Query         psy15664
Match_columns 174
No_of_seqs    135 out of 1088
Neff          6.6 
Searched_HMMs 46136
Date          Fri Aug 16 18:26:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15664.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15664hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2686|consensus              100.0 2.8E-45 6.1E-50  316.0  13.3  151    1-174   186-342 (366)
  2 KOG4720|consensus              100.0   2E-44 4.3E-49  304.6  14.1  140    3-174   224-367 (391)
  3 PTZ00296 choline kinase; Provi 100.0 3.9E-42 8.5E-47  306.3  14.2  144    6-174   257-414 (442)
  4 PTZ00384 choline kinase; Provi 100.0 1.8E-38 3.9E-43  278.4  15.1  135    6-165   199-345 (383)
  5 PLN02421 phosphotransferase, a 100.0 1.6E-38 3.4E-43  273.0  14.1  139    4-174   159-300 (330)
  6 PLN02236 choline kinase        100.0 1.8E-36 3.8E-41  261.9  14.8  145    5-174   178-324 (344)
  7 cd05156 ChoK_euk Choline Kinas 100.0   4E-34 8.6E-39  240.4  13.1  135    9-163   156-302 (302)
  8 PF01633 Choline_kinase:  Choli  99.9 9.3E-26   2E-30  181.3   4.8   92    4-119   120-211 (211)
  9 TIGR02721 ycfN_thiK thiamine k  99.8 3.4E-20 7.3E-25  152.8  12.3   98   24-168   143-240 (256)
 10 cd05157 ETNK_euk Ethanolamine   99.8 1.2E-20 2.6E-25  152.7   8.7   87    6-124   149-235 (235)
 11 COG0510 ycfN Thiamine kinase a  99.8   9E-20 1.9E-24  153.5  11.6  110    7-167   132-242 (269)
 12 PRK10271 thiK thiamine kinase;  99.7 2.4E-17 5.1E-22  132.4  11.0   97   22-167    72-168 (188)
 13 cd05151 ChoK Choline Kinase (C  99.5 1.7E-13 3.7E-18  104.7   9.1   78   11-131    90-168 (170)
 14 cd05153 HomoserineK_II Homoser  99.4 4.7E-12   1E-16  105.8  13.2   99   24-162   172-270 (296)
 15 TIGR02172 Fb_sc_TIGR02172 Fibr  99.4 7.9E-13 1.7E-17  108.4   7.1   73   15-130   141-213 (226)
 16 PRK09550 mtnK methylthioribose  99.2 7.9E-11 1.7E-15  104.4  11.0   67    8-101   206-272 (401)
 17 cd05154 ACAD10_11_like Acyl-Co  99.2 2.1E-11 4.5E-16   96.3   6.3   49   25-95    172-220 (223)
 18 PRK05231 homoserine kinase; Pr  99.2 3.3E-10 7.2E-15   95.8  11.9   95   10-140   167-264 (319)
 19 TIGR02906 spore_CotS spore coa  99.2 1.4E-10   3E-15   97.3   9.4   99   24-164   184-282 (313)
 20 PF01636 APH:  Phosphotransfera  99.2 6.8E-11 1.5E-15   93.3   7.0   66   24-128   163-228 (239)
 21 cd05150 APH Aminoglycoside 3'-  99.2 9.4E-11   2E-15   95.5   7.9   84   24-154   160-243 (244)
 22 PRK12396 5-methylribose kinase  99.1 4.3E-10 9.4E-15   99.7  10.6   67    8-101   210-276 (409)
 23 smart00587 CHK ZnF_C4 abd HLH   99.1   4E-10 8.6E-15   90.2   9.4   73   25-131   118-190 (196)
 24 TIGR00938 thrB_alt homoserine   99.1 1.2E-09 2.6E-14   92.5  11.7   74   24-133   184-257 (307)
 25 TIGR01767 MTRK 5-methylthiorib  99.1 7.4E-10 1.6E-14   97.2  10.6   67    8-101   175-241 (370)
 26 TIGR02904 spore_ysxE spore coa  99.1 7.7E-10 1.7E-14   93.9  10.2  101   23-165   192-292 (309)
 27 cd05155 APH_ChoK_like_1 Unchar  99.0 7.6E-10 1.6E-14   90.2   7.1   59   25-128   162-221 (235)
 28 cd05152 MPH2' Macrolide 2'-Pho  98.9   2E-08 4.3E-13   84.7  11.7   65   24-132   182-247 (276)
 29 PLN02756 S-methyl-5-thioribose  98.8 2.7E-08 5.8E-13   88.7  10.8   65    8-99    213-277 (418)
 30 PRK11768 serine/threonine prot  98.8   4E-08 8.7E-13   84.4  10.6   90   24-157   193-282 (325)
 31 PF02958 EcKinase:  Ecdysteroid  98.8   2E-08 4.4E-13   84.0   8.6   74   24-131   212-285 (294)
 32 COG2334 Putative homoserine ki  98.8 1.8E-07 3.9E-12   81.2  13.3   97   29-167   199-296 (331)
 33 PLN02876 acyl-CoA dehydrogenas  98.7   5E-08 1.1E-12   93.3   9.3  103   26-159   224-332 (822)
 34 cd05120 APH_ChoK_like Aminogly  98.6 1.6E-07 3.5E-12   68.3   7.2   45   27-95    108-152 (155)
 35 COG4857 Predicted kinase [Gene  98.5 3.3E-07 7.1E-12   78.6   7.3   61    8-95    211-271 (408)
 36 PRK10593 hypothetical protein;  98.3 2.6E-06 5.5E-11   72.5   8.8   68   22-134   188-255 (297)
 37 PRK06148 hypothetical protein;  98.3 9.5E-06 2.1E-10   79.5  12.3  102   24-162   200-302 (1013)
 38 COG3173 Predicted aminoglycosi  98.3 1.7E-06 3.6E-11   75.0   5.9   57   12-92    183-239 (321)
 39 PRK14879 serine/threonine prot  98.1 2.8E-05 6.1E-10   61.4   9.2   70   28-131   115-184 (211)
 40 PF07914 DUF1679:  Protein of u  98.1 2.8E-06 6.1E-11   75.8   3.8   55   23-96    264-318 (414)
 41 TIGR03724 arch_bud32 Kae1-asso  98.1 3.1E-05 6.7E-10   60.7   8.9   70   27-131   109-179 (199)
 42 PRK06149 hypothetical protein;  98.0 5.2E-05 1.1E-09   74.1  12.1  102   25-160   206-307 (972)
 43 PF06293 Kdo:  Lipopolysacchari  98.0 1.9E-05 4.1E-10   63.5   7.2   65   27-127   137-206 (206)
 44 COG3178 Predicted phosphotrans  97.9 6.9E-05 1.5E-09   64.6   8.5   73   23-131   196-268 (351)
 45 PRK15123 lipopolysaccharide co  97.6 0.00078 1.7E-08   56.9  11.3   72   27-130   157-234 (268)
 46 PF04655 APH_6_hur:  Aminoglyco  97.6 0.00039 8.5E-09   58.4   9.2  110    8-161   141-250 (253)
 47 COG3642 Mn2+-dependent serine/  97.6 0.00048   1E-08   55.9   8.6   97    8-146    96-194 (204)
 48 PRK09605 bifunctional UGMP fam  97.5 0.00035 7.5E-09   63.8   8.4   69   27-130   447-515 (535)
 49 TIGR02905 spore_yutH spore coa  97.5 0.00076 1.6E-08   57.7   9.1   68   25-133   187-255 (313)
 50 PRK01723 3-deoxy-D-manno-octul  97.2  0.0024 5.3E-08   52.6   8.6   32   28-83    162-193 (239)
 51 PF03881 Fructosamin_kin:  Fruc  97.1 0.00087 1.9E-08   57.2   5.5   65   23-134   184-248 (288)
 52 cd05145 RIO1_like RIO kinase f  97.0 0.00079 1.7E-08   53.1   4.1   32   27-83    137-168 (190)
 53 PRK09902 hypothetical protein;  97.0   0.003 6.6E-08   52.0   7.3   77   10-129   134-215 (216)
 54 cd05147 RIO1_euk RIO kinase fa  96.9  0.0011 2.3E-08   52.8   3.7   29   27-80    137-165 (190)
 55 PRK12274 serine/threonine prot  96.8  0.0038 8.3E-08   51.4   6.7   34   27-84    110-144 (218)
 56 COG3570 StrB Streptomycin 6-ki  96.8  0.0085 1.8E-07   49.8   8.3  103   11-155   145-247 (274)
 57 PRK10359 lipopolysaccharide co  96.7  0.0033 7.1E-08   52.2   5.5   44   27-97    154-199 (232)
 58 KOG0667|consensus               96.7  0.0021 4.6E-08   59.6   4.4   35   26-82    307-341 (586)
 59 PF01163 RIO1:  RIO1 family;  I  96.5  0.0055 1.2E-07   49.2   5.2   28   27-79    126-153 (188)
 60 PF06176 WaaY:  Lipopolysacchar  96.4  0.0058 1.3E-07   50.7   4.8   28   27-79    154-181 (229)
 61 cd05119 RIO RIO kinase family,  96.3  0.0048   1E-07   47.6   3.6   32   24-80    131-162 (187)
 62 cd00180 PKc Catalytic domain o  96.2  0.0059 1.3E-07   45.8   4.0   56    6-85     91-146 (215)
 63 cd05146 RIO3_euk RIO kinase fa  96.2  0.0039 8.5E-08   50.5   2.9   27   27-78    144-170 (197)
 64 cd05594 STKc_PKB_alpha Catalyt  96.1  0.0097 2.1E-07   50.0   5.0   35   22-80    110-144 (325)
 65 cd05144 RIO2_C RIO kinase fami  96.1   0.011 2.5E-07   46.5   5.1   30   27-80    144-173 (198)
 66 cd06605 PKc_MAPKK Catalytic do  96.0    0.01 2.2E-07   47.5   4.4   43   14-80    107-149 (265)
 67 smart00090 RIO RIO-like kinase  95.8   0.016 3.4E-07   47.8   4.8   28   29-81    170-197 (237)
 68 KOG0583|consensus               95.6   0.014   3E-07   51.4   4.1   34   27-83    139-172 (370)
 69 PF00069 Pkinase:  Protein kina  95.6  0.0093   2E-07   47.4   2.7   29   28-80    118-146 (260)
 70 PRK10345 hypothetical protein;  95.6   0.021 4.5E-07   46.5   4.6   16   28-43    125-140 (210)
 71 cd05122 PKc_STE Catalytic doma  95.5   0.021 4.7E-07   44.6   4.4   33   27-83    117-149 (253)
 72 cd05068 PTKc_Frk_like Catalyti  95.5    0.02 4.4E-07   46.0   4.3   16   28-43    123-138 (261)
 73 cd07863 STKc_CDK4 Catalytic do  95.4   0.016 3.4E-07   47.2   3.5   29   28-80    128-156 (288)
 74 cd06649 PKc_MEK2 Catalytic dom  95.4   0.023 4.9E-07   48.0   4.5   17   27-43    123-139 (331)
 75 cd06622 PKc_MAPKK_PBS2_like Ca  95.4   0.021 4.5E-07   46.5   4.1   31   26-80    121-151 (286)
 76 KOG0984|consensus               95.3   0.013 2.8E-07   48.8   2.7   43   15-81    156-198 (282)
 77 cd08223 STKc_Nek4 Catalytic do  95.3   0.026 5.7E-07   44.9   4.5   29   28-80    122-150 (257)
 78 cd08528 STKc_Nek10 Catalytic d  95.3   0.028   6E-07   45.3   4.7   36   21-80    127-162 (269)
 79 cd05604 STKc_SGK3 Catalytic do  95.3   0.017 3.7E-07   48.6   3.5   30   27-80    115-144 (325)
 80 COG3001 Uncharacterized protei  95.3   0.081 1.8E-06   44.7   7.4   63    3-91    163-225 (286)
 81 cd05573 STKc_ROCK_NDR_like Cat  95.3   0.017 3.7E-07   48.7   3.3   31   27-81    120-150 (350)
 82 smart00219 TyrKc Tyrosine kina  95.2    0.03 6.4E-07   44.3   4.5   30   28-81    123-152 (258)
 83 cd08215 STKc_Nek Catalytic dom  95.2   0.023 4.9E-07   44.8   3.8   30   28-81    123-152 (258)
 84 cd05603 STKc_SGK2 Catalytic do  95.2   0.019 4.1E-07   48.1   3.4   30   27-80    115-144 (321)
 85 cd05586 STKc_Sck1_like Catalyt  95.2    0.02 4.4E-07   48.1   3.5   30   28-81    116-145 (330)
 86 cd05614 STKc_MSK2_N N-terminal  95.2    0.02 4.4E-07   48.1   3.5   16   28-43    125-140 (332)
 87 KOG0658|consensus               95.2   0.027 5.9E-07   49.5   4.3   17   27-43    144-160 (364)
 88 cd05069 PTKc_Yes Catalytic dom  95.1   0.032 6.9E-07   44.9   4.4   16   28-43    122-137 (260)
 89 TIGR01982 UbiB 2-polyprenylphe  95.1   0.015 3.2E-07   52.3   2.6   34   27-84    276-309 (437)
 90 cd06650 PKc_MEK1 Catalytic dom  95.1   0.031 6.8E-07   47.3   4.5   29   28-80    124-152 (333)
 91 cd06617 PKc_MKK3_6 Catalytic d  95.1    0.03 6.5E-07   45.3   4.2   23   21-43    117-139 (283)
 92 cd00192 PTKc Catalytic domain   95.1   0.032   7E-07   44.1   4.2   17   27-43    124-140 (262)
 93 cd08217 STKc_Nek2 Catalytic do  95.0   0.031 6.7E-07   44.3   4.0   32   26-81    128-159 (265)
 94 cd05082 PTKc_Csk Catalytic dom  95.0   0.033 7.3E-07   44.6   4.2   30   27-80    121-150 (256)
 95 cd05627 STKc_NDR2 Catalytic do  95.0   0.025 5.4E-07   48.3   3.6   30   27-80    120-149 (360)
 96 cd06616 PKc_MKK4 Catalytic dom  95.0   0.027 5.9E-07   45.9   3.6   19   25-43    125-143 (288)
 97 cd05628 STKc_NDR1 Catalytic do  94.9   0.031 6.8E-07   47.8   4.1   30   27-80    120-149 (363)
 98 cd05083 PTKc_Chk Catalytic dom  94.9   0.034 7.5E-07   44.4   4.0   31   27-81    119-149 (254)
 99 cd05109 PTKc_HER2 Catalytic do  94.9   0.034 7.5E-07   45.2   4.0   16   28-43    129-144 (279)
100 cd06615 PKc_MEK Catalytic doma  94.9   0.033 7.2E-07   46.4   3.9   18   26-43    118-135 (308)
101 cd05621 STKc_ROCK2 Catalytic d  94.8   0.037   8E-07   47.9   4.1   30   27-80    161-190 (370)
102 cd05052 PTKc_Abl Catalytic dom  94.8   0.041   9E-07   44.3   4.2   17   27-43    123-139 (263)
103 cd05601 STKc_CRIK Catalytic do  94.8   0.033 7.2E-07   46.7   3.7   30   27-80    121-150 (330)
104 cd05571 STKc_PKB Catalytic dom  94.8   0.036 7.9E-07   46.6   4.0   29   28-80    115-143 (323)
105 cd05585 STKc_YPK1_like Catalyt  94.8   0.043 9.4E-07   45.8   4.4   30   28-81    113-142 (312)
106 PHA03212 serine/threonine kina  94.7   0.038 8.1E-07   48.4   4.1   28   28-79    202-229 (391)
107 cd05617 STKc_aPKC_zeta Catalyt  94.7    0.03 6.6E-07   47.2   3.4   16   28-43    116-131 (327)
108 cd05070 PTKc_Fyn_Yrk Catalytic  94.7   0.032   7E-07   44.8   3.4   29   28-80    122-150 (260)
109 cd05595 STKc_PKB_beta Catalyti  94.7    0.03 6.4E-07   47.2   3.2   16   28-43    115-130 (323)
110 cd05039 PTKc_Csk_like Catalyti  94.7    0.04 8.6E-07   44.0   3.8   32   27-82    121-152 (256)
111 cd05616 STKc_cPKC_beta Catalyt  94.6   0.034 7.3E-07   46.7   3.4   16   28-43    121-136 (323)
112 cd05053 PTKc_FGFR Catalytic do  94.6   0.036 7.8E-07   45.3   3.4   30   27-80    151-180 (293)
113 cd07869 STKc_PFTAIRE1 Catalyti  94.6   0.033 7.1E-07   46.1   3.2   16   28-43    123-138 (303)
114 cd06656 STKc_PAK3 Catalytic do  94.5   0.031 6.7E-07   46.3   3.0   29   28-80    135-163 (297)
115 cd06623 PKc_MAPKK_plant_like C  94.5   0.042 9.1E-07   43.7   3.6   26   18-43    110-135 (264)
116 PTZ00263 protein kinase A cata  94.5   0.053 1.1E-06   45.8   4.4   29   28-80    138-166 (329)
117 cd05593 STKc_PKB_gamma Catalyt  94.5   0.042 9.1E-07   46.4   3.8   16   28-43    115-130 (328)
118 KOG0581|consensus               94.5   0.041 8.8E-07   48.5   3.7   48   20-93    191-238 (364)
119 cd05040 PTKc_Ack_like Catalyti  94.5   0.045 9.7E-07   43.7   3.8   16   28-43    117-132 (257)
120 PLN00034 mitogen-activated pro  94.5   0.046 9.9E-07   46.6   4.0   16   28-43    188-203 (353)
121 cd05602 STKc_SGK1 Catalytic do  94.5   0.043 9.3E-07   46.1   3.8   17   27-43    115-131 (325)
122 cd05574 STKc_phototropin_like   94.5   0.053 1.1E-06   45.0   4.3   30   28-81    123-152 (316)
123 PHA03209 serine/threonine kina  94.5   0.044 9.5E-07   47.0   3.8   29   28-80    177-205 (357)
124 cd07873 STKc_PCTAIRE1 Catalyti  94.4   0.038 8.3E-07   45.6   3.3   17   27-43    123-139 (301)
125 cd05612 STKc_PRKX_like Catalyt  94.4   0.048   1E-06   45.0   3.9   29   28-80    121-149 (291)
126 cd05575 STKc_SGK Catalytic dom  94.4   0.043 9.2E-07   46.1   3.6   29   28-80    116-144 (323)
127 cd05598 STKc_LATS Catalytic do  94.4   0.056 1.2E-06   46.3   4.4   29   28-80    121-149 (376)
128 cd05584 STKc_p70S6K Catalytic   94.4    0.04 8.7E-07   46.3   3.4   16   28-43    120-135 (323)
129 PTZ00267 NIMA-related protein   94.4   0.051 1.1E-06   48.8   4.3   29   28-80    189-217 (478)
130 PRK09188 serine/threonine prot  94.4   0.069 1.5E-06   47.1   5.0   40   27-90    130-170 (365)
131 cd07868 STKc_CDK8 Catalytic do  94.4   0.054 1.2E-06   44.9   4.1   16   28-43    128-143 (317)
132 cd05629 STKc_NDR_like_fungal C  94.4   0.049 1.1E-06   46.8   4.0   30   27-80    120-149 (377)
133 cd05591 STKc_nPKC_epsilon Cata  94.4   0.051 1.1E-06   45.6   4.0   16   28-43    116-131 (321)
134 cd05618 STKc_aPKC_iota Catalyt  94.4   0.045 9.8E-07   46.3   3.7   16   28-43    116-131 (329)
135 PHA02882 putative serine/threo  94.4   0.057 1.2E-06   44.7   4.2   16   28-43    146-161 (294)
136 cd06627 STKc_Cdc7_like Catalyt  94.4   0.055 1.2E-06   42.7   3.9   30   28-81    119-148 (254)
137 cd05625 STKc_LATS1 Catalytic d  94.4   0.048   1E-06   47.0   3.8   29   28-80    121-149 (382)
138 cd07875 STKc_JNK1 Catalytic do  94.4   0.048   1E-06   46.5   3.8   29   28-80    146-174 (364)
139 cd05088 PTKc_Tie2 Catalytic do  94.4   0.042 9.2E-07   45.6   3.4   17   27-43    143-159 (303)
140 cd05597 STKc_DMPK_like Catalyt  94.3   0.054 1.2E-06   45.8   4.1   28   28-79    122-149 (331)
141 cd07871 STKc_PCTAIRE3 Catalyti  94.3   0.038 8.2E-07   45.5   3.0   17   27-43    122-138 (288)
142 cd07878 STKc_p38beta_MAPK11 Ca  94.3   0.051 1.1E-06   45.8   3.8   16   28-43    138-153 (343)
143 cd05623 STKc_MRCK_alpha Cataly  94.3   0.048   1E-06   46.0   3.7   29   27-79    121-149 (332)
144 cd05102 PTKc_VEGFR3 Catalytic   94.3   0.066 1.4E-06   45.0   4.5   16   28-43    194-209 (338)
145 cd05034 PTKc_Src_like Catalyti  94.3   0.052 1.1E-06   43.4   3.7   29   28-80    123-151 (261)
146 cd05587 STKc_cPKC Catalytic do  94.3   0.048   1E-06   45.8   3.6   16   28-43    121-136 (324)
147 cd05583 STKc_MSK_N N-terminal   94.3   0.047   1E-06   44.6   3.5   17   27-43    124-140 (288)
148 cd05084 PTKc_Fes Catalytic dom  94.3   0.062 1.3E-06   42.8   4.1   16   28-43    114-129 (252)
149 cd05624 STKc_MRCK_beta Catalyt  94.3    0.05 1.1E-06   46.0   3.7   17   27-43    121-137 (331)
150 cd05038 PTKc_Jak_rpt2 Catalyti  94.3   0.055 1.2E-06   43.7   3.8   17   27-43    128-144 (284)
151 KOG0594|consensus               94.3   0.077 1.7E-06   46.2   4.8   17   27-43    139-155 (323)
152 cd05080 PTKc_Tyk2_rpt2 Catalyt  94.2   0.065 1.4E-06   43.6   4.2   16   28-43    127-142 (283)
153 TIGR02457 TreS_Cterm trehalose  94.2   0.058 1.3E-06   49.9   4.3   44   28-96    380-432 (528)
154 PTZ00426 cAMP-dependent protei  94.2   0.047   1E-06   46.7   3.5   29   28-80    151-179 (340)
155 cd07857 STKc_MPK1 Catalytic do  94.2   0.038 8.2E-07   46.5   2.9   16   28-43    125-140 (332)
156 cd06618 PKc_MKK7 Catalytic dom  94.2   0.048   1E-06   44.9   3.5   17   27-43    134-150 (296)
157 cd07832 STKc_CCRK Catalytic do  94.2   0.053 1.2E-06   43.8   3.7   16   28-43    119-134 (286)
158 cd05096 PTKc_DDR1 Catalytic do  94.2   0.058 1.3E-06   44.6   3.9   29   28-80    158-186 (304)
159 cd05089 PTKc_Tie1 Catalytic do  94.2   0.053 1.1E-06   44.7   3.6   17   27-43    138-154 (297)
160 cd05590 STKc_nPKC_eta Catalyti  94.2    0.06 1.3E-06   45.3   4.0   16   28-43    116-131 (320)
161 cd05580 STKc_PKA Catalytic dom  94.2   0.053 1.2E-06   44.5   3.6   31   27-81    120-150 (290)
162 KOG4250|consensus               94.2   0.062 1.3E-06   51.0   4.4   34   27-80    139-172 (732)
163 cd05091 PTKc_Ror2 Catalytic do  94.2   0.053 1.2E-06   44.1   3.5   29   28-80    144-172 (283)
164 cd07853 STKc_NLK Catalytic dom  94.2   0.055 1.2E-06   46.4   3.8   16   28-43    123-138 (372)
165 cd07872 STKc_PCTAIRE2 Catalyti  94.1   0.049 1.1E-06   45.2   3.3   16   28-43    124-139 (309)
