ODK_B 3G5O_D 2A6Q_B 3D55_C 3OEI_E 3CTO_C 3K33_D 3KH2_F 3HS2_C ....
Probab=63.09 E-value=8.3 Score=25.43 Aligned_cols=33 Identities=18% Similarity=0.229 Sum_probs=28.4
Q ss_pred CCccchhhHHHHHHHHHHHHhhcCCCeeeeecc
Q psy15664 1 MKKILSKDLNTEADWLKKHLLKIKSPVTFCHND 33 (174)
Q Consensus 1 ~~~~~~~~L~~e~~~l~~~l~~~~~~~v~cHND 33 (174)
|+.++..++++.+..+.+.+...+.|+++..|.
T Consensus 1 M~~vs~~e~r~~~~~~l~~v~~~~~pv~It~~g 33 (75)
T PF02604_consen 1 MKTVSITEFRNNFSELLDEVEEGEEPVIITKNG 33 (75)
T ss_dssp CEEEEHHHHHHTHHHHHHHHHHCT-EEEEEETT
T ss_pred CCEecHHHHHHHHHHHHHHHHcCCCeEEEEECC
Confidence 789999999999999999999888889887764
No 460
>KOG0584|consensus
Probab=62.60 E-value=11 Score=35.61 Aligned_cols=17 Identities=29% Similarity=0.446 Sum_probs=14.9
Q ss_pred eeeeccCCCCCeeecCC
Q psy15664 28 TFCHNDLQEGNILYRES 44 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~ 44 (174)
-+.|+||++.||+++.+
T Consensus 165 PIIHRDLKCDNIFinG~ 181 (632)
T KOG0584|consen 165 PIIHRDLKCDNIFVNGN 181 (632)
T ss_pred CccccccccceEEEcCC
Confidence 36899999999999874
No 461
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the
Probab=61.82 E-value=5.5 Score=32.35 Aligned_cols=35 Identities=20% Similarity=0.163 Sum_probs=28.3
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY 83 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 83 (174)
..++.=+|-+++|||++. .++.+.-|||.++--..
T Consensus 127 ~YilglgDRh~~NIli~~-----------------------~~G~~~hIDfg~~~~~~ 161 (219)
T cd00142 127 GYILGIGDRHPDNIMIDL-----------------------DTGKLFHIDFGFIFGKR 161 (219)
T ss_pred HHHhccCCCCCccEEEEC-----------------------CCCeEEEEeeHHhhCcC
Confidence 457888999999999997 35889999998764333
No 462
>KOG2270|consensus
Probab=61.41 E-value=7.5 Score=35.39 Aligned_cols=18 Identities=39% Similarity=0.665 Sum_probs=16.0
Q ss_pred CeeeeeccCCCCCeeecC
Q psy15664 26 PVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~ 43 (174)
...+.|-||-.-|+|+.+
T Consensus 283 ~c~LVHADLSEfN~Lyhd 300 (520)
T KOG2270|consen 283 KCRLVHADLSEFNLLYHD 300 (520)
T ss_pred HhceeccchhhhhheEEC
Confidence 356999999999999997
No 463
>KOG0574|consensus
Probab=61.11 E-value=2.7 Score=37.15 Aligned_cols=15 Identities=40% Similarity=0.656 Sum_probs=13.5
Q ss_pred eeeccCCCCCeeecC
Q psy15664 29 FCHNDLQEGNILYRE 43 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~ 43 (174)
=.|+|++.||||++.
T Consensus 150 KIHRDIKAGNILLNT 164 (502)
T KOG0574|consen 150 KIHRDIKAGNILLNT 164 (502)
T ss_pred HHHhhcccccEEEcc
Confidence 479999999999986
No 464
>KOG2269|consensus
Probab=60.51 E-value=8.6 Score=34.61 Aligned_cols=50 Identities=20% Similarity=0.294 Sum_probs=37.1
Q ss_pred cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664 4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY 78 (174)
Q Consensus 4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY 78 (174)
|+-+++..-+..+...+.+.-....+.|-||..-|||... +++.|||---
T Consensus 380 l~d~E~~~aY~q~~~~M~~lY~Ec~LVHADlSEyN~Lw~~-------------------------gKvw~IDVsQ 429 (531)
T KOG2269|consen 380 LTDDERRNAYDQVQSIMCRLYKECLLVHADLSEYNLLWTP-------------------------GKVWVIDVSQ 429 (531)
T ss_pred cChHHHHHHHHHHHHHHHHHHHhhheeecchhhhhheecC-------------------------CceEEEechh
Confidence 4455555555555555555556678999999999999987 6899999643
No 465
>KOG0662|consensus
Probab=60.33 E-value=5.2 Score=32.97 Aligned_cols=13 Identities=38% Similarity=0.657 Sum_probs=11.6
Q ss_pred eccCCCCCeeecC
Q psy15664 31 HNDLQEGNILYRE 43 (174)
Q Consensus 31 HNDl~~gNiL~~~ 43 (174)
|+||+|.|+|++.
T Consensus 124 hrdlkpqnllin~ 136 (292)
T KOG0662|consen 124 HRDLKPQNLLINR 136 (292)
T ss_pred hccCCcceEEecc
Confidence 4799999999986
No 466
>KOG1240|consensus
Probab=59.55 E-value=4.4 Score=41.12 Aligned_cols=19 Identities=32% Similarity=0.656 Sum_probs=16.4
Q ss_pred CCeeeeeccCCCCCeeecC
Q psy15664 25 SPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~ 43 (174)
.+..+||+|++..|||++.
T Consensus 137 H~~gVcHGDIKsENILiTS 155 (1431)
T KOG1240|consen 137 HKLGVCHGDIKSENILITS 155 (1431)
T ss_pred HHcCccccccccceEEEee
Confidence 4567999999999999874
No 467
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno
Probab=57.97 E-value=7.1 Score=33.55 Aligned_cols=30 Identities=23% Similarity=0.360 Sum_probs=25.8
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.|+.=+|-+++|||++. ..+.++-|||.++
T Consensus 209 yilglgDRh~~NIli~~-----------------------~tG~v~hiDf~~~ 238 (307)
T cd05170 209 YVIGLGDRHLDNVLIDL-----------------------KTGEVVHIDYNVC 238 (307)
T ss_pred HHccCCCCCCccEEEEc-----------------------CCCcEEEEeeHhh
Confidence 57888999999999996 3578999999764
No 468
>KOG1290|consensus
Probab=57.77 E-value=9.2 Score=35.58 Aligned_cols=43 Identities=14% Similarity=0.140 Sum_probs=30.9
Q ss_pred CccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCC
Q psy15664 2 KKILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRES 44 (174)
Q Consensus 2 ~~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~ 44 (174)
+.|++..+++=...+..-|......+.+.|-||+|.|||+.-+
T Consensus 182 rGlpl~~VK~I~~qvL~GLdYLH~ecgIIHTDlKPENvLl~~~ 224 (590)
T KOG1290|consen 182 RGLPLSCVKEICRQVLTGLDYLHRECGIIHTDLKPENVLLCST 224 (590)
T ss_pred CCCcHHHHHHHHHHHHHHHHHHHHhcCccccCCCcceeeeecc
Confidence 3456666665555555555666777899999999999997643
No 469
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transi
Probab=57.66 E-value=7 Score=33.07 Aligned_cols=31 Identities=26% Similarity=0.322 Sum_probs=26.4
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
..++.=+|-+++|||++. ..+.+.-|||.++
T Consensus 180 ~yilglgDRh~~NIll~~-----------------------~tG~v~hiDf~~~ 210 (279)
T cd05171 180 GYILGLGDRHANNILIDE-----------------------KTAEVVHIDLGIA 210 (279)
T ss_pred HHhhccCCCCcccEEEEc-----------------------CcCcEEEEechhh
Confidence 357888999999999986 3578999999875
No 470
>KOG4717|consensus
Probab=57.13 E-value=11 Score=35.59 Aligned_cols=18 Identities=28% Similarity=0.571 Sum_probs=15.5
Q ss_pred CeeeeeccCCCCCeeecC
Q psy15664 26 PVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~ 43 (174)
.+-..|+||+|.|+.+-+
T Consensus 136 qLHVVHRDLKPENVVFFE 153 (864)
T KOG4717|consen 136 QLHVVHRDLKPENVVFFE 153 (864)
T ss_pred hhhhhcccCCcceeEEee
Confidence 455779999999999987
No 471
>PF10009 DUF2252: Uncharacterized protein conserved in bacteria (DUF2252); InterPro: IPR018721 This domain has no known function.