166 cd05075 PTKc_Axl Catalytic dom  94.1    0.05 1.1E-06   43.7   3.3   16   28-43    132-147 (272)
167 cd05620 STKc_nPKC_delta Cataly  94.1   0.048 1.1E-06   45.8   3.3   16   28-43    116-131 (316)
168 cd05600 STKc_Sid2p_Dbf2p Catal  94.1   0.064 1.4E-06   45.1   4.0   29   28-80    121-149 (333)
169 PTZ00036 glycogen synthase kin  94.1   0.058 1.3E-06   48.0   3.9   17   27-43    189-205 (440)
170 cd05113 PTKc_Btk_Bmx Catalytic  94.1   0.076 1.7E-06   42.7   4.3   29   28-80    120-148 (256)
171 cd07862 STKc_CDK6 Catalytic do  94.1   0.063 1.4E-06   43.8   3.9   28   28-79    130-157 (290)
172 cd05060 PTKc_Syk_like Catalyti  94.1   0.084 1.8E-06   42.2   4.5   29   28-80    115-143 (257)
173 cd05066 PTKc_EphR_A Catalytic   94.1   0.061 1.3E-06   43.4   3.7   17   27-43    125-141 (267)
174 cd05588 STKc_aPKC Catalytic do  94.1   0.055 1.2E-06   45.7   3.5   16   28-43    116-131 (329)
175 cd05599 STKc_NDR_like Catalyti  94.0   0.057 1.2E-06   45.9   3.6   29   28-80    121-149 (364)
176 cd07859 STKc_TDY_MAPK_plant Ca  94.0   0.065 1.4E-06   44.7   3.9   16   28-43    123-138 (338)
177 cd05582 STKc_RSK_N N-terminal   94.0   0.061 1.3E-06   45.0   3.7   29   28-80    118-146 (318)
178 PHA03207 serine/threonine kina  94.0   0.044 9.6E-07   47.6   2.9   16   28-43    205-220 (392)
179 cd05622 STKc_ROCK1 Catalytic d  94.0   0.076 1.6E-06   45.9   4.3   17   27-43    161-177 (371)
180 KOG1166|consensus               94.0    0.12 2.5E-06   51.1   6.0   48   11-79    801-848 (974)
181 cd08219 STKc_Nek3 Catalytic do  94.0   0.088 1.9E-06   42.0   4.4   30   27-80    119-148 (255)
182 cd05049 PTKc_Trk Catalytic dom  94.0    0.08 1.7E-06   42.8   4.2   16   28-43    142-157 (280)
183 cd05613 STKc_MSK1_N N-terminal  94.0   0.067 1.5E-06   43.7   3.8   29   27-79    124-152 (290)
184 cd05071 PTKc_Src Catalytic dom  94.0   0.067 1.5E-06   43.2   3.8   16   28-43    122-137 (262)
185 cd05057 PTKc_EGFR_like Catalyt  94.0   0.076 1.6E-06   43.1   4.1   17   27-43    128-144 (279)
186 cd05633 STKc_GRK3 Catalytic do  94.0   0.049 1.1E-06   44.6   3.0   16   28-43    117-132 (279)
187 cd05094 PTKc_TrkC Catalytic do  94.0   0.075 1.6E-06   43.6   4.1   16   28-43    143-158 (291)
188 cd07839 STKc_CDK5 Catalytic do  94.0   0.054 1.2E-06   43.9   3.2   16   28-43    119-134 (284)
189 cd06614 STKc_PAK Catalytic dom  94.0   0.074 1.6E-06   43.3   4.0   30   27-80    135-164 (286)
190 cd05123 STKc_AGC Catalytic dom  93.9   0.084 1.8E-06   41.7   4.2   31   27-81    112-142 (250)
191 cd05047 PTKc_Tie Catalytic dom  93.9   0.075 1.6E-06   43.0   4.0   17   27-43    131-147 (270)
192 cd07874 STKc_JNK3 Catalytic do  93.9   0.058 1.3E-06   45.8   3.5   29   28-80    139-167 (355)
193 cd05148 PTKc_Srm_Brk Catalytic  93.9   0.077 1.7E-06   42.4   4.0   29   28-80    124-152 (261)
194 cd07834 STKc_MAPK Catalytic do  93.9   0.057 1.2E-06   45.1   3.3   16   28-43    123-138 (330)
195 cd07841 STKc_CDK7 Catalytic do  93.9   0.091   2E-06   43.0   4.5   16   28-43    122-137 (298)
196 cd05608 STKc_GRK1 Catalytic do  93.9   0.059 1.3E-06   44.2   3.3   16   28-43    117-132 (280)
197 PTZ00284 protein kinase; Provi  93.9   0.059 1.3E-06   48.0   3.5   22   22-43    246-267 (467)
198 cd07876 STKc_JNK2 Catalytic do  93.8   0.058 1.3E-06   46.0   3.3   16   28-43    143-158 (359)
199 PLN03225 Serine/threonine-prot  93.8   0.084 1.8E-06   48.9   4.6   30   28-80    275-304 (566)
200 cd05632 STKc_GRK5 Catalytic do  93.8   0.068 1.5E-06   43.9   3.6   16   28-43    122-137 (285)
201 cd08529 STKc_FA2-like Catalyti  93.8   0.088 1.9E-06   41.7   4.2   17   27-43    120-136 (256)
202 cd05108 PTKc_EGFR Catalytic do  93.8   0.085 1.8E-06   44.0   4.2   16   28-43    129-144 (316)
203 cd07866 STKc_BUR1 Catalytic do  93.8   0.059 1.3E-06   44.2   3.2   16   28-43    135-150 (311)
204 cd05116 PTKc_Syk Catalytic dom  93.8   0.079 1.7E-06   42.5   3.9   16   28-43    115-130 (257)
205 PRK04750 ubiB putative ubiquin  93.8   0.035 7.6E-07   51.4   2.0   37   27-83    279-315 (537)
206 cd07870 STKc_PFTAIRE2 Catalyti  93.8   0.078 1.7E-06   43.3   3.9   16   28-43    123-138 (291)
207 cd05592 STKc_nPKC_theta_delta   93.8   0.062 1.3E-06   45.1   3.3   17   27-43    115-131 (316)
208 cd05085 PTKc_Fer Catalytic dom  93.7   0.087 1.9E-06   41.8   3.9   29   28-80    113-141 (250)
209 cd05079 PTKc_Jak1_rpt2 Catalyt  93.7   0.077 1.7E-06   43.3   3.7   17   27-43    128-144 (284)
210 cd05589 STKc_PKN Catalytic dom  93.7   0.069 1.5E-06   44.8   3.5   16   28-43    121-136 (324)
211 cd05099 PTKc_FGFR4 Catalytic d  93.7   0.087 1.9E-06   43.9   4.1   17   27-43    153-169 (314)
212 cd05112 PTKc_Itk Catalytic dom  93.7   0.074 1.6E-06   42.4   3.5   29   28-80    120-148 (256)
213 cd05062 PTKc_IGF-1R Catalytic   93.7   0.071 1.5E-06   43.3   3.4   16   28-43    139-154 (277)
214 cd05042 PTKc_Aatyk Catalytic d  93.7   0.097 2.1E-06   42.2   4.2   16   28-43    120-135 (269)
215 cd05631 STKc_GRK4 Catalytic do  93.6    0.09 1.9E-06   43.2   4.0   16   28-43    122-137 (285)
216 cd05101 PTKc_FGFR2 Catalytic d  93.6   0.091   2E-06   43.4   4.0   16   28-43    157-172 (304)
217 cd06638 STKc_myosinIIIA Cataly  93.6   0.076 1.7E-06   43.1   3.5   29   28-80    144-172 (286)
218 COG0478 RIO-like serine/threon  93.6   0.068 1.5E-06   45.9   3.3   28   26-77    220-247 (304)
219 cd07835 STKc_CDK1_like Catalyt  93.6   0.077 1.7E-06   43.0   3.5   16   28-43    119-134 (283)
220 cd07867 STKc_CDC2L6 Catalytic   93.6   0.097 2.1E-06   43.2   4.1   16   28-43    128-143 (317)
221 cd06639 STKc_myosinIIIB Cataly  93.6   0.092   2E-06   42.9   3.9   16   28-43    148-163 (291)
222 cd05041 PTKc_Fes_like Catalyti  93.6    0.11 2.3E-06   41.3   4.3   29   28-80    113-141 (251)
223 smart00220 S_TKc Serine/Threon  93.6   0.068 1.5E-06   41.3   3.0   32   28-83    107-138 (244)
224 smart00221 STYKc Protein kinas  93.6   0.078 1.7E-06   40.8   3.3   32   28-83    118-149 (225)
225 cd06644 STKc_STK10_LOK Catalyt  93.6    0.13 2.9E-06   42.1   4.9   17   27-43    129-145 (292)
226 cd05033 PTKc_EphR Catalytic do  93.5   0.085 1.8E-06   42.5   3.6   17   27-43    125-141 (266)
227 cd05093 PTKc_TrkB Catalytic do  93.5     0.1 2.2E-06   42.7   4.2   17   27-43    139-155 (288)
228 cd06613 STKc_MAP4K3_like Catal  93.5     0.1 2.2E-06   41.5   4.1   30   27-80    120-149 (262)
229 KOG0596|consensus               93.5    0.11 2.4E-06   48.5   4.6   41   27-94    479-519 (677)
230 cd05095 PTKc_DDR2 Catalytic do  93.5   0.096 2.1E-06   43.1   4.0   16   28-43    150-165 (296)
231 COG2187 Uncharacterized protei  93.5     1.4 3.1E-05   38.2  11.0   68   24-132   206-277 (337)
232 cd05626 STKc_LATS2 Catalytic d  93.5   0.085 1.8E-06   45.5   3.8   30   27-80    120-149 (381)
233 cd05114 PTKc_Tec_Rlk Catalytic  93.5   0.084 1.8E-06   42.2   3.5   30   28-81    120-149 (256)
234 cd05111 PTK_HER3 Pseudokinase   93.5    0.11 2.5E-06   42.3   4.4   16   28-43    129-144 (279)
235 cd05578 STKc_Yank1 Catalytic d  93.4   0.079 1.7E-06   42.3   3.3   30   28-81    120-149 (258)
236 KOG0603|consensus               93.4    0.12 2.6E-06   48.3   4.8   36   27-85    434-469 (612)
237 cd06652 STKc_MEKK2 Catalytic d  93.4   0.091   2E-06   42.2   3.6   16   28-43    126-141 (265)
238 cd05037 PTK_Jak_rpt1 Pseudokin  93.4    0.11 2.4E-06   41.3   4.0   17   27-43    120-136 (259)
239 KOG3087|consensus               93.4    0.37 7.9E-06   39.6   6.9   83   28-146   133-219 (229)
240 cd05048 PTKc_Ror Catalytic Dom  93.4    0.11 2.4E-06   42.0   4.1   16   28-43    144-159 (283)
241 cd05615 STKc_cPKC_alpha Cataly  93.3   0.085 1.8E-06   44.4   3.5   17   27-43    120-136 (323)
242 cd05579 STKc_MAST_like Catalyt  93.3   0.091   2E-06   41.6   3.4   31   27-81    112-142 (265)
243 cd05609 STKc_MAST Catalytic do  93.3   0.091   2E-06   43.5   3.6   29   28-80    121-149 (305)
244 cd05118 STKc_CMGC Catalytic do  93.3    0.13 2.8E-06   41.4   4.4   30   28-81    118-147 (283)
245 COG0661 AarF Predicted unusual  93.3   0.047   1E-06   50.4   2.0   31   27-81    284-314 (517)
246 cd05596 STKc_ROCK Catalytic do  93.3    0.09 1.9E-06   45.4   3.6   16   28-43    162-177 (370)
247 cd07845 STKc_CDK10 Catalytic d  93.3   0.078 1.7E-06   43.9   3.1   16   28-43    128-143 (309)
248 cd07837 STKc_CdkB_plant Cataly  93.3    0.12 2.7E-06   42.1   4.3   16   28-43    130-145 (295)
249 cd08221 STKc_Nek9 Catalytic do  93.3   0.093   2E-06   41.8   3.4   31   27-81    120-150 (256)
250 cd05607 STKc_GRK7 Catalytic do  93.3    0.16 3.5E-06   41.5   4.9   17   27-43    114-130 (277)
251 PHA03211 serine/threonine kina  93.3   0.093   2E-06   47.4   3.8   16   28-43    280-295 (461)
252 cd05032 PTKc_InsR_like Catalyt  93.2    0.12 2.7E-06   41.6   4.2   17   27-43    138-154 (277)
253 cd07848 STKc_CDKL5 Catalytic d  93.2   0.091   2E-06   42.8   3.4   16   28-43    120-135 (287)
254 cd05051 PTKc_DDR Catalytic dom  93.2   0.092   2E-06   42.9   3.4   16   28-43    150-165 (296)
255 cd05097 PTKc_DDR_like Catalyti  93.2    0.12 2.5E-06   42.5   4.0   17   27-43    148-164 (295)
256 cd05115 PTKc_Zap-70 Catalytic   93.2    0.13 2.9E-06   41.4   4.3   16   28-43    115-130 (257)
257 cd05605 STKc_GRK4_like Catalyt  93.2   0.094   2E-06   43.0   3.4   16   28-43    122-137 (285)
258 cd05059 PTKc_Tec_like Catalyti  93.1    0.11 2.5E-06   41.5   3.8   29   28-80    120-148 (256)
259 KOG1163|consensus               93.1    0.11 2.4E-06   44.3   3.7   32   27-79    130-161 (341)
260 cd06641 STKc_MST3 Catalytic do  93.1    0.16 3.4E-06   41.3   4.6   30   27-80    120-149 (277)
261 cd08228 STKc_Nek6 Catalytic do  93.1    0.12 2.6E-06   41.4   3.9   30   27-80    125-154 (267)
262 cd05054 PTKc_VEGFR Catalytic d  93.1    0.13 2.9E-06   43.7   4.3   16   28-43    193-208 (337)
263 cd05035 PTKc_Axl_like Catalyti  93.1    0.12 2.7E-06   41.3   3.9   16   28-43    133-148 (273)
264 cd05044 PTKc_c-ros Catalytic d  93.1    0.11 2.5E-06   41.6   3.7   34   28-80    126-159 (269)
265 cd06654 STKc_PAK1 Catalytic do  93.1   0.077 1.7E-06   43.9   2.7   16   28-43    136-151 (296)
266 cd06648 STKc_PAK_II Catalytic   93.1    0.12 2.7E-06   42.3   3.9   17   27-43    134-150 (285)
267 cd05572 STKc_cGK_PKG Catalytic  93.1    0.12 2.5E-06   41.5   3.7   31   27-81    112-142 (262)
268 PHA03390 pk1 serine/threonine-  93.0    0.14   3E-06   41.7   4.2   30   28-80    129-158 (267)
269 cd06630 STKc_MEKK1 Catalytic d  93.0    0.11 2.3E-06   41.7   3.5   16   28-43    123-138 (268)
270 cd08220 STKc_Nek8 Catalytic do  93.0    0.11 2.3E-06   41.3   3.4   17   27-43    120-136 (256)
271 cd07861 STKc_CDK1_euk Catalyti  93.0   0.099 2.1E-06   42.3   3.3   16   28-43    121-136 (285)
272 PHA03210 serine/threonine kina  93.0    0.12 2.5E-06   46.9   4.1   28   28-79    287-314 (501)
273 cd07847 STKc_CDKL1_4 Catalytic  93.0    0.12 2.6E-06   41.8   3.7   17   27-43    119-135 (286)
274 COG3231 Aph Aminoglycoside pho  93.0    0.31 6.8E-06   41.0   6.2   66   25-129   183-248 (266)
275 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  93.0    0.12 2.6E-06   42.0   3.7   16   28-43    128-143 (284)
276 cd07846 STKc_CDKL2_3 Catalytic  93.0    0.12 2.5E-06   41.9   3.6   29   28-80    120-148 (286)
277 cd05056 PTKc_FAK Catalytic dom  93.0    0.14 3.1E-06   41.2   4.1   17   27-43    126-142 (270)
278 cd06655 STKc_PAK2 Catalytic do  93.0   0.088 1.9E-06   43.6   3.0   16   28-43    135-150 (296)
279 cd07833 STKc_CDKL Catalytic do  92.9    0.13 2.9E-06   41.5   3.9   30   28-81    120-149 (288)
280 PLN00009 cyclin-dependent kina  92.9    0.16 3.6E-06   41.5   4.5   16   28-43    122-137 (294)
281 cd06658 STKc_PAK5 Catalytic do  92.9    0.11 2.4E-06   43.0   3.4   28   28-79    138-165 (292)
282 cd05072 PTKc_Lyn Catalytic dom  92.9    0.12 2.6E-06   41.4   3.5   16   28-43    123-138 (261)
283 cd07850 STKc_JNK Catalytic dom  92.9     0.1 2.2E-06   44.3   3.3   16   28-43    138-153 (353)
284 cd05074 PTKc_Tyro3 Catalytic d  92.9    0.14 3.1E-06   41.1   4.0   16   28-43    133-148 (273)
285 cd07836 STKc_Pho85 Catalytic d  92.8    0.12 2.6E-06   41.8   3.5   16   28-43    120-135 (284)
286 cd05050 PTKc_Musk Catalytic do  92.8    0.11 2.4E-06   42.4   3.3   17   27-43    149-165 (288)
287 cd05098 PTKc_FGFR1 Catalytic d  92.8   0.092   2E-06   43.5   2.9   17   27-43    159-175 (307)
288 cd05619 STKc_nPKC_theta Cataly  92.8    0.12 2.7E-06   43.4   3.6   16   28-43    116-131 (316)
289 cd05103 PTKc_VEGFR2 Catalytic   92.8    0.19 4.1E-06   42.7   4.8   30   27-80    198-227 (343)
290 cd06643 STKc_SLK Catalytic dom  92.8    0.17 3.8E-06   41.1   4.4   29   28-80    123-151 (282)
291 cd06645 STKc_MAP4K3 Catalytic   92.7    0.11 2.4E-06   41.7   3.2   16   28-43    126-141 (267)
292 cd05036 PTKc_ALK_LTK Catalytic  92.7    0.17 3.7E-06   41.1   4.3   16   28-43    136-151 (277)
293 cd06624 STKc_ASK Catalytic dom  92.7    0.19 4.1E-06   40.4   4.6   16   28-43    128-143 (268)
294 cd05087 PTKc_Aatyk1_Aatyk3 Cat  92.7     0.2 4.3E-06   40.4   4.7   16   28-43    120-135 (269)
295 cd07844 STKc_PCTAIRE_like Cata  92.7    0.11 2.5E-06   42.3   3.2   16   28-43    123-138 (291)
296 cd05106 PTKc_CSF-1R Catalytic   92.7    0.18 3.9E-06   43.7   4.6   16   28-43    232-247 (374)
297 cd05067 PTKc_Lck_Blk Catalytic  92.7    0.16 3.4E-06   40.7   4.0   17   27-43    121-137 (260)
298 cd05090 PTKc_Ror1 Catalytic do  92.7    0.14 3.1E-06   41.6   3.8   16   28-43    144-159 (283)
299 cd05577 STKc_GRK Catalytic dom  92.6    0.11 2.3E-06   42.3   3.0   16   28-43    115-130 (277)
300 cd05063 PTKc_EphR_A2 Catalytic  92.6    0.14   3E-06   41.2   3.6   16   28-43    127-142 (268)
301 cd06646 STKc_MAP4K5 Catalytic   92.6    0.13 2.8E-06   41.3   3.4   16   28-43    126-141 (267)
302 cd06637 STKc_TNIK Catalytic do  92.6     0.1 2.2E-06   42.0   2.7   29   28-80    131-159 (272)
303 KOG0588|consensus               92.6   0.092   2E-06   49.8   2.8   49   11-83    113-163 (786)
304 cd07865 STKc_CDK9 Catalytic do  92.6    0.11 2.5E-06   42.4   3.1   16   28-43    139-154 (310)
305 cd05073 PTKc_Hck Catalytic dom  92.6    0.14 3.1E-06   41.1   3.6   17   27-43    121-137 (260)
306 cd06610 STKc_OSR1_SPAK Catalyt  92.6    0.14   3E-06   40.8   3.5   30   27-80    121-150 (267)
307 cd05110 PTKc_HER4 Catalytic do  92.6    0.18 3.8E-06   41.8   4.2   16   28-43    129-144 (303)
308 cd08216 PK_STRAD Pseudokinase   92.5    0.18 3.9E-06   41.7   4.3   16   28-43    121-136 (314)
309 cd05570 STKc_PKC Catalytic dom  92.5    0.13 2.8E-06   43.1   3.5   17   27-43    115-131 (318)
310 KOG0608|consensus               92.5    0.18 3.9E-06   48.1   4.5   32   25-80    746-777 (1034)
311 cd05045 PTKc_RET Catalytic dom  92.5    0.13 2.8E-06   42.1   3.3   17   27-43    146-162 (290)
312 cd06608 STKc_myosinIII_like Ca  92.5    0.14   3E-06   40.9   3.4   30   27-80    132-161 (275)
313 cd06633 STKc_TAO3 Catalytic do  92.4    0.19 4.1E-06   42.0   4.3   16   28-43    141-156 (313)
314 cd06657 STKc_PAK4 Catalytic do  92.4    0.13 2.7E-06   42.7   3.2   29   28-80    136-164 (292)
315 cd06625 STKc_MEKK3_like Cataly  92.4    0.19 4.2E-06   40.0   4.2   29   28-80    124-152 (263)
316 cd05610 STKc_MASTL Catalytic d  92.4    0.15 3.2E-06   48.1   3.9   30   28-81    124-153 (669)
317 KOG2345|consensus               92.4    0.26 5.6E-06   42.0   5.0   16   28-43    149-164 (302)
318 cd05611 STKc_Rim15_like Cataly  92.3    0.16 3.4E-06   40.6   3.6   16   28-43    117-132 (260)
319 cd05630 STKc_GRK6 Catalytic do  92.3    0.17 3.6E-06   41.6   3.7   30   27-80    121-150 (285)
320 KOG0592|consensus               92.3    0.18   4E-06   46.7   4.3   18   27-44    193-210 (604)
321 cd05581 STKc_PDK1 Catalytic do  92.3    0.12 2.6E-06   41.4   2.9   30   27-80    121-150 (280)
322 cd07864 STKc_CDK12 Catalytic d  92.3    0.14   3E-06   41.9   3.2   16   28-43    136-151 (302)
323 cd07840 STKc_CDK9_like Catalyt  92.3    0.12 2.7E-06   41.5   2.9   16   28-43    120-135 (287)
324 PRK14705 glycogen branching en  92.3     2.1 4.5E-05   43.5  11.9   83   25-133   329-427 (1224)
325 cd06612 STKc_MST1_2 Catalytic   92.3    0.18 3.9E-06   39.9   3.8   16   28-43    119-134 (256)
326 cd05086 PTKc_Aatyk2 Catalytic   92.3    0.27 5.9E-06   39.8   4.9   16   28-43    119-134 (268)
327 cd08530 STKc_CNK2-like Catalyt  92.2    0.25 5.4E-06   39.0   4.6   30   27-80    122-151 (256)
328 cd07843 STKc_CDC2L1 Catalytic   92.2    0.15 3.3E-06   41.7   3.4   16   28-43    126-141 (293)
329 cd05606 STKc_beta_ARK Catalyti  92.2    0.15 3.2E-06   41.7   3.3   16   28-43    117-132 (278)
330 cd08224 STKc_Nek6_Nek7 Catalyt  92.2    0.19 4.2E-06   40.0   4.0   17   27-43    125-141 (267)
331 cd06634 STKc_TAO2 Catalytic do  92.2    0.16 3.4E-06   42.3   3.5   29   28-80    135-163 (308)
332 cd06635 STKc_TAO1 Catalytic do  92.2    0.22 4.9E-06   41.5   4.5   16   28-43    145-160 (317)