Probab=56.94 E-value=18 Score=32.26 Aligned_cols=76 Identities=16% Similarity=0.189 Sum_probs=51.0
Q ss_pred CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCce--EEEeeecccCccchhhHHHHHHHHhhhccC
Q psy15664 24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDL--VVIDFEYCSYNYRAFDIANHFVESVYDYSY 101 (174)
Q Consensus 24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l--~lIDfEYa~~n~~~fDlan~f~E~~~dy~~ 101 (174)
..+.|.+++|+|.+|+=.-.+++ +.+ -+=||+=+.++|..|||--.......
T Consensus 40 ~~~~v~icGD~Hl~NFG~~~~~~----------------------~~~vFdiNDFDEa~~gp~~wDl~Rla~Si~l---- 93 (385)
T PF10009_consen 40 SGPPVWICGDAHLENFGAFASPE----------------------GRVVFDINDFDEALPGPFEWDLKRLATSIVL---- 93 (385)
T ss_pred CCCceEEeccchhhccCcccCCC----------------------CCEEecCCCCCcCCcCChHHHHHHHHHHHHH----
Confidence 35789999999999998776432 233 24589999999999999666554331
Q ss_pred CCCCcccccCCCCCCH---HHHHHHHHHHHhcc
Q psy15664 102 KHFPHYTVKRENYPSY---SLRKSFVETYLSRM 131 (174)
Q Consensus 102 ~~~p~~~~~~~~~p~~---~~~~~fl~~Yl~~~ 131 (174)
......++.. +....|+++|...+
T Consensus 94 ------aa~~~gl~~~~~~~~~~~~~~~Y~~~l 120 (385)
T PF10009_consen 94 ------AARENGLSDKDARKAVRAFLEGYREAL 120 (385)
T ss_pred ------HHHHcCCCHHHHHHHHHHHHHHHHHHH
Confidence 1122334332 33568888888765
No 472
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with
Probab=56.77 E-value=8.1 Score=32.52 Aligned_cols=31 Identities=23% Similarity=0.311 Sum_probs=26.1
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
..++.=+|-|++|||++. ..+.++-|||.++
T Consensus 180 ~YilglgDRH~~NIll~~-----------------------~tG~v~HIDfg~~ 210 (280)
T cd05169 180 GYILGLGDRHPSNIMIDR-----------------------LTGKVIHIDFGDC 210 (280)
T ss_pred HhheeccCCCcceEEEEc-----------------------CCCCEEEEecHHH
Confidence 467899999999999997 4588999999644
No 473
>KOG0597|consensus
Probab=56.63 E-value=13 Score=35.52 Aligned_cols=39 Identities=21% Similarity=0.248 Sum_probs=23.6
Q ss_pred cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664 4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
++.+.+++=..-|-..+.... ...+.|+|++|-|||+..
T Consensus 97 lpEe~v~~~a~~LVsaL~yLh-s~rilhrd~kPqniLl~~ 135 (808)
T KOG0597|consen 97 LPEEQVRAIAYDLVSALYYLH-SNRILHRDMKPQNILLEK 135 (808)
T ss_pred CCHHHHHHHHHHHHHHHHHHH-hcCcccccCCcceeeecC
Confidence 444444433333333343332 245889999999999986
No 474
>KOG4158|consensus
Probab=56.14 E-value=17 Score=33.45 Aligned_cols=21 Identities=29% Similarity=0.423 Sum_probs=16.8
Q ss_pred eeeeeccCCCCCeeecCCCCC
Q psy15664 27 VTFCHNDLQEGNILYRESPNN 47 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~ 47 (174)
-.+.|+||++.|||+.-.++.
T Consensus 360 hgvAhRDlKSDNiL~ElddD~ 380 (598)
T KOG4158|consen 360 HGVAHRDLKSDNILLELDDDE 380 (598)
T ss_pred ccchhhcccccceEEEecCCC
Confidence 468999999999998765443
No 475
>KOG0587|consensus
Probab=55.88 E-value=18 Score=35.80 Aligned_cols=17 Identities=29% Similarity=0.485 Sum_probs=15.2
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
.-..|+|++-.|||++.
T Consensus 142 nkviHRDikG~NiLLT~ 158 (953)
T KOG0587|consen 142 NKVIHRDIKGQNVLLTE 158 (953)
T ss_pred cceeeecccCceEEEec
Confidence 45789999999999987
No 476
>KOG2052|consensus
Probab=53.05 E-value=17 Score=33.50 Aligned_cols=25 Identities=24% Similarity=0.391 Sum_probs=20.2
Q ss_pred cCCCeeeeeccCCCCCeeecCCCCC
Q psy15664 23 IKSPVTFCHNDLQEGNILYRESPNN 47 (174)
Q Consensus 23 ~~~~~v~cHNDl~~gNiL~~~~~~~ 47 (174)
.+.+-.+.|+||++.|||+..+...
T Consensus 331 TqgKPaIAHRDlKSKNILVKkn~~C 355 (513)
T KOG2052|consen 331 TQGKPAIAHRDLKSKNILVKKNGTC 355 (513)
T ss_pred CCCCchhhccccccccEEEccCCcE
Confidence 3466789999999999999876443
No 477
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central
Probab=53.04 E-value=9 Score=31.68 Aligned_cols=32 Identities=28% Similarity=0.342 Sum_probs=26.5
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..++.=+|-+++|||++. ..+.+.-|||.++-
T Consensus 138 ~YilgigDRh~~NIli~~-----------------------~tG~~~HIDfg~~~ 169 (237)
T cd00892 138 GYILGLGDRHGENILFDS-----------------------NTGDVVHVDFNCLF 169 (237)
T ss_pred HHHhccCCCCcccEEEEc-----------------------CCCcEEEEehHhhh
Confidence 357888999999999987 35789999997654
No 478
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members include ATM (Ataxia telangiectasia mutated), ATR (Ataxia telangiectasia and Rad3-related), TOR (Target of rapamycin), SMG-1 (Suppressor of morphogenetic effect on genitalia-1), and DNA-PK (DNA-dependent protein kinase). PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). They show strong preference for phosphorylating serine/threonine residues followed by a glutamine and are also referred to as (S/T)-Q-directed kinases. They all contain a FATC (FRAP, ATM and TRRAP, C-terminal) d
Probab=52.88 E-value=8.3 Score=31.55 Aligned_cols=32 Identities=25% Similarity=0.217 Sum_probs=26.5
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS 80 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 80 (174)
..|+.=+|-+++|||++. ..+.+.-|||-++-
T Consensus 130 ~YvlglgDRh~~NIli~~-----------------------~tG~v~hIDf~~~~ 161 (222)
T cd05164 130 GYILGLGDRHLDNILIDR-----------------------ETGEVVHIDFGCIF 161 (222)
T ss_pred HHHhccCCCCCceEEEEC-----------------------CCCcEEEEccHHhh
Confidence 357888999999999997 45789999997653
No 479
>KOG0201|consensus
Probab=52.68 E-value=16 Score=33.38 Aligned_cols=29 Identities=31% Similarity=0.435 Sum_probs=23.6
Q ss_pred eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
-.|+|++..|||+.. ++.++|-||-+++.
T Consensus 132 kiHrDIKaanil~s~------------------------~g~vkl~DfgVa~q 160 (467)
T KOG0201|consen 132 KIHRDIKAANILLSE------------------------SGDVKLADFGVAGQ 160 (467)
T ss_pred eecccccccceeEec------------------------cCcEEEEecceeee
Confidence 579999999999987 35678888877764
No 480
>KOG0611|consensus
Probab=52.51 E-value=7.4 Score=35.74 Aligned_cols=17 Identities=35% Similarity=0.468 Sum_probs=14.7
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
-...|+||+..|||++.