333 cd07851 STKc_p38 Catalytic dom  92.2    0.15 3.2E-06   43.3   3.4   29   28-80    138-166 (343)
334 cd05576 STKc_RPK118_like Catal  92.2    0.14 3.1E-06   40.8   3.1   17   27-43    104-120 (237)
335 cd05055 PTKc_PDGFR Catalytic d  92.2    0.15 3.2E-06   42.4   3.3   16   28-43    161-176 (302)
336 cd05058 PTKc_Met_Ron Catalytic  92.1     0.2 4.4E-06   40.0   4.0   17   27-43    117-133 (262)
337 cd06659 STKc_PAK6 Catalytic do  92.1    0.18 3.8E-06   41.8   3.7   28   28-79    137-164 (297)
338 cd07880 STKc_p38gamma_MAPK12 C  92.1    0.18 3.8E-06   42.8   3.7   30   27-80    137-166 (343)
339 cd08229 STKc_Nek7 Catalytic do  92.1    0.16 3.5E-06   40.7   3.3   17   27-43    125-141 (267)
340 cd07838 STKc_CDK4_6_like Catal  92.0    0.22 4.7E-06   40.2   4.1   29   28-80    127-155 (287)
341 cd06619 PKc_MKK5 Catalytic dom  92.0    0.21 4.6E-06   40.7   4.0   17   27-43    114-130 (279)
342 cd08218 STKc_Nek1 Catalytic do  92.0    0.22 4.7E-06   39.7   4.0   30   27-80    120-149 (256)
343 cd07879 STKc_p38delta_MAPK13 C  92.0    0.17 3.8E-06   42.8   3.6   29   28-80    137-165 (342)
344 cd06606 STKc_MAPKKK Catalytic   92.0    0.12 2.7E-06   40.4   2.5   17   27-43    120-136 (260)
345 cd06917 STKc_NAK1_like Catalyt  91.9    0.15 3.3E-06   41.2   3.0   17   27-43    120-136 (277)
346 KOG0983|consensus               91.9    0.23   5E-06   43.1   4.1   25   20-44    204-228 (391)
347 cd07830 STKc_MAK_like Catalyti  91.9    0.23 4.9E-06   40.2   4.0   16   28-43    119-134 (283)
348 cd06631 STKc_YSK4 Catalytic do  91.8    0.17 3.6E-06   40.6   3.2   29   28-80    122-150 (265)
349 KOG0668|consensus               91.8    0.17 3.6E-06   43.0   3.1   51    8-82    133-183 (338)
350 PTZ00283 serine/threonine prot  91.8    0.21 4.5E-06   45.3   4.0   16   28-43    163-178 (496)
351 cd07860 STKc_CDK2_3 Catalytic   91.8    0.19 4.2E-06   40.7   3.5   16   28-43    120-135 (284)
352 cd06629 STKc_MAPKKK_Bck1_like   91.7    0.32   7E-06   39.1   4.8   30   28-81    128-157 (272)
353 cd05100 PTKc_FGFR3 Catalytic d  91.7    0.23 5.1E-06   41.7   4.1   16   28-43    154-169 (334)
354 cd07842 STKc_CDK8_like Catalyt  91.7    0.21 4.5E-06   41.0   3.7   33   28-80    128-160 (316)
355 cd06640 STKc_MST4 Catalytic do  91.7    0.22 4.7E-06   40.4   3.8   17   27-43    120-136 (277)
356 cd08225 STKc_Nek5 Catalytic do  91.6    0.16 3.4E-06   40.3   2.8   17   27-43    120-136 (257)
357 KOG1006|consensus               91.5   0.065 1.4E-06   46.2   0.5   33   24-80    184-216 (361)
358 cd07849 STKc_ERK1_2_like Catal  91.5    0.17 3.7E-06   42.6   3.0   16   28-43    126-141 (336)
359 cd06607 STKc_TAO Catalytic dom  91.5    0.34 7.4E-06   40.1   4.8   16   28-43    135-150 (307)
360 cd07858 STKc_TEY_MAPK_plant Ca  91.5    0.19 4.2E-06   42.3   3.3   16   28-43    128-143 (337)
361 cd06632 STKc_MEKK1_plant Catal  91.4    0.19 4.1E-06   39.8   3.1   17   27-43    121-137 (258)
362 cd06653 STKc_MEKK3_like_1 Cata  91.4    0.19   4E-06   40.5   3.0   16   28-43    126-141 (264)
363 cd05065 PTKc_EphR_B Catalytic   91.4     0.3 6.4E-06   39.3   4.2   17   27-43    125-141 (269)
364 cd06651 STKc_MEKK3 Catalytic d  91.4    0.23 4.9E-06   40.0   3.5   17   27-43    125-141 (266)
365 cd07852 STKc_MAPK15 Catalytic   91.3    0.29 6.3E-06   41.1   4.2   16   28-43    127-142 (337)
366 cd06636 STKc_MAP4K4_6 Catalyti  91.3    0.22 4.7E-06   40.4   3.3   30   27-80    140-169 (282)
367 cd05046 PTK_CCK4 Pseudokinase   91.2    0.31 6.7E-06   39.3   4.2   16   28-43    137-152 (275)
368 cd07855 STKc_ERK5 Catalytic do  91.2    0.26 5.7E-06   41.4   3.8   16   28-43    127-142 (334)
369 cd05092 PTKc_TrkA Catalytic do  91.2    0.22 4.7E-06   40.6   3.3   17   27-43    141-157 (280)
370 cd07856 STKc_Sty1_Hog1 Catalyt  91.2    0.23 5.1E-06   41.9   3.5   16   28-43    128-143 (328)
371 cd05104 PTKc_Kit Catalytic dom  91.1    0.31 6.6E-06   42.2   4.2   16   28-43    234-249 (375)
372 cd08222 STKc_Nek11 Catalytic d  90.9    0.25 5.5E-06   39.4   3.3   17   27-43    125-141 (260)
373 cd06628 STKc_MAPKKK_Byr2_like   90.9    0.21 4.5E-06   40.0   2.8   16   28-43    126-141 (267)
374 KOG1167|consensus               90.9    0.35 7.5E-06   43.4   4.4   54    4-81    129-182 (418)
375 cd06642 STKc_STK25-YSK1 Cataly  90.8    0.46   1E-05   38.4   4.9   17   27-43    120-136 (277)
376 cd07877 STKc_p38alpha_MAPK14 C  90.8     0.3 6.4E-06   41.5   3.8   16   28-43    140-155 (345)
377 PLN03224 probable serine/threo  90.8     0.4 8.6E-06   44.1   4.9   29   28-80    329-357 (507)
378 KOG1235|consensus               90.8    0.18 3.9E-06   46.8   2.7   33   28-80    321-353 (538)
379 cd05043 PTK_Ryk Pseudokinase d  90.8    0.27 5.9E-06   39.8   3.4   17   27-43    136-152 (280)
380 cd05061 PTKc_InsR Catalytic do  90.7     0.3 6.5E-06   39.9   3.7   16   28-43    139-154 (288)
381 cd07831 STKc_MOK Catalytic dom  90.7    0.29 6.3E-06   39.4   3.5   16   28-43    120-135 (282)
382 cd05105 PTKc_PDGFR_alpha Catal  90.6    0.35 7.6E-06   42.6   4.3   16   28-43    257-272 (400)
383 PRK13184 pknD serine/threonine  90.6     0.3 6.4E-06   48.1   4.1   29   28-80    133-161 (932)
384 cd06647 STKc_PAK_I Catalytic d  90.6    0.26 5.7E-06   40.6   3.3   16   28-43    135-150 (293)
385 cd07829 STKc_CDK_like Catalyti  90.6    0.35 7.6E-06   38.9   3.9   16   28-43    118-133 (282)
386 KOG0610|consensus               90.6    0.42 9.2E-06   43.1   4.7   44   11-82    186-229 (459)
387 cd06621 PKc_MAPKK_Pek1_like Ca  90.5    0.33 7.1E-06   39.7   3.7   31   27-81    124-154 (287)
388 PLN00181 protein SPA1-RELATED;  90.3    0.43 9.4E-06   45.6   4.9   17   27-43     99-115 (793)
389 KOG0595|consensus               90.3     0.5 1.1E-05   42.4   4.8   52   11-84    116-167 (429)
390 cd06626 STKc_MEKK4 Catalytic d  90.2    0.38 8.2E-06   38.2   3.8   16   28-43    119-134 (264)
391 KOG0598|consensus               90.1    0.25 5.4E-06   43.5   2.8   29   11-43    132-160 (357)
392 KOG0578|consensus               90.1    0.49 1.1E-05   43.8   4.8   33   27-83    388-420 (550)
393 cd05107 PTKc_PDGFR_beta Cataly  90.0    0.53 1.1E-05   41.5   4.9   16   28-43    259-274 (401)
394 cd07854 STKc_MAPK4_6 Catalytic  90.0    0.26 5.6E-06   41.7   2.8   16   28-43    134-149 (342)
395 cd05077 PTK_Jak1_rpt1 Pseudoki  89.9    0.63 1.4E-05   37.6   4.9   17   27-43    124-140 (262)
396 cd06609 STKc_MST3_like Catalyt  89.9    0.33 7.3E-06   39.1   3.3   16   28-43    118-133 (274)
397 PTZ00024 cyclin-dependent prot  89.8    0.29 6.4E-06   41.0   3.0   17   27-43    138-154 (335)
398 cd06620 PKc_MAPKK_Byr1_like Ca  89.7    0.33 7.2E-06   39.5   3.2   16   28-43    124-139 (284)
399 PHA02988 hypothetical protein;  89.7    0.37 8.1E-06   39.7   3.4   15   29-43    144-158 (283)
400 KOG0660|consensus               89.6    0.27 5.8E-06   43.3   2.6   33   26-82    143-175 (359)
401 cd06611 STKc_SLK_like Catalyti  89.6    0.38 8.3E-06   38.9   3.4   16   28-43    123-138 (280)
402 KOG0593|consensus               89.5    0.49 1.1E-05   41.5   4.1   28   29-80    122-149 (396)
403 KOG0607|consensus               89.3    0.59 1.3E-05   41.4   4.4   32    8-43    180-211 (463)
404 KOG0670|consensus               89.2    0.63 1.4E-05   43.5   4.8   29   11-43    543-571 (752)
405 KOG0616|consensus               89.2    0.59 1.3E-05   40.8   4.3   41   11-79    151-191 (355)
406 KOG0604|consensus               89.1    0.52 1.1E-05   41.3   4.0   54    9-87    166-219 (400)
407 cd05064 PTKc_EphR_A10 Catalyti  88.8    0.53 1.1E-05   38.0   3.7   16   28-43    127-142 (266)
408 KOG0599|consensus               88.8     0.4 8.6E-06   41.7   3.0   41   28-92    143-183 (411)
409 KOG0582|consensus               88.7    0.66 1.4E-05   42.3   4.4   33    7-43    129-161 (516)
410 COG3281 Ble Uncharacterized pr  88.3    0.26 5.5E-06   43.8   1.6   45   27-96    284-337 (438)
411 cd05078 PTK_Jak2_Jak3_rpt1 Pse  88.1    0.71 1.5E-05   37.0   4.0   18   27-44    119-136 (258)
412 cd05076 PTK_Tyk2_rpt1 Pseudoki  87.9       1 2.2E-05   36.8   4.8   16   28-43    137-152 (274)
413 KOG0615|consensus               87.6    0.73 1.6E-05   41.7   4.0   19   26-44    294-312 (475)
414 KOG1187|consensus               86.9    0.77 1.7E-05   40.3   3.8   19   28-46    197-215 (361)
415 COG5072 ALK1 Serine/threonine   86.8    0.78 1.7E-05   41.4   3.7   62    4-90    315-379 (488)
416 COG1718 RIO1 Serine/threonine   86.8    0.59 1.3E-05   39.7   2.8   26   27-77    186-211 (268)
417 KOG0198|consensus               86.6       1 2.2E-05   39.1   4.3   17   27-43    136-152 (313)
418 PF10707 YrbL-PhoP_reg:  PhoP r  86.6     1.8 3.9E-05   35.0   5.5   45    8-76    122-166 (199)
419 cd08227 PK_STRAD_alpha Pseudok  86.4    0.98 2.1E-05   37.8   4.1   16   28-43    121-136 (327)
420 KOG2268|consensus               86.4     1.2 2.7E-05   39.7   4.7   43    8-78    206-248 (465)
421 KOG1164|consensus               86.3       1 2.2E-05   38.3   4.1   36   26-80    140-175 (322)
422 KOG1035|consensus               85.7    0.94   2E-05   45.8   4.0   17   27-43    716-732 (1351)
423 cd08226 PK_STRAD_beta Pseudoki  85.4    0.88 1.9E-05   38.1   3.3   16   28-43    121-136 (328)
424 KOG0586|consensus               85.3     0.9 1.9E-05   42.6   3.4   31   27-81    174-204 (596)
425 KOG0659|consensus               85.1     1.1 2.4E-05   38.5   3.7   16   28-43    121-136 (318)
426 KOG0032|consensus               85.0     1.1 2.3E-05   39.8   3.7   38   27-84    154-191 (382)
427 KOG0579|consensus               84.3    0.53 1.1E-05   45.1   1.5   16   28-43    150-165 (1187)
428 KOG0605|consensus               83.9     1.3 2.9E-05   41.0   3.9   31   26-80    259-289 (550)
429 KOG4236|consensus               83.7     1.6 3.5E-05   41.1   4.4   33   28-81    684-716 (888)
430 KOG0577|consensus               83.6     0.5 1.1E-05   44.9   1.1   35   27-85    145-179 (948)
431 KOG0591|consensus               83.0     2.2 4.7E-05   37.3   4.6   40    4-43    121-163 (375)
432 KOG0671|consensus               82.5     2.7 5.8E-05   37.7   5.1   50   26-80    210-260 (415)
433 KOG0663|consensus               82.4     2.3 4.9E-05   37.9   4.5   17   27-43    196-212 (419)
434 KOG0612|consensus               81.1     2.1 4.5E-05   43.2   4.3   19   26-44    193-211 (1317)
435 PTZ00266 NIMA-related protein   80.0     2.1 4.6E-05   42.7   4.0   16   28-43    145-160 (1021)
436 PHA03111 Ser/Thr kinase; Provi  80.0     3.1 6.6E-05   37.2   4.5   22   23-44    298-319 (444)
437 KOG0694|consensus               79.4     2.1 4.5E-05   40.8   3.5   56   10-93    474-529 (694)
438 KOG0590|consensus               79.4     1.7 3.7E-05   40.9   3.0   20   25-44    437-456 (601)
439 PF07714 Pkinase_Tyr:  Protein   79.3     3.1 6.8E-05   33.5   4.2   15   29-43    124-138 (259)
440 KOG0665|consensus               79.2     1.2 2.5E-05   39.2   1.7   36   26-85    136-171 (369)
441 KOG0192|consensus               78.7     2.9 6.3E-05   36.8   4.1   17   29-45    164-180 (362)
442 KOG0664|consensus               78.6     1.5 3.3E-05   38.1   2.2   30   27-80    175-204 (449)
443 KOG1027|consensus               78.4     2.4 5.2E-05   41.4   3.7   17   27-43    625-641 (903)
444 KOG1151|consensus               78.3     4.1 8.8E-05   37.8   4.9   17   28-44    590-606 (775)
445 KOG0193|consensus               76.8     2.4 5.2E-05   40.1   3.1   17   27-43    507-523 (678)
446 KOG0600|consensus               76.2     4.4 9.5E-05   37.6   4.6   18   26-43    236-253 (560)
447 PF05445 Pox_ser-thr_kin:  Poxv  76.2     2.7 5.8E-05   37.7   3.1   23   23-45    294-316 (434)
448 KOG0661|consensus               75.9     1.5 3.3E-05   40.3   1.6   19   25-43    127-145 (538)
449 KOG0575|consensus               75.5     3.5 7.6E-05   38.7   3.8   17   27-43    137-153 (592)
450 COG0515 SPS1 Serine/threonine   75.3     4.6  0.0001   31.3   4.0   16   28-43    121-136 (384)
451 KOG0585|consensus               74.3       2 4.4E-05   39.7   1.9   17   28-44    230-246 (576)
452 KOG1989|consensus               74.0     3.6 7.8E-05   39.7   3.6   34   27-84    165-198 (738)
453 KOG0666|consensus               73.1     2.6 5.7E-05   37.3   2.3   15   29-43    153-167 (438)
454 KOG3021|consensus               73.0      12 0.00025   31.8   6.0   40   28-92    211-250 (313)
455 KOG1165|consensus               69.5      12 0.00025   33.6   5.4   34   28-80    144-177 (449)
456 PF14531 Kinase-like:  Kinase-l  67.9     8.5 0.00018   33.0   4.3   38   14-79    155-192 (288)
457 KOG1345|consensus               64.6      11 0.00023   33.0   4.2   31   28-80    141-171 (378)
458 cd05172 PIKKc_DNA-PK DNA-depen  63.4     6.5 0.00014   32.5   2.6   32   26-80    135-166 (235)
459 PF02604 PhdYeFM_antitox:  Anti  63.1     8.3 0.00018   25.4   2.7   33    1-33      1-33  (75)
460 KOG0584|consensus               62.6      11 0.00025   35.6   4.3   17   28-44    165-181 (632)
461 cd00142 PI3Kc_like Phosphoinos  61.8     5.5 0.00012   32.3   1.9   35   26-83    127-161 (219)
462 KOG2270|consensus               61.4     7.5 0.00016   35.4   2.8   18   26-43    283-300 (520)
463 KOG0574|consensus               61.1     2.7 5.8E-05   37.1  -0.1   15   29-43    150-164 (502)
464 KOG2269|consensus               60.5     8.6 0.00019   34.6   3.0   50    4-78    380-429 (531)
465 KOG0662|consensus               60.3     5.2 0.00011   33.0   1.5   13   31-43    124-136 (292)
466 KOG1240|consensus               59.5     4.4 9.6E-05   41.1   1.1   19   25-43    137-155 (1431)
467 cd05170 PIKKc_SMG1 Suppressor   58.0     7.1 0.00015   33.6   2.0   30   27-79    209-238 (307)
468 KOG1290|consensus               57.8     9.2  0.0002   35.6   2.8   43    2-44    182-224 (590)
469 cd05171 PIKKc_ATM Ataxia telan  57.7       7 0.00015   33.1   1.9   31   26-79    180-210 (279)
470 KOG4717|consensus               57.1      11 0.00025   35.6   3.2   18   26-43    136-153 (864)
471 PF10009 DUF2252:  Uncharacteri  56.9      18 0.00038   32.3   4.4   76   24-131    40-120 (385)
472 cd05169 PIKKc_TOR TOR (Target   56.8     8.1 0.00018   32.5   2.2   31   26-79    180-210 (280)
473 KOG0597|consensus               56.6      13 0.00028   35.5   3.5   39    4-43     97-135 (808)
474 KOG4158|consensus               56.1      17 0.00036   33.4   4.1   21   27-47    360-380 (598)
475 KOG0587|consensus               55.9      18 0.00039   35.8   4.5   17   27-43    142-158 (953)
476 KOG2052|consensus               53.1      17 0.00036   33.5   3.6   25   23-47    331-355 (513)
477 cd00892 PIKKc_ATR ATR (Ataxia   53.0       9  0.0002   31.7   1.8   32   26-80    138-169 (237)
478 cd05164 PIKKc Phosphoinositide  52.9     8.3 0.00018   31.6   1.5   32   26-80    130-161 (222)
479 KOG0201|consensus               52.7      16 0.00035   33.4   3.4   29   29-81    132-160 (467)
480 KOG0611|consensus               52.5     7.4 0.00016   35.7   1.3   17   27-43    172-188 (668)
481 KOG1152|consensus               52.0      20 0.00044   34.2   4.0   33   25-81    687-719 (772)
482 COG2112 Predicted Ser/Thr prot  51.0     9.7 0.00021   31.1   1.6   36   27-87    124-161 (201)
483 KOG0580|consensus               51.0      15 0.00032   31.4   2.7   23   20-43    137-159 (281)
484 KOG0907|consensus               50.1      34 0.00075   24.7   4.3   43   68-113    20-62  (106)
485 KOG1236|consensus               49.7     8.2 0.00018   35.6   1.1   18   29-46    366-383 (565)
486 smart00146 PI3Kc Phosphoinosit  49.5      13 0.00029   29.7   2.2   35   26-84    100-134 (202)
487 KOG2464|consensus               49.1      18  0.0004   29.8   3.1   30   14-43    144-173 (246)
488 KOG3653|consensus               49.1      34 0.00074   31.7   4.9   23   25-47    333-355 (534)
489 KOG0589|consensus               44.7      15 0.00033   33.3   2.0   18   26-43    124-141 (426)
490 PF00454 PI3_PI4_kinase:  Phosp  43.8      14 0.00031   29.7   1.6   32   27-81    134-165 (235)
491 KOG0906|consensus               43.8 3.2E+02   0.007   26.7  10.6   71    3-97    644-745 (843)
492 KOG4721|consensus               43.2      20 0.00044   34.3   2.6   16   28-43    232-247 (904)
493 PF12377 DuffyBP_N:  Duffy bind  40.4      46   0.001   22.0   3.2   27   66-92     18-44  (66)
494 PF13575 DUF4135:  Domain of un  39.1      19  0.0004   31.5   1.7   29   29-82    150-178 (370)
495 KOG0669|consensus               38.7      16 0.00034   31.7   1.1   17   27-43    143-159 (376)
496 cd05163 TRRAP TRansformation/t  38.6      22 0.00048   29.7   2.0   30   27-79    154-183 (253)
497 KOG0033|consensus               38.5      22 0.00047   30.7   1.9   19   26-44    128-146 (355)
498 KOG0614|consensus               37.0      19 0.00042   33.9   1.5   28   28-79    540-567 (732)
499 PF12260 PIP49_C:  Protein-kina  36.8      76  0.0017   25.0   4.8   32   29-84     83-114 (188)
500 KOG4645|consensus               36.7      51  0.0011   34.3   4.4   16   28-43   1354-1369(1509)