T Consensus 172 nrVvHRDLKLENILLD~ 188 (668)
T KOG0611|consen 172 NRVVHRDLKLENILLDQ 188 (668)
T ss_pred ccceecccchhheeecC
Confidence 34679999999999987
No 481
>KOG1152|consensus
Probab=52.00 E-value=20 Score=34.21 Aligned_cols=33 Identities=24% Similarity=0.428 Sum_probs=27.6
Q ss_pred CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
....+.|+|++-.|+++.. ++-++||||--|++
T Consensus 687 h~~~ivhrdikdenvivd~------------------------~g~~klidfgsaa~ 719 (772)
T KOG1152|consen 687 HDQGIVHRDIKDENVIVDS------------------------NGFVKLIDFGSAAY 719 (772)
T ss_pred cccCceecccccccEEEec------------------------CCeEEEeeccchhh
Confidence 3467999999999999986 57899999976665
No 482
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=51.02 E-value=9.7 Score=31.06 Aligned_cols=36 Identities=22% Similarity=0.505 Sum_probs=26.3
Q ss_pred eeeeeccCCC--CCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664 27 VTFCHNDLQE--GNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD 87 (174)
Q Consensus 27 ~v~cHNDl~~--gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD 87 (174)
..+-|+.++- .|||+.+ +++++||||-|+++-..=-
T Consensus 124 ~GI~H~El~~~~k~vlv~~-------------------------~~~~iIDFd~At~k~~p~N 161 (201)
T COG2112 124 LGIEHGELSRPWKNVLVND-------------------------RDVYIIDFDSATFKKKPRN 161 (201)
T ss_pred hccchhhhcCCceeEEecC-------------------------CcEEEEEccchhhccCCch
Confidence 4678888875 4777754 5899999999986544433
No 483
>KOG0580|consensus
Probab=50.99 E-value=15 Score=31.38 Aligned_cols=23 Identities=26% Similarity=0.342 Sum_probs=16.6
Q ss_pred HhhcCCCeeeeeccCCCCCeeecC
Q psy15664 20 LLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 20 l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
+.....+. +.|+|++|.|+|+.-
T Consensus 137 l~y~h~k~-VIhRdiKpenlLlg~ 159 (281)
T KOG0580|consen 137 LLYCHLKR-VIHRDIKPENLLLGS 159 (281)
T ss_pred HHHhccCC-cccCCCCHHHhccCC
Confidence 33444444 579999999999875
No 484
>KOG0907|consensus
Probab=50.09 E-value=34 Score=24.72 Aligned_cols=43 Identities=26% Similarity=0.344 Sum_probs=33.5
Q ss_pred CCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCcccccCCC
Q psy15664 68 NIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKREN 113 (174)
Q Consensus 68 ~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~ 113 (174)
.+++++||| ||.+..|+==|+-.|++.+-.|.. .-.++++-+.
T Consensus 20 ~~kliVvdF-~a~wCgPCk~i~P~~~~La~~y~~--v~Flkvdvde 62 (106)
T KOG0907|consen 20 GDKLVVVDF-YATWCGPCKAIAPKFEKLAEKYPD--VVFLKVDVDE 62 (106)
T ss_pred CCCeEEEEE-ECCCCcchhhhhhHHHHHHHHCCC--CEEEEEeccc
Confidence 368999999 999999999999999998877654 3344444443
No 485
>KOG1236|consensus
Probab=49.69 E-value=8.2 Score=35.55 Aligned_cols=18 Identities=44% Similarity=0.750 Sum_probs=15.6
Q ss_pred eeeccCCCCCeeecCCCC
Q psy15664 29 FCHNDLQEGNILYRESPN 46 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~~ 46 (174)
|.|-|++||||++.-.+.
T Consensus 366 FvHaDlHPGNVlirf~~t 383 (565)
T KOG1236|consen 366 FVHADLHPGNVLIRFNKT 383 (565)
T ss_pred ceecccCCCcEEEEecCC
Confidence 899999999999987543
No 486
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phosphoinositide 3-kinase isoforms participate in a variety of processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
Probab=49.52 E-value=13 Score=29.66 Aligned_cols=35 Identities=23% Similarity=0.224 Sum_probs=27.5
Q ss_pred CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
..++.=+|-+++|||++. .+.+.=|||.++--..+
T Consensus 100 ~YilglgDRh~~NIli~~------------------------~G~v~hIDfg~~~~~~~ 134 (202)
T smart00146 100 TYILGLGDRHNDNIMLDK------------------------TGHLFHIDFGFILGNGP 134 (202)
T ss_pred HHHhcCCCCCCCcEEEeC------------------------CCCEEEEechhhhCccc
Confidence 357788999999999984 47899999987664443
No 487
>KOG2464|consensus
Probab=49.15 E-value=18 Score=29.83 Aligned_cols=30 Identities=33% Similarity=0.372 Sum_probs=22.7
Q ss_pred HHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664 14 DWLKKHLLKIKSPVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 14 ~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~ 43 (174)
..+...+...+....+-|+|++.||||+..
T Consensus 144 ~q~~~~l~i~~~~~~~~hrdl~~gnili~k 173 (246)
T KOG2464|consen 144 WQLVLSLAIAEKSLGFEHRDLHLGNILIKK 173 (246)
T ss_pred HHHHHHHHHhhhhhcccccccCcCcEEEec
Confidence 333344445567788999999999999987
No 488
>KOG3653|consensus
Probab=49.11 E-value=34 Score=31.74 Aligned_cols=23 Identities=22% Similarity=0.362 Sum_probs=18.5
Q ss_pred CCeeeeeccCCCCCeeecCCCCC
Q psy15664 25 SPVTFCHNDLQEGNILYRESPNN 47 (174)
Q Consensus 25 ~~~v~cHNDl~~gNiL~~~~~~~ 47 (174)
.+-.+.|+|+++.|||+.++...
T Consensus 333 ~Kp~IaHRDlkSkNVLvK~DlTc 355 (534)
T KOG3653|consen 333 HKPPIAHRDLKSKNVLVKNDLTC 355 (534)
T ss_pred CCCccccccccccceEEccCCcE
Confidence 45679999999999999875433
No 489
>KOG0589|consensus
Probab=44.68 E-value=15 Score=33.32 Aligned_cols=18 Identities=28% Similarity=0.381 Sum_probs=15.6
Q ss_pred CeeeeeccCCCCCeeecC
Q psy15664 26 PVTFCHNDLQEGNILYRE 43 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~ 43 (174)
..-+-|+||++.||+++.
T Consensus 124 ~~~iLHRDlK~~Nifltk 141 (426)
T KOG0589|consen 124 ENRVLHRDLKCANIFLTK 141 (426)
T ss_pred hhhhhcccchhhhhhccc
Confidence 456789999999999987
No 490
>PF00454 PI3_PI4_kinase: Phosphatidylinositol 3- and 4-kinase; InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Phosphatidylinositol 3-kinase (PI3-kinase) (2.7.1.137 from EC) [] is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. The three products of PI3-kinase - PI-3-P, PI-3,4-P(2) and PI-3,4,5-P(3) function as secondary messengers in cell signalling. Phosphatidylinositol 4-kinase (PI4-kinase) (2.7.1.67 from EC) [] is an enzyme that acts on phosphatidylinositol (PI) in the first committed step in the production of the secondary messenger inositol-1'4'5'-trisphosphate. This domain is also present in a wide range of protein kinases, involved in diverse cellular functions, such as control of cell growth, regulation of cell cycle progression, a DNA damage checkpoint, recombination, and maintenance of telomere length. Despite significant homology to lipid kinases, no lipid kinase activity has been demonstrated for any of the PIK-related kinases []. The PI3- and PI4-kinases share a well conserved domain at their C-terminal section; this domain seems to be distantly related to the catalytic domain of protein kinases [, ]. The catalytic domain of PI3K has the typical bilobal structure that is seen in other ATP-dependent kinases, with a small N-terminal lobe and a large C-terminal lobe. The core of this domain is the most conserved region of the PI3Ks. The ATP cofactor binds in the crevice formed by the N-and C-terminal lobes, a loop between two strands provides a hydrophobic pocket for binding of the adenine moiety, and a lysine residue interacts with the alpha-phosphate. In contrast to protein kinases, the PI3K loop which interacts with the phosphates of the ATP and is known as the glycine-rich or P-loop, contains no glycine residues. Instead, contact with the ATP -phosphate is maintained through the side chain of a conserved serine residue.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 2WXL_A 4AJW_B 2WXQ_A 2WXP_A 2WXM_A 2WXH_A 2WXK_A 2WXG_A 2X38_A 2WXF_A ....
Probab=43.80 E-value=14 Score=29.70 Aligned_cols=32 Identities=28% Similarity=0.369 Sum_probs=19.6
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY 81 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 81 (174)
.++.=+|=+++|||+.. ..+.++-|||.++-.
T Consensus 134 yilg~gDRh~~Nili~~-----------------------~~g~~~hIDfg~~f~ 165 (235)
T PF00454_consen 134 YILGLGDRHPGNILIDK-----------------------KTGELIHIDFGFIFG 165 (235)
T ss_dssp HHHT-CS--TTTEEE-E-----------------------TTSEEEE--HSSCTT
T ss_pred EEEeecCCCchhheecc-----------------------ccceeeeEEeHHhhh
Confidence 45666799999999954 357899999976653
No 491
>KOG0906|consensus
Probab=43.77 E-value=3.2e+02 Score=26.69 Aligned_cols=71 Identities=18% Similarity=0.117 Sum_probs=48.5
Q ss_pred ccchhhHHHHHHHHHHHHhhcC--------------------------CCeeeeeccCCCCCeeecCCCCCCCCCCCCCC
Q psy15664 3 KILSKDLNTEADWLKKHLLKIK--------------------------SPVTFCHNDLQEGNILYRESPNNNNNNNNNNN 56 (174)
Q Consensus 3 ~~~~~~L~~e~~~l~~~l~~~~--------------------------~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~ 56 (174)
+.++..+..+...+..+++... ...++.-+|=+.+|+|++.