No 1  
>KOG2686|consensus
Probab=100.00  E-value=2.8e-45  Score=316.04  Aligned_cols=151  Identities=43%  Similarity=0.716  Sum_probs=140.8

Q ss_pred             CCccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664          1 MKKILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus         1 ~~~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ++.+..++|..|+.+++++.+..++|+||||||||+||||+.+                       ..+.+++||||||+
T Consensus       186 ~~~~~~~~l~~e~~~~~~~~e~~~~~vvFcHNDlq~gNiL~~~-----------------------~t~~Lv~IDfEYas  242 (366)
T KOG2686|consen  186 PDKLEIEDLLLELSLFRKWSELTKSPVVFCHNDLQYGNILLLN-----------------------STKELVLIDFEYAS  242 (366)
T ss_pred             cchhhHHHHHHHHHHHHHHHhcCCCCeeeecccccccceeeec-----------------------CCCceeEEeecccc
Confidence            4678889999999999999977889999999999999999986                       34689999999999


Q ss_pred             CccchhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCC---C--CCcHHHHHHHHHHHHHHHHHH
Q psy15664         81 YNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQ---E--DSTPESVLEEVKHFTLASHFF  155 (174)
Q Consensus        81 ~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~---~--~~~v~~l~~~v~~~~~~s~~~  155 (174)
                      ||+||||||||||||++||+++++|++.++.+.||++++++.|+++|+.+...   +  +++++.|+++++.|++++|++
T Consensus       243 yN~r~fDlanHf~E~~~DY~~~~~P~~~~~~~~~p~~e~~~~F~~sYl~~~~~~~~~~~~~ev~~L~~e~~~~~p~shlf  322 (366)
T KOG2686|consen  243 YNPRGFDLANHFCEWAADYHTPTPPGLKINPDLYPGEEQRQRFIESYLDSAAVKRKEPREKEVEKLLKEIRFFTPASHLF  322 (366)
T ss_pred             CCchhhhHHHHHHHhhccccCCCCCeeecchhhCCCcHHHHHHHHHHHHHhhccccCchHHHHHHHHHHHHHHhhhhHHH
Confidence            99999999999999999999999999999999999999999999999988763   2  278999999999999999999


Q ss_pred             HHHHHHHHcccC-CCCCCCC
Q psy15664        156 WALWSFVHDDTS-EISFGYW  174 (174)
Q Consensus       156 W~lWaliq~~~s-~i~fdy~  174 (174)
                      |+|||++|+..+ .|+|||+
T Consensus       323 W~LWsi~q~~~~~~i~fdy~  342 (366)
T KOG2686|consen  323 WGLWSILQALVLHKIEFDYM  342 (366)
T ss_pred             HHHHHHHHhhhccccccChH
Confidence            999999999999 8999995


No 2  
>KOG4720|consensus
Probab=100.00  E-value=2e-44  Score=304.62  Aligned_cols=140  Identities=39%  Similarity=0.728  Sum_probs=130.9

Q ss_pred             ccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664          3 KILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus         3 ~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      .++++.|.+|+.||++.+...++|+|||||||.+|||+++.                       ..+++.|||||||+||
T Consensus       224 ~~~~~~L~~Ei~~l~E~l~~L~sPVVFcHNDLL~~Niiy~~-----------------------~~~~v~fIDYEYa~yN  280 (391)
T KOG4720|consen  224 EPSPEDLGEEISKLKEMLSMLKSPVVFCHNDLLCGNIIYDS-----------------------EKGSVEFIDYEYAGYN  280 (391)
T ss_pred             CCCHHHHHHHHHHHHHHHHhhCCCeEEeecchhhcceeecc-----------------------ccCcEEEEeecccccc
Confidence            46788999999999999999999999999999999999987                       5688999999999999


Q ss_pred             cchhhHHHHHHHHhhhccCCCCCcc-cccCCCCCCHHHHHHHHHHHHhccCCCC---CcHHHHHHHHHHHHHHHHHHHHH
Q psy15664         83 YRAFDIANHFVESVYDYSYKHFPHY-TVKRENYPSYSLRKSFVETYLSRMNQED---STPESVLEEVKHFTLASHFFWAL  158 (174)
Q Consensus        83 ~~~fDlan~f~E~~~dy~~~~~p~~-~~~~~~~p~~~~~~~fl~~Yl~~~~~~~---~~v~~l~~~v~~~~~~s~~~W~l  158 (174)
                      |++|||||||||.+         |. .+|++.||++|+|.+||+.||+..++.+   .+|+.|+.+|.+|.+++|++|++
T Consensus       281 Y~afDIgNHFnE~a---------Gv~evDYSlyp~rE~Q~qwl~~YLq~~kg~evs~~eVe~lfvqvn~FalAsHlfWav  351 (391)
T KOG4720|consen  281 YQAFDIGNHFNEYA---------GVEEVDYSLYPTREEQLQWLRDYLQAYKGKEVSDTEVETLFVQVNQFALASHLFWAV  351 (391)
T ss_pred             hhheehhhhHHhhc---------CCCccchhcCCCHHHHHHHHHHHHhhccCccCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999987         23 5788999999999999999999987643   79999999999999999999999


Q ss_pred             HHHHHcccCCCCCCCC
Q psy15664        159 WSFVHDDTSEISFGYW  174 (174)
Q Consensus       159 Waliq~~~s~i~fdy~  174 (174)
                      ||++|++.|+|||||+
T Consensus       352 WAllQA~~StIdFdyl  367 (391)
T KOG4720|consen  352 WALLQAQNSTIDFDYL  367 (391)
T ss_pred             HHHHHhhcCcccccch
Confidence            9999999999999995


No 3  
>PTZ00296 choline kinase; Provisional
Probab=100.00  E-value=3.9e-42  Score=306.33  Aligned_cols=144  Identities=35%  Similarity=0.687  Sum_probs=129.2

Q ss_pred             hhhHHHHHHHHHHHHh------hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664          6 SKDLNTEADWLKKHLL------KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus         6 ~~~L~~e~~~l~~~l~------~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .+.+.+|+.++++.+.      ..+.++||||||++++|||..+                         ++++|||||||
T Consensus       257 ~~~l~~e~~~l~~~l~~~~~l~~~~~~~VfCHNDl~~~NiL~~~-------------------------~~l~LIDfEYA  311 (442)
T PTZ00296        257 IHKYIKESEKFIKFMKVYSKSDNLANDIVFCHNDLQENNIINTN-------------------------KCLRLIDFEYS  311 (442)
T ss_pred             HHHHHHHHHHHHHHHHhhcccccccCCeeEEeCCCCccceeecC-------------------------CCEEEEeeccc
Confidence            4567788999988886      5567999999999999999754                         46999999999


Q ss_pred             cCccchhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC------CCcHHHHHHHHHHHHHHHH
Q psy15664         80 SYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE------DSTPESVLEEVKHFTLASH  153 (174)
Q Consensus        80 ~~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~------~~~v~~l~~~v~~~~~~s~  153 (174)
                      |+|+|+||||||||||++||+.+++|+|.++.+.||+.++|+.|+++||+.....      ++++++++.+|..|++++|
T Consensus       312 g~ndpafDIAn~f~E~~~dy~~~~~p~f~~d~~~yPs~e~q~~Fi~~Yl~~~~~~~~~~~~~~~v~~l~~ev~~f~l~sh  391 (442)
T PTZ00296        312 GYNFLATDIANFFIETTIDYSVSHYPFFAIDKKKYISYENRKLFITAYLSNYLDKSLVVPNPKIIDQILEAVEVQALGAH  391 (442)
T ss_pred             ccccHHHHHHHHHHHHhhhcCCCCCCccccCcccCcCHHHHHHHHHHHHHHhccCCCCCchHHHHHHHHHHHHHHhhhhH
Confidence            9999999999999999999999999999999999999999999999999875221      2468899999999999999


Q ss_pred             HHHHHHHHHHcc--cCCCCCCCC
Q psy15664        154 FFWALWSFVHDD--TSEISFGYW  174 (174)
Q Consensus       154 ~~W~lWaliq~~--~s~i~fdy~  174 (174)
                      ++||+||++|+.  .|.|+|||+
T Consensus       392 l~W~lWaiiqa~~~~s~idFDy~  414 (442)
T PTZ00296        392 LLWGFWSIIRGYQTKSYNEFDFF  414 (442)
T ss_pred             HHHHHHHHHhCCcccCCCCCCHH
Confidence            999999999997  467999985


No 4  
>PTZ00384 choline kinase; Provisional
Probab=100.00  E-value=1.8e-38  Score=278.40  Aligned_cols=135  Identities=30%  Similarity=0.517  Sum_probs=120.1

Q ss_pred             hhhHHHHHHHHHHHHhhc-------CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664          6 SKDLNTEADWLKKHLLKI-------KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY   78 (174)
Q Consensus         6 ~~~L~~e~~~l~~~l~~~-------~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY   78 (174)
                      ...+.+++..+++.++..       ..++||||||++++|||..+                         +++.||||||
T Consensus       199 ~~~l~~~~~~~~~~L~~~l~~~~~~~~~~VfCHNDL~~gNIL~~~-------------------------~~l~lID~EY  253 (383)
T PTZ00384        199 YNELVQNYELFKKILNNHLNTSNSITNSVLFCHNDLFFTNILDFN-------------------------QGIYFIDFDF  253 (383)
T ss_pred             HHHHHHHHHHHHHHHHHhhccccccccceeeeeccCCcccEEecC-------------------------CCEEEEEecc
Confidence            346778888887777532       34699999999999999754                         5799999999


Q ss_pred             ccCccchhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC-----CCcHHHHHHHHHHHHHHHH
Q psy15664         79 CSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE-----DSTPESVLEEVKHFTLASH  153 (174)
Q Consensus        79 a~~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~-----~~~v~~l~~~v~~~~~~s~  153 (174)
                      |++|+|+||||||||||++||+.+++|+|..+.+.||+.++|..|++.|+++..+.     +++++.|+.+|..|++++|
T Consensus       254 A~~n~~~fDLAn~f~E~~~~y~~~~~~~~~~~~~~~ps~e~~~~fi~~Yl~~~~~~~~~~~~~~~~~l~~~v~~~~l~sh  333 (383)
T PTZ00384        254 AGFNYVGWEIANFFVKLYIVYDPPTPPYFNSDDSLALSEEMKTIFVSVYLSQLLGKNVLPSDDLVKEFLQSLEIHTLGVN  333 (383)
T ss_pred             ccCCchHhHHHHHHHHHhcccCCCCCCccccCCCCCCCHHHHHHHHHHHHHHhcCCCCCCcHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999875321     2578999999999999999


Q ss_pred             HHHHHHHHHHcc
Q psy15664        154 FFWALWSFVHDD  165 (174)
Q Consensus       154 ~~W~lWaliq~~  165 (174)
                      ++|++||+||+.
T Consensus       334 ~~W~lW~iIq~~  345 (383)
T PTZ00384        334 LFWTYWGIVMND  345 (383)
T ss_pred             HHHHHHHHHhCC
Confidence            999999999998


No 5  
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=100.00  E-value=1.6e-38  Score=273.04  Aligned_cols=139  Identities=39%  Similarity=0.676  Sum_probs=122.8

Q ss_pred             cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664          4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus         4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      +..+.+.+++..+++.+...+.|+||||||++++|||+.+                       .++++.||||||||+|+
T Consensus       159 ~~~~~l~~~~~~l~~~~~~~~~~~v~CHnDl~~~NiL~~~-----------------------~~~~l~lID~EYag~nd  215 (330)
T PLN02421        159 ISFEELRDEIVELKEITDSLKAPVVFAHNDLLSGNLMLNE-----------------------DEGKLYFIDFEYGSYSY  215 (330)
T ss_pred             cCHHHHHHHHHHHHHHhccCCCCeEEEECCCCcccEEEeC-----------------------CCCcEEEEcccccCCCc
Confidence            4467888999999999988899999999999999999975                       24679999999999999


Q ss_pred             chhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC---CCcHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664         84 RAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE---DSTPESVLEEVKHFTLASHFFWALWS  160 (174)
Q Consensus        84 ~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~---~~~v~~l~~~v~~~~~~s~~~W~lWa  160 (174)
                      |+||||||||||+         +|.++.+.||+.++|..|+++|++.....   +.++++++.+|+.|++++|++|++||
T Consensus       216 ~~fDIa~~f~E~~---------~~~~~~~~~p~~~~~~~fl~~Y~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~W~lWa  286 (330)
T PLN02421        216 RGYDIGNHFNEYA---------GFDCDYSLYPSKEEQYHFFRHYLRPDDPEEVSDAELEELFVETNFYALASHLYWAIWA  286 (330)
T ss_pred             cHHHHHHHHHHHc---------ccccCcccCcCHHHHHHHHHHhCCcccCCcchHHHHHHHHHHHHHHhhhhHHHHHHHH
Confidence            9999999999987         24456689999999999999999764321   25688999999999999999999999


Q ss_pred             HHHcccCCCCCCCC
Q psy15664        161 FVHDDTSEISFGYW  174 (174)
Q Consensus       161 liq~~~s~i~fdy~  174 (174)
                      ++|+..|+|+|||+
T Consensus       287 ~iq~~~s~i~fdf~  300 (330)
T PLN02421        287 IVQAKMSPIDFDYL  300 (330)
T ss_pred             HHHhhcCCcCCCHH
Confidence            99999999999985


No 6  
>PLN02236 choline kinase
Probab=100.00  E-value=1.8e-36  Score=261.94  Aligned_cols=145  Identities=40%  Similarity=0.719  Sum_probs=127.9

Q ss_pred             chhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664          5 LSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus         5 ~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      ..+.+..++.+|++.+.....++||||||++++|||+.+                       .++.+.|||||||++|+|
T Consensus       178 ~~~~l~~~~~~L~~~~~~~~~~~~~cH~Dl~~~Nil~~~-----------------------~~~~~~lID~Eya~~~~~  234 (344)
T PLN02236        178 RLDSLEDEINLLEKELSGDDQEIGFCHNDLQYGNIMIDE-----------------------ETRAITIIDYEYASYNPV  234 (344)
T ss_pred             CHHHHHHHHHHHHHHhcccCCCceEEeCCCCcCcEEEeC-----------------------CCCcEEEEeehhccccch
Confidence            346788899999998888788999999999999999975                       235799999999999999


Q ss_pred             hhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC--CCcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664         85 AFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE--DSTPESVLEEVKHFTLASHFFWALWSFV  162 (174)
Q Consensus        85 ~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~--~~~v~~l~~~v~~~~~~s~~~W~lWali  162 (174)
                      +||||+||||++.+|+.+++  +.++.+.||+.++++.|++.|+++.+..  +.+++.++.+|+.|.+++|++|++||++
T Consensus       235 ~~Dia~~~~e~~~~y~~~~~--~~~~~~~~~~~~~~~~fi~~Yl~~~g~~~~~~~~~~l~~~v~~~~~~~~l~W~lWa~i  312 (344)
T PLN02236        235 AYDIANHFCEMAADYHSETP--HILDYSKYPGEEERRRFIRTYLSSSGEEPSDEEVEQLLDDVEKYTLASHLFWGLWGII  312 (344)
T ss_pred             HHHHHHHHHHHHHhhcCCCc--ccCchhhCcCHHHHHHHHHHHHhhcCCCchHHHHHHHHHHHHHHhhHhHHHHHHHHHH
Confidence            99999999999999977654  3378888999999999999999764321  2578899999999999999999999999


Q ss_pred             HcccCCCCCCCC
Q psy15664        163 HDDTSEISFGYW  174 (174)
Q Consensus       163 q~~~s~i~fdy~  174 (174)
                      |+..|+|+|||+
T Consensus       313 q~~~s~~~fdy~  324 (344)
T PLN02236        313 SGHVNKIDFDYM  324 (344)
T ss_pred             hcccCCCCCCHH
Confidence            999999999985


No 7  
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=100.00  E-value=4e-34  Score=240.38  Aligned_cols=135  Identities=46%  Similarity=0.832  Sum_probs=114.8

Q ss_pred             HHHHHHHHHHHHhh-----cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664          9 LNTEADWLKKHLLK-----IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus         9 L~~e~~~l~~~l~~-----~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      +..++..+++.+..     ...++||||||++++|||+.+++.                    +.+.+.|||||||++|+
T Consensus       156 ~~~~~~~~~~~l~~~~~~~~~~~~~lcH~Dl~~~Nil~~~~~~--------------------~~~~i~lIDwEya~~~~  215 (302)
T cd05156         156 FLEDEAKYLRFLLESTSEESGSPVVFCHNDLQEGNILLLNPSS--------------------ETKKLVLIDFEYASYNY  215 (302)
T ss_pred             HHHHHHHHHHHHHhhccCCCCCCceEEecCCCcCeEEecCCCC--------------------CCCcEEEEeeCCCCCCC
Confidence            34444455555543     347899999999999999986210                    13679999999999999


Q ss_pred             chhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCC-------CCcHHHHHHHHHHHHHHHHHHH
Q psy15664         84 RAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE-------DSTPESVLEEVKHFTLASHFFW  156 (174)
Q Consensus        84 ~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~-------~~~v~~l~~~v~~~~~~s~~~W  156 (174)
                      |+||||+|||||+++|+.+++|++.++.+.||+.++|..|++.|+++....       ..++++++.+|+.|.+++|++|
T Consensus       216 p~~DlA~~~~e~~~~~~~~~~~~~~~~~~~~p~~~~~~~f~~~Yl~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~W  295 (302)
T cd05156         216 RGFDIANHFCEWMYDYHDPEPPFFKIHEDKYPTEEQRLNFISAYLSESLKGKNSVEEREKEVKDLLEEVEIFTPASHLFW  295 (302)
T ss_pred             cHHHHHHHHHHHHhhcCCCCCCccccChhhCcCHHHHHHHHhccCchhcccccccCcHHHHHHHHHHHHHHHHhhhhHHH
Confidence            999999999999999999999999999999999999999999999876421       2678899999999999999999


Q ss_pred             HHHHHHH
Q psy15664        157 ALWSFVH  163 (174)
Q Consensus       157 ~lWaliq  163 (174)
                      ++||++|
T Consensus       296 ~lW~~~q  302 (302)
T cd05156         296 ALWGIIQ  302 (302)
T ss_pred             HHHHhcC
Confidence            9999997


No 8  
>PF01633 Choline_kinase:  Choline/ethanolamine kinase;  InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome.  Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=99.92  E-value=9.3e-26  Score=181.30  Aligned_cols=92  Identities=43%  Similarity=0.711  Sum_probs=75.1

Q ss_pred             cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664          4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus         4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      +.+..|.+++.++++.+++.++++|||||||+++|||+..                       .+++++|||||||++|+
T Consensus       120 ~~~~~l~~~~~~~~~~l~~~~~~~v~cHnDl~~~Nil~~~-----------------------~~~~~~lIDfEya~~n~  176 (211)
T PF01633_consen  120 EDLEDLQEELEELEKLLEKSNSPLVFCHNDLNPGNILINN-----------------------KDGEVKLIDFEYAGYND  176 (211)
T ss_dssp             HHHHHHHHHHHHHHHHHHTSCGGEEEE-S--SGGGEEETS-----------------------SSSCEEE--GTT-EEEE
T ss_pred             CCHHHHHHHHhhhhhhhhccCCCceEeeccCccccEEecc-----------------------CCCeEEEecHHHHhhcc
Confidence            3456788999999999998899999999999999999933                       35889999999999999


Q ss_pred             chhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHH
Q psy15664         84 RAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSL  119 (174)
Q Consensus        84 ~~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~  119 (174)
                      |+|||||||+|++++|...+. .+.++.+.||+++|
T Consensus       177 ~~fDia~~f~e~~~~~~~~~~-~~~~~~~~yp~~~~  211 (211)
T PF01633_consen  177 RAFDIANFFCEWNFDYEQEEF-FFKCDYSKYPTEEQ  211 (211)
T ss_dssp             HHHHHHHHHHHTTEETTHSST-STEE-GGGS--HHH
T ss_pred             chhhHHHHHHHHcCchhhhhh-hhhhhHhhCCCccC
Confidence            999999999999999999888 89999999999875


No 9  
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=99.83  E-value=3.4e-20  Score=152.84  Aligned_cols=98  Identities=21%  Similarity=0.290  Sum_probs=83.7

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      +.+.|+||||++++|||+++                         +++.|||||||++|+|+||||++++++        
T Consensus       143 ~~~~~l~H~Dl~~~Nil~~~-------------------------~~~~lIDwE~a~~gdp~~DLa~~~~~~--------  189 (256)
T TIGR02721       143 PLPLAPLHMDVHAYNLVVTP-------------------------QGLKLIDWEYASDGDIALELAAIIRAN--------  189 (256)
T ss_pred             CCCCeeecCCCCcCcEEEeC-------------------------CCCEEEeccccCcCCHHHHHHHHHHhC--------
Confidence            34789999999999999976                         348999999999999999999999873        


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcccCC
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDDTSE  168 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~~s~  168 (174)
                                  +.+++..|+++|.+....  ...+.+.++++.|.++++++|++|+.++...+.
T Consensus       190 ------------~~~~~~~~l~~Y~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~  240 (256)
T TIGR02721       190 ------------DEEQQQDFVQRYCQRRRI--YSISVLWRQVKAWQPWVDYMAALWFELRWQQTG  240 (256)
T ss_pred             ------------CHHHHHHHHHHHHHhhCC--ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence                        478899999999976432  234678899999999999999999988876653


No 10 
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=99.83  E-value=1.2e-20  Score=152.71  Aligned_cols=87  Identities=45%  Similarity=0.833  Sum_probs=74.7

Q ss_pred             hhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664          6 SKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA   85 (174)
Q Consensus         6 ~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~   85 (174)
                      .+.+.+++.+|++.+.....+.|+||||++++|||+++                       .++.+.|||||||++|+|+
T Consensus       149 ~~~l~~~~~~l~~~l~~~~~~~~l~H~Dl~~~Nil~~~-----------------------~~~~~~lIDwe~a~~~~~~  205 (235)
T cd05157         149 FEQLRDEISWLKELLSALNSPIVFCHNDLLSGNIIYNE-----------------------EKNSVKFIDYEYAGYNYRA  205 (235)
T ss_pred             HHHHHHHHHHHHHHhcccCCCEEEEcCCCCcCcEEEeC-----------------------CCCCEEEEEcccCCcCchh
Confidence            45677778888888877778899999999999999985                       2357999999999999999


Q ss_pred             hhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHH
Q psy15664         86 FDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFV  124 (174)
Q Consensus        86 fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl  124 (174)
                      ||||++|+||+         ++.++...||+.++|+.|+
T Consensus       206 ~Dla~~~~e~~---------~~~~~~~~~~~~~~~~~~~  235 (235)
T cd05157         206 FDIANHFNEWA---------GFDCDYYLYPPKEEQQAFI  235 (235)
T ss_pred             eeHHHHHHHHc---------CccCChhhCcCHHHHHhhC
Confidence            99999999987         2455678999999999985


No 11 
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=99.82  E-value=9e-20  Score=153.50  Aligned_cols=110  Identities=27%  Similarity=0.538  Sum_probs=90.3

Q ss_pred             hhHHHHHHHHHHHHhhcCCC-eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664          7 KDLNTEADWLKKHLLKIKSP-VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA   85 (174)
Q Consensus         7 ~~L~~e~~~l~~~l~~~~~~-~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~   85 (174)
                      ..+++.+..|++.+...+.+ .|+||||++++|+|.++                        ++++.||||||||+|+++
T Consensus       132 ~~~~~~~~~l~~~l~~~~~~~~v~cH~Dl~~~N~l~t~------------------------~~~l~LIDWEyAg~~D~~  187 (269)
T COG0510         132 HLLRKKLKELRRALEEVPKDDLVPCHNDLNPGNLLLTD------------------------KGGLFLIDWEYAGLNDPA  187 (269)
T ss_pred             HHHHHHHHHHHHHhhhcCCCceeeecCCCCccceEEcC------------------------CCcEEEEecccCCCccHH
Confidence            35667788888888888877 89999999999999986                        478999999999999999


Q ss_pred             hhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcc
Q psy15664         86 FDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDD  165 (174)
Q Consensus        86 fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~  165 (174)
                      ||||+++.|+..+                  ..+......+|++...-     +.    |..+.+...+.|.+|+.+|..
T Consensus       188 ~DLA~~~~e~~~~------------------~~~~~~~~~~~~~~~~~-----~~----~~~~~i~~~~~W~l~~~~~~~  240 (269)
T COG0510         188 FDLAALLSEYIFN------------------HNELEDLYSAYLEKYGF-----EA----VLIYKILQKFLWYLWTKLQEQ  240 (269)
T ss_pred             HHHHHHHHHhccc------------------hhHHHHHHHHHHHhCCc-----hh----hHHHHHHHHhHHHHHHHHHHH
Confidence            9999999998853                  33455566666665432     11    678999999999999999998


Q ss_pred             cC
Q psy15664        166 TS  167 (174)
Q Consensus       166 ~s  167 (174)
                      ..
T Consensus       241 ~~  242 (269)
T COG0510         241 IL  242 (269)
T ss_pred             hh
Confidence            76


No 12 
>PRK10271 thiK thiamine kinase; Provisional
Probab=99.73  E-value=2.4e-17  Score=132.42  Aligned_cols=97  Identities=20%  Similarity=0.266  Sum_probs=84.0

Q ss_pred             hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccC
Q psy15664         22 KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY  101 (174)
Q Consensus        22 ~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~  101 (174)
                      ..+.+.|+||||++++||++.+                         +++++||||||+.|+|++|||..+.+       
T Consensus        72 ~~~l~~~p~H~D~~~~N~~~~~-------------------------~~~~lIDwe~a~~gDp~~DLa~~~~~-------  119 (188)
T PRK10271         72 PRPLRLAPLHMDVHAGNLVHSA-------------------------SGLRLIDWEYAGDGDIALELAAVWVE-------  119 (188)
T ss_pred             CCCCCeeeecCCCCCccEEEEC-------------------------CCEEEEeCCcccCCCHHHHHHHHHcC-------
Confidence            4456789999999999999876                         45999999999999999999999863       


Q ss_pred             CCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcccC
Q psy15664        102 KHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDDTS  167 (174)
Q Consensus       102 ~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~~s  167 (174)
                                    +.++++.|+++|.++..   .+...+.++++.|.+...++=.+|..++.+.+
T Consensus       120 --------------~~~~~~~~l~~Y~~~~~---~d~~~~~~~~~~W~p~~~~m~llWyev~~qq~  168 (188)
T PRK10271        120 --------------NTEQHRQLVNDYATRAK---IDAAQLWRQVRRWFPWVLMLKAGWFEYRWRQT  168 (188)
T ss_pred             --------------CHHHHHHHHHHHhCccC---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence                          47899999999996521   34567899999999999999999999998775


No 13 
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=99.49  E-value=1.7e-13  Score=104.69  Aligned_cols=78  Identities=35%  Similarity=0.494  Sum_probs=62.2

Q ss_pred             HHHHHHHHHHhhcCC-CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHH
Q psy15664         11 TEADWLKKHLLKIKS-PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIA   89 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~-~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDla   89 (174)
                      .++..+-+.+...+. +.++||+|++++|||+++                         +++++||||+++++++++|||
T Consensus        90 ~~l~~~l~~LH~~~~~~~~~~HgD~~~~Nil~~~-------------------------~~~~liDf~~a~~~~~~~Dla  144 (170)
T cd05151          90 EKIAKLLKKLHSSPLPDLVPCHNDLLPGNFLLDD-------------------------GRLWLIDWEYAGMNDPLFDLA  144 (170)
T ss_pred             HHHHHHHHHHhCCCCCCceeecCCCCcCcEEEEC-------------------------CeEEEEecccccCCChHHHHH
Confidence            334433333433332 678999999999999974                         579999999999999999999


Q ss_pred             HHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664         90 NHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRM  131 (174)
Q Consensus        90 n~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~  131 (174)
                      .++.++.+                  +++++..|+++|-++.
T Consensus       145 ~~~~~~~~------------------~~~~~~~~~~~y~~~~  168 (170)
T cd05151         145 NFFSEAKL------------------SEDQEEELLEAYFGRE  168 (170)
T ss_pred             HHHHhcCC------------------CHHHHHHHHHHHhCCC
Confidence            99988652                  6888999999998764


No 14 
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=99.41  E-value=4.7e-12  Score=105.79  Aligned_cols=99  Identities=15%  Similarity=0.178  Sum_probs=69.8

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      ..|.++||+|++++|||+++                        ++.+.|||||+|+++++.+|||..+..|++...   
T Consensus       172 ~~~~~l~HgD~~~~Nil~~~------------------------~~~~~iIDfe~a~~g~~~~Dla~~~~~~~~~~~---  224 (296)
T cd05153         172 DLPRGVIHADLFRDNVLFDG------------------------DELSGVIDFYFACTDAFLYDLAITLNDWCFDED---  224 (296)
T ss_pred             cCCCcCCccCcCcccEEEeC------------------------CceEEEeehhhhcCchHHHHHHHHHHHHHhCcc---
Confidence            45789999999999999986                        234579999999999999999999988774211   


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFV  162 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWali  162 (174)
                              .. .+.+....|++.|.+..+-.+++.+    .+..+.++..+.+.+|++.
T Consensus       225 --------~~-~~~~~~~~~l~gY~~~~~ls~~e~~----~l~~~~~~~a~~~~~~~~~  270 (296)
T cd05153         225 --------GA-LDPERAQALLAGYQAVRPLTEAERA----ALPIMLRGAALRFWLSRLY  270 (296)
T ss_pred             --------CC-CCHHHHHHHHHHHHhcCCCCHHHHH----HHHHHHHHHHHHHHHHHHH
Confidence                    11 2677899999999876443223333    3344444444555555553


No 15 
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=99.39  E-value=7.9e-13  Score=108.39  Aligned_cols=73  Identities=18%  Similarity=0.178  Sum_probs=59.6

Q ss_pred             HHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHH
Q psy15664         15 WLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVE   94 (174)
Q Consensus        15 ~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E   94 (174)
                      .+++.++..+.+.++||+|++++|||+.+                        ++ +.|||||++++++|.+|||.++.-
T Consensus       141 ~l~~~l~~~~~~~~~~HgD~~~~Nii~~~------------------------~~-~~iIDwe~a~~Gdp~~Dla~~~~~  195 (226)
T TIGR02172       141 KARAFIKEVPDTSTCLHGDFQIGNLITSG------------------------KG-TYWIDLGDFGYGNPLFDLGLLFMF  195 (226)
T ss_pred             HHHHHHHhCCCCCceEecCCCCCcEEEcC------------------------CC-cEEEechhcCcCCHHHHHHHHHHh
Confidence            34555555666678899999999999976                        23 899999999999999999998865


Q ss_pred             HhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhc
Q psy15664         95 SVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSR  130 (174)
Q Consensus        95 ~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~  130 (174)
                      +.+                  ...++++|+..|..+
T Consensus       196 ~~~------------------~~~~~~~~~~~y~~~  213 (226)
T TIGR02172       196 CHY------------------LDDDKLQAIFHMNAE  213 (226)
T ss_pred             ccC------------------ChhHHHHHHHhcCHH
Confidence            442                  577899999999975


No 16 
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=99.23  E-value=7.9e-11  Score=104.45  Aligned_cols=67  Identities=30%  Similarity=0.467  Sum_probs=54.9

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      .|..++..|+..+..  .+.+++|+|+++||||+.+                         .++.+||||+|.+|+++||
T Consensus       206 ~L~~~~~~L~~~~~~--~~~~l~HgDl~~gni~~~~-------------------------~~~~viD~E~a~~G~~~~D  258 (401)
T PRK09550        206 ELKLEVAKLKHKFLT--KAEALLHGDLHTGSIFVTE-------------------------EETKVIDPEFAFYGPIGFD  258 (401)
T ss_pred             HHHHHHHHHHHHHhc--CCCceeeccCCcccEEeeC-------------------------CCcEEEeccccccCChHHH
Confidence            345566666666553  3568999999999999976                         4689999999999999999


Q ss_pred             HHHHHHHHhhhccC
Q psy15664         88 IANHFVESVYDYSY  101 (174)
Q Consensus        88 lan~f~E~~~dy~~  101 (174)
                      ||+++.++...|..
T Consensus       259 lg~~lanl~~~~~~  272 (401)
T PRK09550        259 IGTFIANLLLNYCS  272 (401)
T ss_pred             HHHHHHHHHHHHhc
Confidence            99999998876644


No 17 
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=99.22  E-value=2.1e-11  Score=96.26  Aligned_cols=49  Identities=20%  Similarity=0.297  Sum_probs=42.6

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHH
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   95 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~   95 (174)
                      .+.++||+|++++|||+.++                      ..+.+.|||||++++++|++|||.++.+|
T Consensus       172 ~~~~l~HgD~~~~Nil~~~~----------------------~~~~~~iID~e~~~~g~~~~Dla~~~~~~  220 (223)
T cd05154         172 SRPGLVHGDYRLGNVLFHPD----------------------EPRVVAVLDWELATLGDPLADLGWLLMYW  220 (223)
T ss_pred             CCcEEEECCCCcccEEEcCC----------------------CCcEEEEEeccccccCChHHHHHHHHHhc
Confidence            57899999999999999762                      02457899999999999999999999875


No 18 
>PRK05231 homoserine kinase; Provisional
Probab=99.17  E-value=3.3e-10  Score=95.85  Aligned_cols=95  Identities=16%  Similarity=0.196  Sum_probs=65.7

Q ss_pred             HHHHHHHHHHHhh---cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchh
Q psy15664         10 NTEADWLKKHLLK---IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAF   86 (174)
Q Consensus        10 ~~e~~~l~~~l~~---~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~f   86 (174)
                      ..++..+.+.+..   ...|.++||+|++++|||+.+                        ++-..||||++|+++++.|
T Consensus       167 ~~~~~~~~~~~~~~~~~~lp~~liHgD~~~~Nil~~~------------------------~~~~~iIDf~~~~~~~~~~  222 (319)
T PRK05231        167 EAELAAQLAFLASAAWPALPRGVIHADLFRDNVLFEG------------------------DRLSGFIDFYFACNDKLLY  222 (319)
T ss_pred             HHHHHHHHHhhhccccccCCcccCCCCCCCCcEEEEC------------------------CceEEEEecccccCCchHH
Confidence            3444444444432   125778999999999999975                        2334799999999999999


Q ss_pred             hHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHH
Q psy15664         87 DIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPES  140 (174)
Q Consensus        87 Dlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~  140 (174)
                      |||..+.-|+++..           ..+ +.+....|+++|-+..+-.+.+.+.
T Consensus       223 DlA~~~~~~~~~~~-----------~~~-~~~~~~~~l~gY~~~~~Ls~~E~~~  264 (319)
T PRK05231        223 DVAITLNDWCFEAD-----------GSL-DATKARALLAAYQSVRPLTAAERAA  264 (319)
T ss_pred             HHHHHHHHHHccCC-----------CCc-CHHHHHHHHHHHhhcCCCCHHHHHH
Confidence            99999988875421           112 4567889999997664432234433


No 19 
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=99.17  E-value=1.4e-10  Score=97.26  Aligned_cols=99  Identities=24%  Similarity=0.357  Sum_probs=73.3

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      ..+.++||+|++++|||+.+                         +.+.|||||.++++++.+|||.++..++-      
T Consensus       184 ~~~~~liHgD~~~~Nil~~~-------------------------~~i~lIDfd~~~~~~~~~Dla~~l~~~~~------  232 (313)
T TIGR02906       184 KKIRGFCHQDYAYHNILLKD-------------------------NEVYVIDFDYCTIDLPVRDLRKLIIKLMK------  232 (313)
T ss_pred             cCcCceEcCCCCcccEEEeC-------------------------CcEEEEECcccccCCcHHHHHHHHHHHHH------
Confidence            45679999999999999975                         46899999999999999999999876650      


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHc
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHD  164 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~  164 (174)
                            ....+ +.+....|++.|.+..+-.+.    -++-+..+....+-+|.++--...
T Consensus       233 ------~~~~~-d~~~~~~~l~gY~~~~~L~~~----e~~~l~~~l~~p~~~~~~~~~y~~  282 (313)
T TIGR02906       233 ------KNGVW-DLEKAKEIIEAYSSINPLSKE----EKEVLYIDLAFPHKFWKIGKQYYY  282 (313)
T ss_pred             ------hccCC-CHHHHHHHHHHhhccCCCCHH----HHHHHHHHHhChHHHHHHHHHHHh
Confidence                  00112 456778999999986543222    233456677888888887765543


No 20 
>PF01636 APH:  Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.;  InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=99.17  E-value=6.8e-11  Score=93.31  Aligned_cols=66  Identities=29%  Similarity=0.447  Sum_probs=47.3

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      ..+.++||+|++++|||+.+                       .++++.|||||.++++++++|+|..+.-+..+.    
T Consensus       163 ~~~~~~~HgD~~~~Nil~~~-----------------------~~~~i~iID~e~a~~~~~~~Dla~~~~~~~~~~----  215 (239)
T PF01636_consen  163 PLPPVLIHGDLHPGNILVDP-----------------------SDGRIGIIDFEDAGWGDPAYDLARLLRHFGEDQ----  215 (239)
T ss_dssp             CSCEEEE-SS-SGGGEEEES-----------------------STTEEEE--GTT-EEEETHHHHHHHHHHHTTHC----
T ss_pred             CCCcEEEEeccccccceeee-----------------------ccceeEEEecccceECCHHHHHHHHHHHhcccC----
Confidence            57899999999999999993                       235668999999999999999999994433111    


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHH
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYL  128 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl  128 (174)
                                  ..+.+..|+++|.
T Consensus       216 ------------~~~~~~~~~~~~~  228 (239)
T PF01636_consen  216 ------------DPEFRRAYLEAYG  228 (239)
T ss_dssp             ------------HHHHHHHHHHHHT
T ss_pred             ------------CHHHHHHHHHHhc
Confidence                        3566777777777


No 21 
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=99.17  E-value=9.4e-11  Score=95.53  Aligned_cols=84  Identities=18%  Similarity=0.126  Sum_probs=60.7

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      ..+.||||+|++++|||+.+                        ++.+.|||||+|+++++++|||..+.....      
T Consensus       160 ~~~~~l~HgD~~~~Nil~~~------------------------~~~~~iIDwe~a~~gdp~~Dla~~~~~~~~------  209 (244)
T cd05150         160 EEDLVVTHGDACLPNIIVDP------------------------GKFSGFIDLGRLGVADRYQDLALAVRSLRE------  209 (244)
T ss_pred             cCceEEECCCCCCccEEEeC------------------------CcEEEEEEccccccccHHHHHHHHHHHhhh------
Confidence            35689999999999999986                        244679999999999999999998754321      


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHH
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHF  154 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~  154 (174)
                               ...+.+.+..|++.|-+..    ..    .+++..|++...+
T Consensus       210 ---------~~~~~~~~~~f~~~Y~~~~----~~----~~~~~~~~~~~~~  243 (244)
T cd05150         210 ---------NLGGEEYAARFLDRYGIDA----PD----PEKLAYYRLLDEF  243 (244)
T ss_pred             ---------hcCChHHHHHHHHHcCCCC----CC----HHHHHHHHHHhhh
Confidence                     1115677899999995431    11    2355666665543


No 22 
>PRK12396 5-methylribose kinase; Reviewed
Probab=99.12  E-value=4.3e-10  Score=99.73  Aligned_cols=67  Identities=24%  Similarity=0.418  Sum_probs=57.6

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      .|..|+..|+..+..  ...+++|+||++||||+++                         +++++||.|+|-|||++||
T Consensus       210 ~Lk~ev~~Lk~~F~~--~~~aLlHGDlHtGSI~v~~-------------------------~~~kvIDpEFAfyGP~gFD  262 (409)
T PRK12396        210 ELRLEVAKLKFSFMT--NAQALIHGDLHTGSVFVKN-------------------------DSTKVIDPEFAFYGPMGYD  262 (409)
T ss_pred             HHHHHHHHHHHHHHh--cchhhccCcCCCCCEEecC-------------------------CceEEEcccccccCCcHHH
Confidence            567788888877765  3479999999999999986                         5799999999999999999


Q ss_pred             HHHHHHHHhhhccC
Q psy15664         88 IANHFVESVYDYSY  101 (174)
Q Consensus        88 lan~f~E~~~dy~~  101 (174)
                      ||+++....+.|..
T Consensus       263 iG~~lanll~ay~~  276 (409)
T PRK12396        263 IGNVMANLMFAWVN  276 (409)
T ss_pred             HHHHHHHHHHHHhc
Confidence            99999988877744


No 23 
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
Probab=99.12  E-value=4e-10  Score=90.23  Aligned_cols=73  Identities=19%  Similarity=0.301  Sum_probs=53.0

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF  104 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~  104 (174)
                      .+.|+||+|++++|||+..+..+                   ....+.+|||+++++++|++||+.++.-++-       
T Consensus       118 ~~~vl~HgD~~~~N~~~~~~~~~-------------------~~~~~~liDfq~~~~g~p~~Dl~~~l~~~~~-------  171 (196)
T smart00587      118 EFNVLNHGDLWANNIMFKYDDEG-------------------KPEDVALIDFQLSHYGSPAEDLHYFLLTSLS-------  171 (196)
T ss_pred             CceEEeeCCCCccceeeccCCCC-------------------CccceEEEecccCCcCChHHHHHHHHHhCCC-------
Confidence            36799999999999999852211                   1247999999999999999999999975330       


Q ss_pred             CcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664        105 PHYTVKRENYPSYSLRKSFVETYLSRM  131 (174)
Q Consensus       105 p~~~~~~~~~p~~~~~~~fl~~Yl~~~  131 (174)
                      +       . -..+....+++.|.+++
T Consensus       172 ~-------~-~r~~~~~~ll~~Y~~~l  190 (196)
T smart00587      172 V-------E-IRREHFDELLKFYYETL  190 (196)
T ss_pred             H-------H-HHHHHHHHHHHHHHHHH
Confidence            0       0 02344567777777654


No 24 
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=99.09  E-value=1.2e-09  Score=92.46  Aligned_cols=74  Identities=23%  Similarity=0.352  Sum_probs=57.2

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      ..|.++||+|++++|||+.+                        ++...|||||+++++++.+|||..+..|+.+-    
T Consensus       184 ~~~~~l~HgD~~~~Nvl~~~------------------------~~~~~vIDfd~~~~~~~~~DLA~~~~~~~~~~----  235 (307)
T TIGR00938       184 DLPRGVIHADLFPDNVLFDG------------------------DSVKGVIDFYFACTDARAYDLAITVNAWCFDA----  235 (307)
T ss_pred             cCCCccCCCCCCcCcEEEEC------------------------CceEEEeecccccCcchHHHHHHHHHHHHcCC----
Confidence            35789999999999999976                        23357999999999999999999876666321    


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhccCC
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQ  133 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~  133 (174)
                             ...+ +.+..+.|++.|-+..+-
T Consensus       236 -------~~~~-~~~~~~~~l~gY~~~~~L  257 (307)
T TIGR00938       236 -------DDHF-DADHAKALIKGYHQSRPL  257 (307)
T ss_pred             -------CCCC-CHHHHHHHHHHHHhcCCC
Confidence                   0112 467789999999876543


No 25 
>TIGR01767 MTRK 5-methylthioribose kinase. This enzyme is involved in the methionine salvage pathway in certain bacteria.
Probab=99.09  E-value=7.4e-10  Score=97.16  Aligned_cols=67  Identities=33%  Similarity=0.420  Sum_probs=53.6

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      .|..++..|+..+..  ...++||+||++||||+.+                         .++.+||||+|.+|+++||
T Consensus       175 ~l~~~v~~Lk~~f~~--~~~~llHGDl~~gNi~~~~-------------------------~~~~~iD~e~~~~G~~~~D  227 (370)
T TIGR01767       175 SLKIEAAKLKHSFLA--SAETLLHGDLHSGSIFVSE-------------------------HETKVIDPEFAFYGPIGFD  227 (370)
T ss_pred             HHHHHHHHHHHhhcc--CcceeeeccCCcccEEEcC-------------------------CCCEEEcCcccccCchHhh
Confidence            445556666555543  4468999999999999975                         4688999999999999999


Q ss_pred             HHHHHHHHhhhccC
Q psy15664         88 IANHFVESVYDYSY  101 (174)
Q Consensus        88 lan~f~E~~~dy~~  101 (174)
                      ||+.+.+....|..
T Consensus       228 lg~~ianL~l~~~~  241 (370)
T TIGR01767       228 IGQFIANLFLNALS  241 (370)
T ss_pred             HHHHHHHHHHHHhC
Confidence            99999998876643


No 26 
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=99.08  E-value=7.7e-10  Score=93.87  Aligned_cols=101  Identities=17%  Similarity=0.132  Sum_probs=75.2

Q ss_pred             cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664         23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK  102 (174)
Q Consensus        23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~  102 (174)
                      ...+.++||+|+.++|+|+++                        ++.+.+||||+++++++.+|||+++.-.+-.    
T Consensus       192 ~~~~~~lcHgD~~~~Nvl~~~------------------------~~~~~iIDfd~~~~d~~~~DLa~~~~~~~~~----  243 (309)
T TIGR02904       192 ESWRTVLVHGKLSLSHFLYDE------------------------TRGGYFINFEKASFASPLTDLAAFFRRSFGT----  243 (309)
T ss_pred             hhcceeeeCCCCcHHhEEEcC------------------------CCCEEEEEhhhcccCCcHHHHHHHHHHHHhh----
Confidence            446889999999999999975                        3568999999999999999999877654311    


Q ss_pred             CCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcc
Q psy15664        103 HFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDD  165 (174)
Q Consensus       103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~  165 (174)
                               .. ++.++.+.|+++|-+..+-.+++.+    -+....+..+-+|-+|--+...
T Consensus       244 ---------~~-~~~~~~~~~l~~Y~~~~pL~~~E~~----~l~~~L~fP~~f~~~~~~yy~~  292 (309)
T TIGR02904       244 ---------YP-QPIDEMFEWFYTYEKTLPLTDEEIH----LLTSYLAYPGPFIRVIQNYTKQ  292 (309)
T ss_pred             ---------CC-CChHHHHHHHHHHHhcCCCCHHHHH----HHHHHHhCCHHHHHHHHHHHhc
Confidence                     11 3567789999999987644323332    3445677788888888766554


No 27 
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=99.02  E-value=7.6e-10  Score=90.18  Aligned_cols=59  Identities=29%  Similarity=0.379  Sum_probs=49.5