T Consensus 644 s~~la~Ils~~~~I~~ylke~~p~e~ap~gi~~~v~dnfVkScaGYsVitYILGvGDRhldNLllT~------------- 710 (843)
T KOG0906|consen 644 SKPLARILSEYHSILMYLKEDRPDENAPFGISPEVMDNFVKSCAGYSVITYILGVGDRHLDNLLLTK------------- 710 (843)
T ss_pred CCcHHHHHHHHHHHHHHHHhhCCCcCCCCCCChhHHHHHHHhhccceeeeeeecccCCCcCceEEcc-------------
Confidence 4556666666666666664221 1235667899999999986
Q ss_pred CCCCCCCCCCCCCceEEEeeeccc-----CccchhhHHHHHHHHhh
Q psy15664 57 NNNVNNSSNNNNIDLVVIDFEYCS-----YNYRAFDIANHFVESVY 97 (174)
Q Consensus 57 ~~~~~~~~~~~~~~l~lIDfEYa~-----~n~~~fDlan~f~E~~~ 97 (174)
++++.=|||-|.- +-++..-|+--+.|-|.
T Consensus 711 -----------dGk~FHiDFgyIlGRDPKP~pp~MkL~kemve~mg 745 (843)
T KOG0906|consen 711 -----------DGKLFHIDFGYILGRDPKPFPPPMKLAKEMVEGMG 745 (843)
T ss_pred -----------CCcEEEEeeeeeccCCCCCCCCccccCHHHHHHhc
Confidence 5889999998852 34556667777777663
No 492
>KOG4721|consensus
Probab=43.17 E-value=20 Score=34.35 Aligned_cols=16 Identities=38% Similarity=0.486 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+||+.-|||+..
T Consensus 232 KIIHRDLKSPNiLIs~ 247 (904)
T KOG4721|consen 232 KIIHRDLKSPNILISY 247 (904)
T ss_pred hHhhhccCCCceEeec
Confidence 4789999999999986
No 493
>PF12377 DuffyBP_N: Duffy binding protein N terminal ; InterPro: IPR021032 This entry represents the N terminus of the Duffy-antigen binding protein and is thought to bind to the human erythrocytes Duffy blood group determinant. These domains are found in eukaryotic proteins and are approximately 70 amino acids in length [].
Probab=40.44 E-value=46 Score=21.97 Aligned_cols=27 Identities=26% Similarity=0.300 Sum_probs=23.1
Q ss_pred CCCCceEEEeeecccCccchhhHHHHH
Q psy15664 66 NNNIDLVVIDFEYCSYNYRAFDIANHF 92 (174)
Q Consensus 66 ~~~~~l~lIDfEYa~~n~~~fDlan~f 92 (174)
.....++.+|||.++-+.|+.=|-|.+
T Consensus 18 eg~~nlvmldyd~s~nghp~g~~dnvl 44 (66)
T PF12377_consen 18 EGCNNLVMLDYDTSSNGHPAGTIDNVL 44 (66)
T ss_pred ccccceEEEEeeccCCCCcCchhhhHH
Confidence 345679999999999999999888865
No 494
>PF13575 DUF4135: Domain of unknown function (DUF4135)
Probab=39.10 E-value=19 Score=31.52 Aligned_cols=29 Identities=28% Similarity=0.166 Sum_probs=21.7
Q ss_pred eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664 29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN 82 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 82 (174)
+-=+|+|..||+... ..-++||.|...-+
T Consensus 150 L~~~DlH~ENIIa~g-------------------------~~PvlIDlETlf~~ 178 (370)
T PF13575_consen 150 LNGTDLHFENIIASG-------------------------EYPVLIDLETLFHP 178 (370)
T ss_pred hCCCcccccceEEeC-------------------------CCcEEEehhhhCCc
Confidence 444799999999875 45678888876655
No 495
>KOG0669|consensus
Probab=38.73 E-value=16 Score=31.68 Aligned_cols=17 Identities=24% Similarity=0.479 Sum_probs=15.1
Q ss_pred eeeeeccCCCCCeeecC
Q psy15664 27 VTFCHNDLQEGNILYRE 43 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~ 43 (174)
.-+.|+|.++.|+|++.