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCce-EEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDL-VVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      .+.++||+|++++|||+.+                         +++ .|||||+|+.+++++|||...+.  +      
T Consensus       162 ~~~~l~HGD~~~~Nvlv~~-------------------------~~i~giIDw~~a~~gDp~~Dla~~~~~--~------  208 (235)
T cd05155         162 GPPVWFHGDLAPGNLLVQD-------------------------GRLSAVIDFGCLGVGDPACDLAIAWTL--L------  208 (235)
T ss_pred             CCceEEeCCCCCCcEEEEC-------------------------CCEEEEEeCcccCcCChHHHHHHHHhc--C------
Confidence            5779999999999999975                         344 59999999999999999976542  1      


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHH
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYL  128 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl  128 (174)
                                  +...+..|++.|.
T Consensus       209 ------------~~~~~~~~~~~y~  221 (235)
T cd05155         209 ------------DEDSRAAFRAALG  221 (235)
T ss_pred             ------------CHHHHHHHHHHcC
Confidence                        4567899999998


No 28 
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported 
Probab=98.90  E-value=2e-08  Score=84.71  Aligned_cols=65  Identities=20%  Similarity=0.242  Sum_probs=52.1

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCc-eEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNID-LVVIDFEYCSYNYRAFDIANHFVESVYDYSYK  102 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~  102 (174)
                      ..+.++||+|++++|||+++                        +++ .-|||||.++.++|++|||-.+.-        
T Consensus       182 ~~~~~lvHGD~~~~Nilv~~------------------------~~~~~gviDWe~a~iGDPa~Dla~~~~~--------  229 (276)
T cd05152         182 PRHTVLVHGDLHPGHILIDE------------------------DARVTGLIDWTEAKVGDPARDFVLHYRI--------  229 (276)
T ss_pred             CCCCeeEeCCCCCCcEEEeC------------------------CCCEEEEECcHhcccCCHHHHHHHHHHh--------
Confidence            45679999999999999975                        134 469999999999999999965431        


Q ss_pred             CCCcccccCCCCCCHHHHHHHHHHHHhccC
Q psy15664        103 HFPHYTVKRENYPSYSLRKSFVETYLSRMN  132 (174)
Q Consensus       103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~  132 (174)
                                  -..+.+..|+++|-....
T Consensus       230 ------------~~~~~~~~~~~~Y~~~~g  247 (276)
T cd05152         230 ------------FGEAGLERLIDAYEAAGG  247 (276)
T ss_pred             ------------cChHHHHHHHHHHHHcCC
Confidence                        146678999999997653


No 29 
>PLN02756 S-methyl-5-thioribose kinase
Probab=98.84  E-value=2.7e-08  Score=88.71  Aligned_cols=65  Identities=26%  Similarity=0.351  Sum_probs=54.8

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      .|..++..|+..+....  .+++|+||++|||++.+                         ++..+||.|+|-|+|++||
T Consensus       213 ~L~~~v~~Lk~~f~~~~--~~L~HGDl~~g~i~~~~-------------------------~~~~~id~ef~~~g~~~~d  265 (418)
T PLN02756        213 ILKLEIAELKSMFCERA--QALVHGDLHTGSVMVTP-------------------------DSTQVIDPEFAFYGPMGFD  265 (418)
T ss_pred             HHHHHHHHHHHHHHhcc--cceeecCCCCCcEEEcC-------------------------CCceEecchhhccCchHHh
Confidence            57778888877776543  68999999999999986                         4689999999999999999


Q ss_pred             HHHHHHHHhhhc
Q psy15664         88 IANHFVESVYDY   99 (174)
Q Consensus        88 lan~f~E~~~dy   99 (174)
                      ||..+......|
T Consensus       266 ~g~~~~~~~~~~  277 (418)
T PLN02756        266 IGAFLGNLILAY  277 (418)
T ss_pred             HHHHHhhhHHHH
Confidence            999887766544


No 30 
>PRK11768 serine/threonine protein kinase; Provisional
Probab=98.81  E-value=4e-08  Score=84.41  Aligned_cols=90  Identities=16%  Similarity=0.215  Sum_probs=61.2

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      ..+.++||+|++++|||+.+                          .+.||||+.|+++++.+|||..+.-.        
T Consensus       193 ~~~~~liHgD~h~~NvL~~d--------------------------~~~iIDFDd~~~g~~i~DLa~~l~~~--------  238 (325)
T PRK11768        193 DVRLLRLHGDCHPGNILWRD--------------------------GPHFVDLDDARMGPAVQDLWMLLSGD--------  238 (325)
T ss_pred             CCCccceecCCCchhccccC--------------------------CcEEEeCCCCCCCCHHHHHHHHhccC--------
Confidence            45779999999999999942                          46899999999999999999866320        


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHH
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWA  157 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~  157 (174)
                              ... ..++...|++.|-+...-...+ -.++.-......+...-|.
T Consensus       239 --------~~~-~~~~~~~~l~GY~~~r~l~~~e-~~~l~~l~~lR~~~~~~W~  282 (325)
T PRK11768        239 --------RAE-QLMQLETLLEGYEEFCEFDPRE-LALIEPLRALRLIHYSAWL  282 (325)
T ss_pred             --------cch-hHHHHHHHHHHhhccCCCCHHH-HHHHHHHHHHHHHHHHHHH
Confidence                    111 2567789999997654321111 2344445555555555553


No 31 
>PF02958 EcKinase:  Ecdysteroid kinase;  InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans.
Probab=98.81  E-value=2e-08  Score=84.03  Aligned_cols=74  Identities=26%  Similarity=0.494  Sum_probs=54.7

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~  103 (174)
                      ..+.|+||+|++.+|||+.....+                   ....+++|||..+.+++++.||+.++.-+.-      
T Consensus       212 ~~~~vl~HGD~w~nNilf~~~~~g-------------------~~~~~~liDfQ~~~~g~p~~Dl~~fl~~s~~------  266 (294)
T PF02958_consen  212 EPFNVLCHGDFWTNNILFKYDDDG-------------------KPIDVVLIDFQLARYGSPAIDLAYFLYTSLD------  266 (294)
T ss_pred             CCceEEEcCccCHHhEeEcccccc-------------------ccccceeeccccccCCCcHhHHHHHHHHCCC------
Confidence            457799999999999999873221                   2357999999999999999999999975430      


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRM  131 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~  131 (174)
                       +.       . ..+....+|+.|..++
T Consensus       267 -~~-------~-r~~~~~~ll~~Y~~~L  285 (294)
T PF02958_consen  267 -PE-------L-RREHEDELLRHYHESL  285 (294)
T ss_pred             -HH-------H-HHHHHHHHHHHHHHHH
Confidence             00       0 2344567788887664


No 32 
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=98.76  E-value=1.8e-07  Score=81.21  Aligned_cols=97  Identities=19%  Similarity=0.233  Sum_probs=69.6

Q ss_pred             eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCC-ceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCcc
Q psy15664         29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNI-DLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHY  107 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~~  107 (174)
                      +||||++++||+++.                        ++ -..+|||+.|++++..||||..++-|..|         
T Consensus       199 iIH~D~~~~NVl~d~------------------------~~~~~g~iDFdDa~~~~~i~DlAi~l~~~~~d---------  245 (331)
T COG2334         199 IIHGDLHPDNVLFDD------------------------DTDVSGFIDFDDAGYGWFIYDLAIALNAWNGD---------  245 (331)
T ss_pred             eeecCCCccceeEcC------------------------CCCeeeEEEccccccchHHHHHHHHHHHhhcC---------
Confidence            999999999999987                        23 37899999999999999999999876211         


Q ss_pred             cccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHcccC
Q psy15664        108 TVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFVHDDTS  167 (174)
Q Consensus       108 ~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWaliq~~~s  167 (174)
                          ... ...+...|+++|-+...-..++.    ..+..+..+..+.-..|.++.....
T Consensus       246 ----~~~-~~~~~~a~l~GY~~v~pl~~~El----~~Lp~l~r~~a~~~~~~~~~~~~~~  296 (331)
T COG2334         246 ----EAD-PRAAIAAFLEGYEEVRPLTAAEL----ELLPDLRRLRALRLWAWRLIRWLLP  296 (331)
T ss_pred             ----CCC-cHHHHHHHHHHHHhcCCCCHHHH----HHHHHHHHHHHHHHHHHHhhhhhcC
Confidence                111 46778999999998754322223    3344455555566666777666554


No 33 
>PLN02876 acyl-CoA dehydrogenase
Probab=98.72  E-value=5e-08  Score=93.29  Aligned_cols=103  Identities=17%  Similarity=0.259  Sum_probs=67.4

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCc-eEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNID-LVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF  104 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~  104 (174)
                      +.++||+|++++|||+...                       +.+ +-|||||+++.++|.+|||..+.-|..++.....
T Consensus       224 ~~~LvHGD~~~~Nvl~~~~-----------------------~~~v~aVLDWE~a~~GdPl~DLa~~~~~~~~~~~~~~~  280 (822)
T PLN02876        224 GTGIVHGDFRIDNLVFHPT-----------------------EDRVIGILDWELSTLGNQMCDVAYSCLPYIVDINLDNQ  280 (822)
T ss_pred             CcceEecCcccccEEEcCC-----------------------CCeEEEEEeeeccccCChHHHHHHHhhhccccccCCcc
Confidence            4689999999999999851                       233 5799999999999999999888766544311111


Q ss_pred             ---Cccccc--CCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHH
Q psy15664        105 ---PHYTVK--RENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALW  159 (174)
Q Consensus       105 ---p~~~~~--~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lW  159 (174)
                         .++...  ...+|+   ++.++..|.+..... ..+    ..+..|..++.|-|++-
T Consensus       281 ~~~~~~~~~~~~~G~p~---~~e~~~~Y~~~~g~~-~~~----~~~~~~~~~~~~r~a~I  332 (822)
T PLN02876        281 QVGKGFEFTGIPEGIPS---LPEYLAEYCSASGKP-WPA----ANWKFYVAFSLFRGASI  332 (822)
T ss_pred             ccccccccCcCCCCCCC---HHHHHHHHHHHhCCC-CCC----cccHHHHHHHHHHHHHH
Confidence               122221  235666   678999999875421 001    13445666666666543


No 34 
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=98.61  E-value=1.6e-07  Score=68.33  Aligned_cols=45  Identities=40%  Similarity=0.718  Sum_probs=40.8

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHH
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   95 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~   95 (174)
                      .+++|+|++++|||+.+                        .+.+.+|||+.+.+.++++|+|..++-|
T Consensus       108 ~~i~H~Dl~~~Nil~~~------------------------~~~~~l~Df~~~~~~~~~~d~~~~~~~~  152 (155)
T cd05120         108 LVLCHGDLHPGNILVDD------------------------GKILGIIDWEYAGYGPPAFDLAAALLFN  152 (155)
T ss_pred             eEEEecCCCcceEEEEC------------------------CcEEEEEecccccCCChHHHHHHHHHHh
Confidence            58999999999999975                        3679999999999999999999998754


No 35 
>COG4857 Predicted kinase [General function prediction only]
Probab=98.51  E-value=3.3e-07  Score=78.62  Aligned_cols=61  Identities=36%  Similarity=0.485  Sum_probs=51.8

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      +|.-|+..|+..+....  ..+||+||+.|.|++++                         ...++||-|+|-|+|.+||
T Consensus       211 dlkvea~kLk~~F~~~a--etLiHGDLHsGSIfvte-------------------------~etkvIDPEFaFYGPmafD  263 (408)
T COG4857         211 DLKVEAQKLKHKFMAYA--ETLIHGDLHSGSIFVTE-------------------------KETKVIDPEFAFYGPMAFD  263 (408)
T ss_pred             chhhhHHHHHHHHHHHh--HHHhccccccCcEEeec-------------------------CcceeeCccccccCcchhh
Confidence            56678888887776533  57999999999999987                         6789999999999999999


Q ss_pred             HHHHHHHH
Q psy15664         88 IANHFVES   95 (174)
Q Consensus        88 lan~f~E~   95 (174)
                      ||+.+...
T Consensus       264 iG~~iaNl  271 (408)
T COG4857         264 IGMLIANL  271 (408)
T ss_pred             HHHHHHHH
Confidence            99988763


No 36 
>PRK10593 hypothetical protein; Provisional
Probab=98.34  E-value=2.6e-06  Score=72.50  Aligned_cols=68  Identities=9%  Similarity=0.186  Sum_probs=49.5

Q ss_pred             hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccC
Q psy15664         22 KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY  101 (174)
Q Consensus        22 ~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~  101 (174)
                      ....+.++||+|+++||+|++..                      ......+||..-+.+++|-+|||..+.        
T Consensus       188 ~~~~~psLlHGDlw~gNvl~~~~----------------------~~~i~~liDPa~~~~g~rE~DLa~~~~--------  237 (297)
T PRK10593        188 GFNDNCVLVHGNFTLRSMLKDPR----------------------SDQLLAMLNPGLMLWAPREYELFRLMD--------  237 (297)
T ss_pred             cCCCCCeeEeCCCCcccEEECCC----------------------CCceEEEECchHhCCCCHHHhHHHhhc--------
Confidence            33445699999999999999751                      112278999988999999999986641        


Q ss_pred             CCCCcccccCCCCCCHHHHHHHHHHHHhccCCC
Q psy15664        102 KHFPHYTVKRENYPSYSLRKSFVETYLSRMNQE  134 (174)
Q Consensus       102 ~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~  134 (174)
                                ..+     ...|+++|.+..+..
T Consensus       238 ----------~~f-----~~~f~~~Y~~~~pl~  255 (297)
T PRK10593        238 ----------NGL-----AEQLLWRYLQKAPVA  255 (297)
T ss_pred             ----------CCc-----cHHHHHHHHHhCCCC
Confidence                      111     236888888877643


No 37 
>PRK06148 hypothetical protein; Provisional
Probab=98.27  E-value=9.5e-06  Score=79.53  Aligned_cols=102  Identities=17%  Similarity=0.136  Sum_probs=68.7

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceE-EEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLV-VIDFEYCSYNYRAFDIANHFVESVYDYSYK  102 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-lIDfEYa~~n~~~fDlan~f~E~~~dy~~~  102 (174)
                      .-|..+||||++..|||++++.                      .+++. ||||+.++++++.+|||--+.-++.+    
T Consensus       200 ~Lp~~vIHgDln~~NiLv~~~~----------------------~~~isGiIDFgDa~~~~~v~DLAialay~~~~----  253 (1013)
T PRK06148        200 ALPAQVIHNDANDYNILVDADD----------------------GERISGLIDFGDAVHAPRICEVAIAAAYAILD----  253 (1013)
T ss_pred             cCCcceECCCCCcccEEEcCCC----------------------CcceEEEEECcccccccHHHHHHHHHHHHhcC----
Confidence            3467899999999999998621                      12454 99999999999999999887544321    


Q ss_pred             CCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664        103 HFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSFV  162 (174)
Q Consensus       103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWali  162 (174)
                               . ....+....|++.|-+...-.+.+++.| --+...+++.-+.|+.|-.-
T Consensus       254 ---------~-~~p~~~~~a~laGY~sv~pLt~~E~~~L-~~li~~R~~~s~~~~~~~~~  302 (1013)
T PRK06148        254 ---------H-PDPIGAAAALVAGYHAVYPLQAQELDLL-FDLIRMRLAVSVTNSASRRE  302 (1013)
T ss_pred             ---------C-CChHHHHHHHHHHHhhcCCCCHHHHHHH-HHHHHHHHHHHHHHHHHhhh
Confidence                     0 0113456789999998765544455443 34455555555666555443


No 38 
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]
Probab=98.25  E-value=1.7e-06  Score=74.97  Aligned_cols=57  Identities=21%  Similarity=0.312  Sum_probs=46.9

Q ss_pred             HHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHH
Q psy15664         12 EADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANH   91 (174)
Q Consensus        12 e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~   91 (174)
                      -+.|++........+.|+.|+|+++||||+.+                        .+.+-|||||-++.++|..||+.+
T Consensus       183 ~~~Wl~~~~p~~~~~~~lvHGD~~~gNlii~~------------------------~~~~gVlDwe~~~lGDP~~Dl~~~  238 (321)
T COG3173         183 LIKWLEANRPPWAGPPVLVHGDYRPGNLIIDP------------------------GRPTGVLDWELATLGDPLEDLAII  238 (321)
T ss_pred             HHHHHHhcCCCcCCCceeeeCCcccCCEEEeC------------------------CCeeEEEeccccccCCcHHHHHHH
Confidence            34455444444567899999999999999997                        344999999999999999999999


Q ss_pred             H
Q psy15664         92 F   92 (174)
Q Consensus        92 f   92 (174)
                      +
T Consensus       239 ~  239 (321)
T COG3173         239 C  239 (321)
T ss_pred             H
Confidence            7


No 39 
>PRK14879 serine/threonine protein kinase; Provisional
Probab=98.08  E-value=2.8e-05  Score=61.36  Aligned_cols=70  Identities=21%  Similarity=0.284  Sum_probs=49.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCcc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHY  107 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~~  107 (174)
                      .++|+|++++|||+..                         +.+.+|||+.+....+..|.+.-+......+. ...|. 
T Consensus       115 ~i~H~Dl~p~Nil~~~-------------------------~~~~liDf~~a~~~~~~~~~~~~~~~~~~~~~-~~~~~-  167 (211)
T PRK14879        115 GIIHGDLTTSNMILSG-------------------------GKIYLIDFGLAEFSKDLEDRAVDLHVLLRSLE-STHPD-  167 (211)
T ss_pred             CcccCCCCcccEEEEC-------------------------CCEEEEECCcccCCCcHHhhhccHHHHHHHhh-ccCcc-
Confidence            5899999999999973                         57899999999999998888764433221110 00111 


Q ss_pred             cccCCCCCCHHHHHHHHHHHHhcc
Q psy15664        108 TVKRENYPSYSLRKSFVETYLSRM  131 (174)
Q Consensus       108 ~~~~~~~p~~~~~~~fl~~Yl~~~  131 (174)
                             ...+....|+..|....
T Consensus       168 -------~~~~~~~~f~~gY~~~~  184 (211)
T PRK14879        168 -------WAEELFEAFLEGYREVM  184 (211)
T ss_pred             -------hHHHHHHHHHHHHHHhh
Confidence                   12466788999999765


No 40 
>PF07914 DUF1679:  Protein of unknown function (DUF1679);  InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in zinc finger-C4 and HLH domain-containing kinases. In fact, one member of this family (Q9GUC1 from SWISSPROT) is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (IPR000536 from INTERPRO, IPR008946 from INTERPRO, and IPR001628 from INTERPRO). 
Probab=98.08  E-value=2.8e-06  Score=75.79  Aligned_cols=55  Identities=22%  Similarity=0.298  Sum_probs=44.6

Q ss_pred             cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHh
Q psy15664         23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   96 (174)
Q Consensus        23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~   96 (174)
                      .+.+.|+||+||+..|||...+..+                   ...--.||||.-+..+.++.||+-.|+-++
T Consensus       264 lG~~~VL~HGDLw~~NiLw~k~~~g-------------------~~~l~AIIDwQ~vh~G~~~eDl~Rll~~~l  318 (414)
T PF07914_consen  264 LGIKPVLVHGDLWSSNILWDKDSDG-------------------KLKLKAIIDWQCVHRGSPAEDLARLLVSCL  318 (414)
T ss_pred             cCCCcceecCCccHHheeeecCCch-------------------hHHHHHHHHHHHhhcCchHHHHHHHHHhcC
Confidence            4568899999999999999873221                   112367999999999999999999998655


No 41 
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=98.05  E-value=3.1e-05  Score=60.69  Aligned_cols=70  Identities=24%  Similarity=0.300  Sum_probs=49.1

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPH  106 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~  106 (174)
                      ..++|+|++++|||+.+                         +++.+|||+.+....+..|.+.-+........      
T Consensus       109 ~gi~H~Dl~~~Nil~~~-------------------------~~~~liDfg~a~~~~~~~~~~~~~~~~~~~~~------  157 (199)
T TIGR03724       109 AGIVHGDLTTSNIIVRD-------------------------DKLYLIDFGLGKYSDEIEDKAVDLHVLKRSLE------  157 (199)
T ss_pred             CCeecCCCCcceEEEEC-------------------------CcEEEEECCCCcCCCcHHhhhchHHHHHHHHh------
Confidence            35899999999999973                         57999999999999998888764433221110      


Q ss_pred             ccccCCCC-CCHHHHHHHHHHHHhcc
Q psy15664        107 YTVKRENY-PSYSLRKSFVETYLSRM  131 (174)
Q Consensus       107 ~~~~~~~~-p~~~~~~~fl~~Yl~~~  131 (174)
                          ...+ ...+....|+..|.+..
T Consensus       158 ----~~~~~~~~~~~~~fl~~Y~~~~  179 (199)
T TIGR03724       158 ----STHPDKAEELFEAFLEGYREEF  179 (199)
T ss_pred             ----hhCchhHHHHHHHHHHHHHhhc
Confidence                0111 13456778999998753


No 42 
>PRK06149 hypothetical protein; Provisional
Probab=98.05  E-value=5.2e-05  Score=74.09  Aligned_cols=102  Identities=14%  Similarity=0.041  Sum_probs=64.9

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF  104 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~  104 (174)
                      .|..+||||++..|||+..+..+                   ...-.-||||..++++++.+|||-.+.-|+.+-     
T Consensus       206 L~~g~IH~Dl~~~Nilv~~~~~~-------------------~~~v~giIDFgD~~~~~~i~DLAial~~~~~~~-----  261 (972)
T PRK06149        206 LPLQAVHLDITDDNVVGSRDADG-------------------RWQPDGVIDFGDLVRTWRVADLAVTCASLLHHA-----  261 (972)
T ss_pred             CcccccCCCCCcccEEEcCCCCC-------------------CcceeEEEEcccchhhhHHHHHHHHHHHHhccc-----
Confidence            47789999999999999862110                   002257999999999999999998887665311     


Q ss_pred             CcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664        105 PHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWS  160 (174)
Q Consensus       105 p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWa  160 (174)
                             .  +.......|++.|-+...-.+.+++.|. -+...+.+.-+.|+.|-
T Consensus       262 -------~--~dp~~~~~~l~GY~svrpLt~~E~~~L~-~li~~R~~~~~~~~~~~  307 (972)
T PRK06149        262 -------G--GDPFSILPAVRAYHAVRPLSEAELKALW-PLVVARAAVLVASSEQQ  307 (972)
T ss_pred             -------C--CCHHHHHHHHHHHHhcCCCCHHHHHHHH-HHHHHHHHHHHHHHHHH
Confidence                   0  1223457899999877654334444332 23333444444444443


No 43 
>PF06293 Kdo:  Lipopolysaccharide kinase (Kdo/WaaP) family;  InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=98.02  E-value=1.9e-05  Score=63.52  Aligned_cols=65  Identities=26%  Similarity=0.360  Sum_probs=47.7

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc-----chhhHHHHHHHHhhhccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY-----RAFDIANHFVESVYDYSY  101 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----~~fDlan~f~E~~~dy~~  101 (174)
                      ..++|+||+++|||+....                     ++.++.|||||-+....     +.-||+-......     
T Consensus       137 ~gi~H~Dl~~~NILv~~~~---------------------~~~~~~lIDld~~~~~~~~~~~~~~dL~~L~rs~~-----  190 (206)
T PF06293_consen  137 AGIYHGDLNPSNILVDPDD---------------------GQYRFYLIDLDRMRFRPSSRRWRAKDLARLLRSLL-----  190 (206)
T ss_pred             CcCCCCCCCcccEEEeCCC---------------------CceeEEEEcchhceeCCCChHHHHHhHHHHHHhcc-----
Confidence            4699999999999998732                     23579999999988877     4556665543211     