T Consensus 143 ~kilHRDmKaaNvLIt~ 159 (376)
T KOG0669|consen 143 NKILHRDMKAANVLITK 159 (376)
T ss_pred hhHHhhcccHhhEEEcC
Confidence 45789999999999986
No 496
>cd05163 TRRAP TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TRRAP shows some similarity to members of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily in that it contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain and has a large molecular weight. Unlike PIKK proteins, however, it contains an inactive PI3K-like pseudokinase domain, which lacks the conserved residues necessary for ATP binding and catalytic activity. TRRAP also contains many motifs that may be critical for protein-protein interactions. TRRAP is a common component of many histone acetyltransferase (HAT) complexes, and is responsible for the recruitment of these complexes to chromatin during transcription, replicat
Probab=38.57 E-value=22 Score=29.67 Aligned_cols=30 Identities=10% Similarity=0.083 Sum_probs=25.4
Q ss_pred eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.++.=+|-+++|||++. ..+.++-|||-.+
T Consensus 154 YilglgdRh~~nili~~-----------------------~tG~v~hiDf~~~ 183 (253)
T cd05163 154 YILSINNRNPDKIFISR-----------------------DTGNVYQSDLLPS 183 (253)
T ss_pred HHhcCCCCCchhEEEEc-----------------------CCCcEEEEeeeee
Confidence 57888999999999987 4578999999743
No 497
>KOG0033|consensus
Probab=38.46 E-value=22 Score=30.75 Aligned_cols=19 Identities=26% Similarity=0.415 Sum_probs=15.6
Q ss_pred CeeeeeccCCCCCeeecCC
Q psy15664 26 PVTFCHNDLQEGNILYRES 44 (174)
Q Consensus 26 ~~v~cHNDl~~gNiL~~~~ 44 (174)
...+.|+|++|.|+|+-..
T Consensus 128 ~n~IvHRDvkP~nllLASK 146 (355)
T KOG0033|consen 128 SNGIVHRDLKPENLLLASK 146 (355)
T ss_pred hcCceeccCChhheeeeec
Confidence 3458899999999998753
No 498
>KOG0614|consensus
Probab=37.03 E-value=19 Score=33.93 Aligned_cols=28 Identities=25% Similarity=0.402 Sum_probs=22.7
Q ss_pred eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664 28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC 79 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 79 (174)
.+.-+||+|.|+|+.. .+=++|+||-+|
T Consensus 540 ~iIYRDLKPENllLd~------------------------~Gy~KLVDFGFA 567 (732)
T KOG0614|consen 540 GIIYRDLKPENLLLDN------------------------RGYLKLVDFGFA 567 (732)
T ss_pred CceeccCChhheeecc------------------------CCceEEeehhhH
Confidence 4778999999999986 356889998654
No 499
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C). Proteins in this uncharacterised family are described as transmembrane proteins.
Probab=36.82 E-value=76 Score=25.03 Aligned_cols=32 Identities=19% Similarity=0.214 Sum_probs=25.6
Q ss_pred eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664 29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR 84 (174)
Q Consensus 29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~ 84 (174)
|--.|++++|+-+++ ++++++||-+....-++
T Consensus 83 ~~lcDv~~~nfgv~~------------------------~~~lk~iDld~v~~~~~ 114 (188)
T PF12260_consen 83 FYLCDVSPDNFGVND------------------------DGRLKLIDLDDVFVEDK 114 (188)
T ss_pred EEEeecchHHeEEeC------------------------CCcEEEEechhcchhHH
Confidence 666699999999986 46799999998776544
No 500
>KOG4645|consensus
Probab=36.71 E-value=51 Score=34.29 Aligned_cols=16 Identities=31% Similarity=0.476 Sum_probs=14.6
Q ss_pred eeeeccCCCCCeeecC
Q psy15664 28 TFCHNDLQEGNILYRE 43 (174)
Q Consensus 28 v~cHNDl~~gNiL~~~ 43 (174)
.+.|+|+++.||++..
T Consensus 1354 gIVHRDIK~aNI~Ld~ 1369 (1509)
T KOG4645|consen 1354 GIVHRDIKPANILLDF 1369 (1509)
T ss_pred CceecCCCccceeeec
Confidence 4789999999999987
Done!