Q ss_pred             CCCCcccccCCCCCCHHHHHHHHHHH
Q psy15664        102 KHFPHYTVKRENYPSYSLRKSFVETY  127 (174)
Q Consensus       102 ~~~p~~~~~~~~~p~~~~~~~fl~~Y  127 (174)
                               ... -++++++.|+++|
T Consensus       191 ---------~~~-~~~~d~~~fl~~Y  206 (206)
T PF06293_consen  191 ---------RSG-WSERDRQRFLRGY  206 (206)
T ss_pred             ---------ccC-CCHHHHHHHHhhC
Confidence                     112 2788999999988


No 44 
>COG3178 Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only]
Probab=97.88  E-value=6.9e-05  Score=64.63  Aligned_cols=73  Identities=16%  Similarity=0.269  Sum_probs=58.7

Q ss_pred             cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664         23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK  102 (174)
Q Consensus        23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~  102 (174)
                      ...|.|+||+|.++-|||....-.                    +..++-+|||.-|.++|.+||+++.+....      
T Consensus       196 ~~~~~vlvhRDfh~~NLmw~~~~~--------------------g~~rvGvlDFQDA~iGP~aYDvasL~~DAr------  249 (351)
T COG3178         196 LAQPKVLVHRDFHSRNLMWTADRA--------------------GADRVGVLDFQDALIGPIAYDVASLLRDAR------  249 (351)
T ss_pred             hcCCceeeeccccCccceecCCcc--------------------CCCCCceeehhhhhcCcchhhHHHHHhhcc------
Confidence            357899999999999999987311                    246899999999999999999999986422      


Q ss_pred             CCCcccccCCCCCCHHHHHHHHHHHHhcc
Q psy15664        103 HFPHYTVKRENYPSYSLRKSFVETYLSRM  131 (174)
Q Consensus       103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~  131 (174)
                                ..-++|....++..|+.+.
T Consensus       250 ----------vt~~pe~~~~~l~rY~~~r  268 (351)
T COG3178         250 ----------VTWSPERELALLDRYWAAR  268 (351)
T ss_pred             ----------ccCCHHHHHHHHHHHHHhh
Confidence                      1125778889999999764


No 45 
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=97.65  E-value=0.00078  Score=56.86  Aligned_cols=72  Identities=18%  Similarity=0.258  Sum_probs=49.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC------ccchhhHHHHHHHHhhhcc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY------NYRAFDIANHFVESVYDYS  100 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~------n~~~fDlan~f~E~~~dy~  100 (174)
                      ..++|+||.++|||+...+..+                 .++..+.|||||-+..      ..+.-||+-.....+    
T Consensus       157 ~Gi~HgDL~~~NiLl~~~~~~~-----------------~~~~~~~LIDl~r~~~~~~~~~~~r~~dL~~L~~s~~----  215 (268)
T PRK15123        157 AGINHRDCYICHFLLHLPFPGR-----------------EEDLKLSVIDLHRAQIRARVPRRWRDKDLAGLYFSAM----  215 (268)
T ss_pred             CcCccCCCChhhEEEeccccCC-----------------CCCceEEEEECCcccccCCCChHHHHHHHHHHHHHhc----
Confidence            3599999999999997521110                 0246799999998832      245578887754321    


Q ss_pred             CCCCCcccccCCCCCCHHHHHHHHHHHHhc
Q psy15664        101 YKHFPHYTVKRENYPSYSLRKSFVETYLSR  130 (174)
Q Consensus       101 ~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~  130 (174)
                                 +..-+..++..|+++|.+.
T Consensus       216 -----------~~~ls~~d~~~fl~~Y~~~  234 (268)
T PRK15123        216 -----------DIGLTQRDILRFLRVYFGR  234 (268)
T ss_pred             -----------ccCCCHHHHHHHHHHHhCC
Confidence                       1112788999999999985


No 46 
>PF04655 APH_6_hur:  Aminoglycoside/hydroxyurea antibiotic resistance kinase;  InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties []. Aminoglycoside phosphotransferases achieve inactivation of these enzymes by phosphorylation, utilising ATP. Likewise, hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0006468 protein phosphorylation, 0019748 secondary metabolic process
Probab=97.63  E-value=0.00039  Score=58.36  Aligned_cols=110  Identities=20%  Similarity=0.248  Sum_probs=68.6

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      .|..+...+.+.+.....+.|+.|+|||.+|||-..                        ...-+.||-. .-.++|+||
T Consensus       141 ~l~~~a~~~~~~Ll~~~~~~~lLHGDLH~~NIL~~~------------------------~~~WlaIDPk-gl~Gdp~yd  195 (253)
T PF04655_consen  141 RLVDAAAALARELLASPGEEVLLHGDLHHGNILAAG------------------------RRGWLAIDPK-GLVGDPAYD  195 (253)
T ss_pred             HHHHHHHHHHHHHhcCCCcceeeccccchHhhhccC------------------------CCCceEeCCc-ccccccccC
Confidence            344444445445545566778999999999999764                        2568899987 445899999


Q ss_pred             HHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15664         88 IANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFFWALWSF  161 (174)
Q Consensus        88 lan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~W~lWal  161 (174)
                      ++++|+...-+.     +      .. ...+...+.+..-.....-   +.+    ++..|..+--..-++|++
T Consensus       196 ~a~~l~n~~~~~-----~------~~-~~~~~i~~r~~~la~~~gl---d~~----R~~~W~~~~~vlsa~W~~  250 (253)
T PF04655_consen  196 LAPLLRNPLDEL-----P------DA-DDPERIRRRAALLAEAAGL---DRE----RILAWAFARAVLSAAWAL  250 (253)
T ss_pred             HHHHHhCccccc-----c------cc-ccHHHHHHHHHHHHHHHCc---CHH----HHHHHHHHHHHHHHHHHh
Confidence            999998533110     0      00 1223344445555555432   223    556677766666677764


No 47 
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=97.58  E-value=0.00048  Score=55.89  Aligned_cols=97  Identities=26%  Similarity=0.323  Sum_probs=61.6

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      ++-.++..+-..+.+.    .+||+||-+.||++..                         +++.||||=.+-.+.-.=|
T Consensus        96 ~~~r~vG~~vg~lH~~----givHGDLTtsNiIl~~-------------------------~~i~~IDfGLg~~s~~~Ed  146 (204)
T COG3642          96 DLLREVGRLVGKLHKA----GIVHGDLTTSNIILSG-------------------------GRIYFIDFGLGEFSDEVED  146 (204)
T ss_pred             HHHHHHHHHHHHHHhc----CeecCCCccceEEEeC-------------------------CcEEEEECCcccccccHHh
Confidence            3445555555555443    5999999999999986                         5699999988887765444


Q ss_pred             HHH--HHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHH
Q psy15664         88 IAN--HFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVK  146 (174)
Q Consensus        88 lan--~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~  146 (174)
                      .|-  |.-|-....            .....++....|++.|.+..... .+|.+.+++|+
T Consensus       147 ~aVDl~Vleral~s------------th~~~e~l~~~f~~gY~~~~~~~-~~Vl~~~~eIr  194 (204)
T COG3642         147 KAVDLHVLERALES------------THEKAEELFAAFLEGYREEFGEA-KEVLERLEEIR  194 (204)
T ss_pred             hhchHHHHHHHHHh------------ccccHHHHHHHHHHHHHHHhccH-HHHHHHHHHHH
Confidence            443  222322222            22224566789999999887642 24444455544


No 48 
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=97.55  E-value=0.00035  Score=63.83  Aligned_cols=69  Identities=25%  Similarity=0.304  Sum_probs=50.1

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPH  106 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~  106 (174)
                      ..++|+|++|.|||+.+                         +.++||||+.|...+...|+|..+........      
T Consensus       447 ~giiHrDlkp~NILl~~-------------------------~~~~liDFGla~~~~~~~d~a~~l~~~~~~~~------  495 (535)
T PRK09605        447 AGIVHGDLTTSNFIVRD-------------------------DRLYLIDFGLGKYSDLIEDKAVDLHVLKQSLE------  495 (535)
T ss_pred             CCCccCCCChHHEEEEC-------------------------CcEEEEeCcccccCCchHhhhhhHHHHHHHhc------
Confidence            35899999999999943                         67999999999999999999886543321111      


Q ss_pred             ccccCCCCCCHHHHHHHHHHHHhc
Q psy15664        107 YTVKRENYPSYSLRKSFVETYLSR  130 (174)
Q Consensus       107 ~~~~~~~~p~~~~~~~fl~~Yl~~  130 (174)
                          ...+...+....|++.|-..
T Consensus       496 ----~~~~~~~~~~~~fl~gY~~~  515 (535)
T PRK09605        496 ----STHYDFEELWEAFLEGYRET  515 (535)
T ss_pred             ----CCCCCHHHHHHHHHHhhccC
Confidence                11112355678899999654


No 49 
>TIGR02905 spore_yutH spore coat protein YutH. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria.
Probab=97.47  E-value=0.00076  Score=57.71  Aligned_cols=68  Identities=22%  Similarity=0.271  Sum_probs=50.9

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF  104 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~  104 (174)
                      ...++||+|+...|+| .+                         +.+.+|+||++ +.++..||++++.-.+.-      
T Consensus       187 ~~~~lCH~d~~~hn~l-~~-------------------------~~~~~i~~d~~-~D~~~~DL~~firk~~~k------  233 (313)
T TIGR02905       187 DSGTICHERFGETTWL-ER-------------------------GGLIKPPTEWV-YDHPARDLAEWIRERYMG------  233 (313)
T ss_pred             ccCccccCccCccccc-cC-------------------------CCeEecccccc-cccchhHHHHHHHHHHHH------
Confidence            4569999999999987 32                         57889999954 999999999999874411      


Q ss_pred             CcccccCCCCC-CHHHHHHHHHHHHhccCC
Q psy15664        105 PHYTVKRENYP-SYSLRKSFVETYLSRMNQ  133 (174)
Q Consensus       105 p~~~~~~~~~p-~~~~~~~fl~~Yl~~~~~  133 (174)
                              .++ +-+.-..+|++|=+..+-
T Consensus       234 --------~~~~~~~~~~~~l~~Y~~~~pL  255 (313)
T TIGR02905       234 --------EIRQNQRAIASFLQEYEQAAPL  255 (313)
T ss_pred             --------hccccHHHHHHHHHHhhhcCCC
Confidence                    011 234678888888877544


No 50 
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=97.19  E-value=0.0024  Score=52.61  Aligned_cols=32  Identities=28%  Similarity=0.374  Sum_probs=27.1

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      .++|+|++|+|||+..                        ++.++||||+-+....
T Consensus       162 GI~HrDlkp~NILv~~------------------------~~~v~LIDfg~~~~~~  193 (239)
T PRK01723        162 GVYHADLNAHNILLDP------------------------DGKFWLIDFDRGELRT  193 (239)
T ss_pred             CCCCCCCCchhEEEcC------------------------CCCEEEEECCCcccCC
Confidence            5899999999999975                        3579999999887654


No 51 
>PF03881 Fructosamin_kin:  Fructosamine kinase;  InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []. Ketosamine-3-kinases (KT3K), of which fructosamine-3-kinase (FN3K) is the best-known example, catalyse the phosphorylation of the ketosamine moiety of glycated proteins. The instability of a phosphorylated ketosamine leads to its degradation, and KT3K is thus thought to be involved in protein repair []. The function of the prokaryotic members of this group has not been established. However, several lines of evidence indicate that they may function as fructosamine-3-kinases (FN3K). First, they are similar to characterised FN3K from mouse and human. Second, the Escherichia coli members are found in close proximity on the genome to fructose-6-phosphate kinase (PfkB). Last, FN3K activity has been found in a Anacystis montana (Gloeocapsa montana Kutzing 1843) [], indicating such activity-directly demonstrated in eukaryotes-is nonetheless not confined to eukaryotes. This family includes eukaryotic fructosamine-3-kinase enzymes [] which may initiate a process leading to the deglycation of fructoselysine and of glycated proteins and in the phosphorylation of 1-deoxy-1-morpholinofructose, fructoselysine, fructoseglycine, fructose and glycated lysozyme. The family also includes bacterial members that have not been characterised but probably have a similar or identical function. For additional information please see [].; PDB: 3JR1_B 3F7W_A.
Probab=97.12  E-value=0.00087  Score=57.19  Aligned_cols=65  Identities=23%  Similarity=0.474  Sum_probs=38.2

Q ss_pred             cCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCC
Q psy15664         23 IKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK  102 (174)
Q Consensus        23 ~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~  102 (174)
                      ...+-+++|+||++||++.+.                        +++.+|||== +-+++|-+|||..  + ++     
T Consensus       184 ~~~~PsLlHGDLW~GN~~~~~------------------------~g~p~l~DPa-~yygh~E~DLam~--~-lf-----  230 (288)
T PF03881_consen  184 REPKPSLLHGDLWSGNVGFDA------------------------DGEPVLFDPA-CYYGHREVDLAMT--R-LF-----  230 (288)
T ss_dssp             S----EEE-SS-SGGGEEEET------------------------TE-EEE-S----EEE-CHHHHHHH--C-CC-----
T ss_pred             CCCCceeeEcCccccceeecC------------------------CCCceeeccc-cccCchHhhhhhh--h-hh-----
Confidence            344569999999999999987                        3568999987 8899999999953  2 11     


Q ss_pred             CCCcccccCCCCCCHHHHHHHHHHHHhccCCC
Q psy15664        103 HFPHYTVKRENYPSYSLRKSFVETYLSRMNQE  134 (174)
Q Consensus       103 ~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~  134 (174)
                               ..+|     ..|.++|.+..+.+
T Consensus       231 ---------ggf~-----~~f~~~Y~~~~Pl~  248 (288)
T PF03881_consen  231 ---------GGFP-----DEFYDAYQEHYPLS  248 (288)
T ss_dssp             ---------STTH-----HHHHHHHHHHS---
T ss_pred             ---------CCCC-----HHHHHHHHhcCCCC
Confidence                     2221     35889998887654


No 52 
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=97.02  E-value=0.00079  Score=53.08  Aligned_cols=32  Identities=31%  Similarity=0.343  Sum_probs=27.1

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      ..+.|+|++|+|||+++                         +.++||||-.|..-.
T Consensus       137 ~givHrDlkP~NIll~~-------------------------~~~~liDFG~a~~~~  168 (190)
T cd05145         137 AGLVHGDLSEYNILYHD-------------------------GKPYIIDVSQAVELD  168 (190)
T ss_pred             CCEecCCCChhhEEEEC-------------------------CCEEEEEcccceecC
Confidence            47999999999999973                         579999999887633


No 53 
>PRK09902 hypothetical protein; Provisional
Probab=96.99  E-value=0.003  Score=51.98  Aligned_cols=77  Identities=12%  Similarity=-0.005  Sum_probs=51.2

Q ss_pred             HHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc-----c
Q psy15664         10 NTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY-----R   84 (174)
Q Consensus        10 ~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----~   84 (174)
                      ..++..+-+.+..    ..++|.|+.+.||++...                      ++-.+.|||||-+....     +
T Consensus       134 l~~va~~ia~LH~----~Gv~Hgdly~khIll~~~----------------------g~~~v~lIDlEk~r~~l~~~~~~  187 (216)
T PRK09902        134 LKAVALAFKKMHS----VNRQHGCCYVRHIYVKTE----------------------GKAEAGFLDLEKSRRRLRRDKAI  187 (216)
T ss_pred             HHHHHHHHHHHHH----CCCcCCCCCHhheeecCC----------------------CCeeEEEEEhhccchhhhhhhhh
Confidence            3344444444433    359999999999999751                      12359999999877544     3


Q ss_pred             hhhHHHHHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHh
Q psy15664         85 AFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLS  129 (174)
Q Consensus        85 ~fDlan~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~  129 (174)
                      .-||+-.....                .. .++.+++.|+.+|+.
T Consensus       188 ~~Dl~~l~r~~----------------~~-~s~~~~~~~~~~y~~  215 (216)
T PRK09902        188 NHDFRQLEKYL----------------EP-IPKADWEQVKAYYYA  215 (216)
T ss_pred             HhHHHHHHHhc----------------cC-CCHHHHHHHHHHHhc
Confidence            45666554220                11 278999999999984


No 54 
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=96.88  E-value=0.0011  Score=52.81  Aligned_cols=29  Identities=34%  Similarity=0.531  Sum_probs=24.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..+.|+|++|+|||+++                         +.++||||--|.
T Consensus       137 ~giiHrDlkP~NIli~~-------------------------~~v~LiDFG~a~  165 (190)
T cd05147         137 CRLVHADLSEYNLLYHD-------------------------GKLYIIDVSQSV  165 (190)
T ss_pred             CCcccCCCCHHHEEEEC-------------------------CcEEEEEccccc
Confidence            35999999999999974                         579999998765


No 55 
>PRK12274 serine/threonine protein kinase; Provisional
Probab=96.83  E-value=0.0038  Score=51.44  Aligned_cols=34  Identities=35%  Similarity=0.454  Sum_probs=27.6

Q ss_pred             eeeeeccC-CCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664         27 VTFCHNDL-QEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus        27 ~v~cHNDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      ..++|+|| +++|||++.                        ++.++||||.-|....+
T Consensus       110 ~GIvHrDL~kp~NILv~~------------------------~g~i~LIDFG~A~~~~~  144 (218)
T PRK12274        110 CGVAHNDLAKEANWLVQE------------------------DGSPAVIDFQLAVRGNP  144 (218)
T ss_pred             CcCccCCCCCcceEEEcC------------------------CCCEEEEECCCceecCC
Confidence            35999999 799999975                        35799999998875543


No 56 
>COG3570 StrB Streptomycin 6-kinase [Defense mechanisms]
Probab=96.78  E-value=0.0085  Score=49.78  Aligned_cols=103  Identities=22%  Similarity=0.216  Sum_probs=64.5

Q ss_pred             HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHH
Q psy15664         11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIAN   90 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan   90 (174)
                      -|...+-+.+-..+..++.-|+||+-+|||-.+                        ...-.+||-- .-.+.|+||-||
T Consensus       145 v~aA~~A~~LL~~p~di~pLHGDlHH~Nild~~------------------------~rGWlvIDPk-gl~Gdrg~D~AN  199 (274)
T COG3570         145 VEAARAAQTLLDTPRDIRPLHGDLHHGNILDGD------------------------RRGWLVIDPK-GLIGDRGFDYAN  199 (274)
T ss_pred             hhHHHHHHHHhcCccccccCcccccccccccCC------------------------cCceEEEccc-cccCccccchHh
Confidence            345555555555667788999999999999654                        2457788864 556899999999


Q ss_pred             HHHHHhhhccCCCCCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHHHHHHHHH
Q psy15664         91 HFVESVYDYSYKHFPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVKHFTLASHFF  155 (174)
Q Consensus        91 ~f~E~~~dy~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~~~~~~s~~~  155 (174)
                      .||.-.       .+       .--.+....+-+.-...+..   .+-.+|++-+..|..+|--.
T Consensus       200 lf~Np~-------~~-------~~~~pgRi~rqlai~a~a~~---l~p~rLlqw~~Ay~gLSAaW  247 (274)
T COG3570         200 LFCNPL-------DD-------LALAPGRIARQLAIFAHALG---LDPRRLLQWAIAYGGLSAAW  247 (274)
T ss_pred             hhcCCc-------hh-------hhhChHHHHHHHHHHHHHhc---cCHHHHHHHHHHHhhhhHHh
Confidence            998522       10       01112222333333333332   23457778888887766543


No 57 
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=96.71  E-value=0.0033  Score=52.24  Aligned_cols=44  Identities=25%  Similarity=0.248  Sum_probs=31.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc--cchhhHHHHHHHHhh
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN--YRAFDIANHFVESVY   97 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n--~~~fDlan~f~E~~~   97 (174)
                      ..+.|+|++|+|||+++                        .+ ++||||-.+...  ..+.|+  ++.|-.|
T Consensus       154 ~gi~H~Dikp~Nili~~------------------------~g-i~liDfg~~~~~~e~~a~d~--~vler~y  199 (232)
T PRK10359        154 HGMVSGDPHKGNFIVSK------------------------NG-LRIIDLSGKRCTAQRKAKDR--IDLERHY  199 (232)
T ss_pred             cCCccCCCChHHEEEeC------------------------CC-EEEEECCCcccccchhhHHH--HHHHhHh
Confidence            36999999999999976                        23 999998654433  455555  5555444


No 58 
>KOG0667|consensus
Probab=96.66  E-value=0.0021  Score=59.64  Aligned_cols=35  Identities=29%  Similarity=0.510  Sum_probs=28.2

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      ...+.|+||+|.|||+.+.                      ...+|+||||=-|++-
T Consensus       307 ~l~IIHcDLKPENILL~~~----------------------~r~~vKVIDFGSSc~~  341 (586)
T KOG0667|consen  307 ELGIIHCDLKPENILLKDP----------------------KRSRIKVIDFGSSCFE  341 (586)
T ss_pred             hCCeeeccCChhheeeccC----------------------CcCceeEEeccccccc
Confidence            4679999999999999873                      2358999999766653


No 59 
>PF01163 RIO1:  RIO1 family;  InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date.   Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=96.47  E-value=0.0055  Score=49.18  Aligned_cols=28  Identities=36%  Similarity=0.495  Sum_probs=21.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      ..+.|+||.+.|||+.+                         +++++|||+=+
T Consensus       126 ~givHGDLs~~NIlv~~-------------------------~~~~iIDf~qa  153 (188)
T PF01163_consen  126 AGIVHGDLSEYNILVDD-------------------------GKVYIIDFGQA  153 (188)
T ss_dssp             TTEEESS-STTSEEEET-------------------------TCEEE--GTTE
T ss_pred             cCceecCCChhhEEeec-------------------------ceEEEEecCcc
Confidence            46999999999999987                         48999999644


No 60 
>PF06176 WaaY:  Lipopolysaccharide core biosynthesis protein (WaaY);  InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system [].; GO: 0009244 lipopolysaccharide core region biosynthetic process
Probab=96.36  E-value=0.0058  Score=50.72  Aligned_cols=28  Identities=29%  Similarity=0.364  Sum_probs=24.1

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      ..+-|+|+||||+|+++                         +.+++||+.-.
T Consensus       154 ~G~~HGD~hpgNFlv~~-------------------------~~i~iID~~~k  181 (229)
T PF06176_consen  154 HGFYHGDPHPGNFLVSN-------------------------NGIRIIDTQGK  181 (229)
T ss_pred             cCCccCCCCcCcEEEEC-------------------------CcEEEEECccc
Confidence            46999999999999986                         57999999644


No 61 
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=96.25  E-value=0.0048  Score=47.57  Aligned_cols=32  Identities=28%  Similarity=0.336  Sum_probs=25.7

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .....++|+|++|+||++.+                         +.+.+|||.-+.
T Consensus       131 h~~~~ivH~Dl~p~Nili~~-------------------------~~~~liDfg~a~  162 (187)
T cd05119         131 YREAGLVHGDLSEYNILVDD-------------------------GKVYIIDVPQAV  162 (187)
T ss_pred             hhccCcCcCCCChhhEEEEC-------------------------CcEEEEECcccc
Confidence            33356899999999999973                         578999997664


No 62 
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=96.24  E-value=0.0059  Score=45.78  Aligned_cols=56  Identities=20%  Similarity=0.188  Sum_probs=37.1

Q ss_pred             hhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664          6 SKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA   85 (174)
Q Consensus         6 ~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~   85 (174)
                      .+.+..-+..+-+.+...... .++|+|++++||++..                       ..+.++|+||+++......
T Consensus        91 ~~~~~~~~~~l~~~l~~lh~~-~~~H~dl~~~ni~~~~-----------------------~~~~~~l~d~~~~~~~~~~  146 (215)
T cd00180          91 EDEILRILLQILEGLEYLHSN-GIIHRDLKPENILLDS-----------------------DNGKVKLADFGLSKLLTSD  146 (215)
T ss_pred             HHHHHHHHHHHHHHHHHHHhC-CeeccCCCHhhEEEeC-----------------------CCCcEEEecCCceEEccCC
Confidence            333333344444444433322 7999999999999985                       1368999999988765544


No 63 
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=96.19  E-value=0.0039  Score=50.50  Aligned_cols=27  Identities=30%  Similarity=0.458  Sum_probs=23.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY   78 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY   78 (174)
                      ..++|+||.+.|||+.+                         ++++||||.-
T Consensus       144 ~glVHGDLs~~NIL~~~-------------------------~~v~iIDF~q  170 (197)
T cd05146         144 CNLVHADLSEYNMLWHD-------------------------GKVWFIDVSQ  170 (197)
T ss_pred             CCeecCCCCHHHEEEEC-------------------------CcEEEEECCC
Confidence            46999999999999975                         5799999963


No 64 
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=96.11  E-value=0.0097  Score=50.04  Aligned_cols=35  Identities=20%  Similarity=0.393  Sum_probs=26.5

Q ss_pred             hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         22 KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        22 ~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ...+...++|+||+|.|||++.                        ++.++|+||-.+.
T Consensus       110 ~lH~~~~ivHrDikp~NIll~~------------------------~~~~kL~Dfg~~~  144 (325)
T cd05594         110 YLHSEKNVVYRDLKLENLMLDK------------------------DGHIKITDFGLCK  144 (325)
T ss_pred             HHHhcCCEEecCCCCCeEEECC------------------------CCCEEEecCCCCe
Confidence            3333346899999999999975                        3578899987654


No 65 
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=96.10  E-value=0.011  Score=46.46  Aligned_cols=30  Identities=30%  Similarity=0.408  Sum_probs=25.6

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|++|+||+++.                        +..++||||-.|.
T Consensus       144 ~gi~H~Dl~p~Nill~~------------------------~~~~~liDfg~~~  173 (198)
T cd05144         144 HGIIHGDLSEFNILVDD------------------------DEKIYIIDWPQMV  173 (198)
T ss_pred             CCCCcCCCCcccEEEcC------------------------CCcEEEEECCccc
Confidence            46999999999999975                        4689999998663


No 66 
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=95.97  E-value=0.01  Score=47.51  Aligned_cols=43  Identities=21%  Similarity=0.240  Sum_probs=31.2

Q ss_pred             HHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         14 DWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        14 ~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..+-+.+....++..++|+|+++.||+++.                        .+.++|+||..+.
T Consensus       107 ~~l~~~l~~lH~~~~i~H~dl~~~ni~~~~------------------------~~~~~l~d~g~~~  149 (265)
T cd06605         107 VAVLKGLTYLHEKHKIIHRDVKPSNILVNS------------------------RGQIKLCDFGVSG  149 (265)
T ss_pred             HHHHHHHHHHcCCCCeecCCCCHHHEEECC------------------------CCCEEEeecccch
Confidence            333344444455567999999999999986                        3679999997653


No 67 
>smart00090 RIO RIO-like kinase.
Probab=95.80  E-value=0.016  Score=47.77  Aligned_cols=28  Identities=36%  Similarity=0.464  Sum_probs=24.4

Q ss_pred             eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      +||+|++|+|||+.+                         +.++||||..|..
T Consensus       170 iiH~Dikp~NIli~~-------------------------~~i~LiDFg~a~~  197 (237)
T smart00090      170 LVHGDLSEYNILVHD-------------------------GKVVIIDVSQSVE  197 (237)
T ss_pred             EEeCCCChhhEEEEC-------------------------CCEEEEEChhhhc
Confidence            899999999999973                         5799999987774


No 68 
>KOG0583|consensus
Probab=95.62  E-value=0.014  Score=51.44  Aligned_cols=34  Identities=26%  Similarity=0.342  Sum_probs=28.6

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      ..++|+||++.|||++.+                       +..++|+||.++...+
T Consensus       139 ~gi~HRDLK~ENilld~~-----------------------~~~~Kl~DFG~s~~~~  172 (370)
T KOG0583|consen  139 RGIVHRDLKPENILLDGN-----------------------EGNLKLSDFGLSAISP  172 (370)
T ss_pred             CCEeeCCCCHHHEEecCC-----------------------CCCEEEeccccccccC
Confidence            468999999999999872                       2689999999988654


No 69 
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=95.60  E-value=0.0093  Score=47.43  Aligned_cols=29  Identities=34%  Similarity=0.518  Sum_probs=25.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        ++.++||||..+.
T Consensus       118 ~i~H~dikp~NIl~~~------------------------~~~~~l~Dfg~~~  146 (260)
T PF00069_consen  118 GIVHRDIKPENILLDE------------------------NGEVKLIDFGSSV  146 (260)
T ss_dssp             TEEESSBSGGGEEEST------------------------TSEEEESSGTTTE
T ss_pred             cccccccccccccccc------------------------ccccccccccccc
Confidence            5899999999999985                        4678999998875


No 70 
>PRK10345 hypothetical protein; Provisional
Probab=95.55  E-value=0.021  Score=46.49  Aligned_cols=16  Identities=25%  Similarity=0.380  Sum_probs=14.2

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       125 ~IvhrDlKp~NILl~~  140 (210)
T PRK10345        125 RIVTMELKPQNILCQR  140 (210)
T ss_pred             CEeecCCCHHHEEEec
Confidence            3779999999999975


No 71 
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=95.49  E-value=0.021  Score=44.61  Aligned_cols=33  Identities=24%  Similarity=0.365  Sum_probs=26.1

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      ..++|+|+++.||++++                        ++.++|+||..+....
T Consensus       117 ~~i~h~dl~p~ni~i~~------------------------~~~~~l~d~~~~~~~~  149 (253)
T cd05122         117 NGIIHRDIKAANILLTS------------------------DGEVKLIDFGLSAQLS  149 (253)
T ss_pred             CCEecCCCCHHHEEEcc------------------------CCeEEEeecccccccc
Confidence            45899999999999986                        3568888887765443


No 72 
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=95.47  E-value=0.02  Score=45.97  Aligned_cols=16  Identities=38%  Similarity=0.640  Sum_probs=14.8

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       123 ~i~H~dl~p~Nil~~~  138 (261)
T cd05068         123 NYIHRDLAARNVLVGE  138 (261)
T ss_pred             CeeeccCCcceEEEcC
Confidence            5899999999999986


No 73 
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=95.43  E-value=0.016  Score=47.25  Aligned_cols=29  Identities=28%  Similarity=0.409  Sum_probs=23.5

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|++|.|||++.                        .+.++|+||..+.
T Consensus       128 ~ivH~dikp~Nili~~------------------------~~~~kl~dfg~~~  156 (288)
T cd07863         128 CIVHRDLKPENILVTS------------------------GGQVKLADFGLAR  156 (288)
T ss_pred             CeecCCCCHHHEEECC------------------------CCCEEECccCccc
Confidence            4899999999999975                        3568888887654


No 74 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.41  E-value=0.023  Score=48.01  Aligned_cols=17  Identities=29%  Similarity=0.462  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      -.++|+||++.|||+..
T Consensus       123 ~~ivH~dlkp~Nil~~~  139 (331)
T cd06649         123 HQIMHRDVKPSNILVNS  139 (331)
T ss_pred             CCEEcCCCChhhEEEcC
Confidence            35899999999999976


No 75 
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=95.37  E-value=0.021  Score=46.54  Aligned_cols=31  Identities=23%  Similarity=0.337  Sum_probs=24.4

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ...++|+||++.||+++.                        ++.++++||..+.
T Consensus       121 ~~~i~H~dl~p~nil~~~------------------------~~~~~l~dfg~~~  151 (286)
T cd06622         121 EHNIIHRDVKPTNVLVNG------------------------NGQVKLCDFGVSG  151 (286)
T ss_pred             cCCEeeCCCCHHHEEECC------------------------CCCEEEeecCCcc
Confidence            346999999999999976                        3568888887553


No 76 
>KOG0984|consensus
Probab=95.34  E-value=0.013  Score=48.76  Aligned_cols=43  Identities=23%  Similarity=0.342  Sum_probs=34.2

Q ss_pred             HHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         15 WLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        15 ~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .+-+.+...++++-+.|+|++|+|||++.                        ++++++-||--||+
T Consensus       156 Svv~al~~L~~kL~vIHRDvKPsNiLIn~------------------------~GqVKiCDFGIsG~  198 (282)
T KOG0984|consen  156 SVVHALEFLHSKLSVIHRDVKPSNILINY------------------------DGQVKICDFGISGY  198 (282)
T ss_pred             HHHHHHHHHHHHhhhhhccCCcceEEEcc------------------------CCcEEEccccccee
Confidence            34444445566788999999999999986                        68899999988875


No 77 
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=95.34  E-value=0.026  Score=44.94  Aligned_cols=29  Identities=21%  Similarity=0.267  Sum_probs=23.5

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        ...++|+||..+.
T Consensus       122 ~i~H~di~p~nil~~~------------------------~~~~~l~df~~~~  150 (257)
T cd08223         122 HILHRDLKTQNVFLTR------------------------TNIIKVGDLGIAR  150 (257)
T ss_pred             CeeccCCCchhEEEec------------------------CCcEEEecccceE
Confidence            5899999999999975                        3568888887664


No 78 
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=95.34  E-value=0.028  Score=45.28  Aligned_cols=36  Identities=22%  Similarity=0.377  Sum_probs=27.1

Q ss_pred             hhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         21 LKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        21 ~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ........++|+|+++.||++..                        +..++++||..+.
T Consensus       127 ~~lh~~~~i~H~dl~~~nil~~~------------------------~~~~~l~dfg~~~  162 (269)
T cd08528         127 RYLHKEKRIVHRDLTPNNIMLGE------------------------DDKVTITDFGLAK  162 (269)
T ss_pred             HHhccCCceeecCCCHHHEEECC------------------------CCcEEEeccccee
Confidence            33333346899999999999975                        3578888888765


No 79 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=95.33  E-value=0.017  Score=48.57  Aligned_cols=30  Identities=30%  Similarity=0.543  Sum_probs=24.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||++.|||+..                        ++.++|+||..+.
T Consensus       115 ~givH~Dlkp~NIll~~------------------------~~~~kL~DfG~~~  144 (325)
T cd05604         115 INIVYRDLKPENILLDS------------------------QGHVVLTDFGLCK  144 (325)
T ss_pred             CCeeecCCCHHHeEECC------------------------CCCEEEeecCCcc
Confidence            35899999999999976                        3578999998765


No 80 
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=95.31  E-value=0.081  Score=44.75  Aligned_cols=63  Identities=21%  Similarity=0.304  Sum_probs=47.8

Q ss_pred             ccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664          3 KILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus         3 ~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      .+++-++..=+..+.+.+......-.+.|+||+.||.++..                         +..+++|- =|-++
T Consensus       163 g~~f~did~~~~~v~elL~~hqpqPsLlHGDLW~gN~a~~~-------------------------~GPv~fDP-A~y~G  216 (286)
T COG3001         163 GLTFGDIDAIVEKIQELLADHQPQPSLLHGDLWSGNCAFGK-------------------------DGPVIFDP-ACYWG  216 (286)
T ss_pred             CCCccCHHHHHHHHHHHHhcCCCCcceeecccccccccccC-------------------------CCCeeecc-ccccC
Confidence            34555665556667777777777778999999999999876                         23678886 36679


Q ss_pred             cchhhHHHH
Q psy15664         83 YRAFDIANH   91 (174)
Q Consensus        83 ~~~fDlan~   91 (174)
                      +|-+|||..
T Consensus       217 DrE~Dlam~  225 (286)
T COG3001         217 DRECDLAML  225 (286)
T ss_pred             Ccccceehh
Confidence            999999853


No 81 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=95.26  E-value=0.017  Score=48.67  Aligned_cols=31  Identities=29%  Similarity=0.569  Sum_probs=26.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+||++.|||++.                        ++.++|+||..+..
T Consensus       120 ~giiH~Dlkp~NIll~~------------------------~~~~kL~Dfg~~~~  150 (350)
T cd05573         120 LGFIHRDIKPDNILIDA------------------------DGHIKLADFGLCKK  150 (350)
T ss_pred             CCeeccCCCHHHeEECC------------------------CCCEEeecCCCCcc
Confidence            46999999999999976                        46799999987753


No 82 
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=95.25  E-value=0.03  Score=44.35  Aligned_cols=30  Identities=33%  Similarity=0.462  Sum_probs=24.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+|++++||+++.                        .+.++++||.++..
T Consensus       123 ~~~h~dl~~~nil~~~------------------------~~~~~l~dfg~~~~  152 (258)
T smart00219      123 NFIHRDLAARNCLVGE------------------------NLVVKISDFGLSRD  152 (258)
T ss_pred             CeeecccccceEEEcc------------------------CCeEEEcccCCcee
Confidence            5799999999999986                        35688889887753


No 83 
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=95.23  E-value=0.023  Score=44.84  Aligned_cols=30  Identities=23%  Similarity=0.281  Sum_probs=25.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+|+++.||++.+                        .+.++|+||..+..
T Consensus       123 ~~~H~dl~~~nil~~~------------------------~~~~~l~d~~~~~~  152 (258)
T cd08215         123 KILHRDIKPQNIFLTS------------------------NGLVKLGDFGISKV  152 (258)
T ss_pred             CEecccCChHHeEEcC------------------------CCcEEECCccceee
Confidence            6899999999999986                        36788889876654


No 84 
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=95.20  E-value=0.019  Score=48.10  Aligned_cols=30  Identities=30%  Similarity=0.516  Sum_probs=23.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||++.|||++.                        ++.++|+||..+.
T Consensus       115 ~~ivH~Dlkp~NIll~~------------------------~~~~kl~Dfg~~~  144 (321)
T cd05603         115 LNIIYRDLKPENILLDS------------------------QGHVVLTDFGLCK  144 (321)
T ss_pred             CCeEeccCCHHHeEECC------------------------CCCEEEccCCCCc
Confidence            35899999999999975                        3568888887654


No 85 
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=95.18  E-value=0.02  Score=48.12  Aligned_cols=30  Identities=23%  Similarity=0.317  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+||++.|||+..                        .+.++|+||..+..
T Consensus       116 ~ivHrDlkp~Nili~~------------------------~~~~kl~Dfg~a~~  145 (330)
T cd05586         116 DIVYRDLKPENILLDA------------------------TGHIALCDFGLSKA  145 (330)
T ss_pred             CeEeccCCHHHeEECC------------------------CCCEEEecCCcCcC
Confidence            4899999999999976                        35688999887654


No 86 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=95.16  E-value=0.02  Score=48.05  Aligned_cols=16  Identities=25%  Similarity=0.316  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||+..
T Consensus       125 ~ivHrDlkp~Nili~~  140 (332)
T cd05614         125 GIVYRDIKLENILLDS  140 (332)
T ss_pred             CcEecCCCHHHeEECC
Confidence            5899999999999976


No 87 
>KOG0658|consensus
Probab=95.16  E-value=0.027  Score=49.51  Aligned_cols=17  Identities=29%  Similarity=0.626  Sum_probs=15.8

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+||+|++|-|||++.
T Consensus       144 ~~IcHRDIKPqNlLvD~  160 (364)
T KOG0658|consen  144 HGICHRDIKPQNLLVDP  160 (364)
T ss_pred             cCcccCCCChheEEEcC
Confidence            57999999999999987


No 88 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=95.11  E-value=0.032  Score=44.88  Aligned_cols=16  Identities=38%  Similarity=0.706  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       122 ~i~H~dl~~~Nill~~  137 (260)
T cd05069         122 NYIHRDLRAANILVGD  137 (260)
T ss_pred             CEeecccCcceEEEcC
Confidence            4899999999999976


No 89 
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=95.11  E-value=0.015  Score=52.26  Aligned_cols=34  Identities=26%  Similarity=0.422  Sum_probs=27.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      ..++|+|++||||++.+                        ++++++|||-.++.-++
T Consensus       276 ~g~~H~D~hPgNilv~~------------------------~g~i~liDfG~~~~l~~  309 (437)
T TIGR01982       276 DGFFHADLHPGNIFVLK------------------------DGKIIALDFGIVGRLSE  309 (437)
T ss_pred             CCceeCCCCcccEEECC------------------------CCcEEEEeCCCeeECCH
Confidence            35899999999999975                        46899999988765543


No 90 
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.10  E-value=0.031  Score=47.33  Aligned_cols=29  Identities=24%  Similarity=0.417  Sum_probs=23.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        .+.++|+||..+.
T Consensus       124 ~ivH~dlkp~Nili~~------------------------~~~~kL~Dfg~~~  152 (333)
T cd06650         124 KIMHRDVKPSNILVNS------------------------RGEIKLCDFGVSG  152 (333)
T ss_pred             CEEecCCChhhEEEcC------------------------CCCEEEeeCCcch
Confidence            4899999999999975                        3568888886553


No 91 
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=95.10  E-value=0.03  Score=45.34  Aligned_cols=23  Identities=22%  Similarity=0.400  Sum_probs=17.4

Q ss_pred             hhcCCCeeeeeccCCCCCeeecC
Q psy15664         21 LKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        21 ~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      ........++|+|+++.||+++.
T Consensus       117 ~~lH~~~~i~h~dlkp~nil~~~  139 (283)
T cd06617         117 EYLHSKLSVIHRDVKPSNVLINR  139 (283)
T ss_pred             HHHhhcCCeecCCCCHHHEEECC
Confidence            33334446899999999999975


No 92 
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=95.06  E-value=0.032  Score=44.06  Aligned_cols=17  Identities=41%  Similarity=0.538  Sum_probs=15.3

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       124 ~~i~H~di~p~nili~~  140 (262)
T cd00192         124 KKFVHRDLAARNCLVGE  140 (262)
T ss_pred             CCcccCccCcceEEECC
Confidence            45899999999999986


No 93 
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=95.02  E-value=0.031  Score=44.33  Aligned_cols=32  Identities=28%  Similarity=0.363  Sum_probs=26.5

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ...++|+|+++.||++.+                        .+.++|+||..+..
T Consensus       128 ~~~i~h~dl~p~nili~~------------------------~~~~kl~d~g~~~~  159 (265)
T cd08217         128 GNTVLHRDLKPANIFLDA------------------------NNNVKLGDFGLAKI  159 (265)
T ss_pred             cCcceecCCCHHHEEEec------------------------CCCEEEeccccccc
Confidence            567899999999999986                        36788888887664


No 94 
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=95.01  E-value=0.033  Score=44.56  Aligned_cols=30  Identities=33%  Similarity=0.423  Sum_probs=24.3

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|++|.||+++.                        ++.++|+||.++.
T Consensus       121 ~~i~H~dlkp~nil~~~------------------------~~~~kl~dfg~~~  150 (256)
T cd05082         121 NNFVHRDLAARNVLVSE------------------------DNVAKVSDFGLTK  150 (256)
T ss_pred             CCEeccccchheEEEcC------------------------CCcEEecCCccce
Confidence            35899999999999976                        3568888887654


No 95 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=94.98  E-value=0.025  Score=48.33  Aligned_cols=30  Identities=27%  Similarity=0.584  Sum_probs=25.3

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||+|.|||++.                        ++.++|+||..|.
T Consensus       120 ~givHrDLkp~NIli~~------------------------~~~vkL~DfG~~~  149 (360)
T cd05627         120 LGFIHRDIKPDNLLLDA------------------------KGHVKLSDFGLCT  149 (360)
T ss_pred             CCeEccCCCHHHEEECC------------------------CCCEEEeeccCCc
Confidence            35899999999999975                        4679999998764


No 96 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=94.98  E-value=0.027  Score=45.91  Aligned_cols=19  Identities=26%  Similarity=0.485  Sum_probs=15.8

Q ss_pred             CCeeeeeccCCCCCeeecC
Q psy15664         25 SPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~   43 (174)
                      +...++|+|+++.||++..
T Consensus       125 ~~~~i~H~dlkp~Nil~~~  143 (288)
T cd06616         125 EELKIIHRDVKPSNILLDR  143 (288)
T ss_pred             hcCCeeccCCCHHHEEEcc
Confidence            3346899999999999975


No 97 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=94.94  E-value=0.031  Score=47.82  Aligned_cols=30  Identities=27%  Similarity=0.586  Sum_probs=25.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||++.|||++.                        .+.++|+||..|.
T Consensus       120 ~givHrDlKp~NILi~~------------------------~~~vkL~DFGla~  149 (363)
T cd05628         120 LGFIHRDIKPDNLLLDS------------------------KGHVKLSDFGLCT  149 (363)
T ss_pred             CCeEecCCCHHHeEECC------------------------CCCEEEeeccCcc
Confidence            35899999999999975                        3679999998775


No 98 
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=94.91  E-value=0.034  Score=44.44  Aligned_cols=31  Identities=32%  Similarity=0.344  Sum_probs=24.8

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+|+++.||+++.                        ++.++|+||..+..
T Consensus       119 ~~~~H~dl~p~nili~~------------------------~~~~kl~Dfg~~~~  149 (254)
T cd05083         119 KKLVHRDLAARNILVSE------------------------DGVAKVSDFGLARV  149 (254)
T ss_pred             CCeeccccCcceEEEcC------------------------CCcEEECCCcccee
Confidence            35799999999999975                        35688888876654


No 99 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=94.89  E-value=0.034  Score=45.16  Aligned_cols=16  Identities=31%  Similarity=0.590  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+.+
T Consensus       129 ~iiH~dlkp~Nil~~~  144 (279)
T cd05109         129 RLVHRDLAARNVLVKS  144 (279)
T ss_pred             CeeccccccceEEEcC
Confidence            4899999999999975


No 100
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=94.87  E-value=0.033  Score=46.36  Aligned_cols=18  Identities=28%  Similarity=0.427  Sum_probs=15.5

Q ss_pred             CeeeeeccCCCCCeeecC
Q psy15664         26 PVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~   43 (174)
                      ...++|+|+++.|||+..
T Consensus       118 ~~~i~H~dl~p~nil~~~  135 (308)
T cd06615         118 KHKIMHRDVKPSNILVNS  135 (308)
T ss_pred             hCCEEECCCChHHEEEec
Confidence            345899999999999975


No 101
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=94.78  E-value=0.037  Score=47.93  Aligned_cols=30  Identities=27%  Similarity=0.512  Sum_probs=24.4

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||+|.|||++.                        .+.++|+||..|.
T Consensus       161 ~~IvHrDLKp~NILl~~------------------------~~~~kL~DFG~a~  190 (370)
T cd05621         161 MGLIHRDVKPDNMLLDK------------------------HGHLKLADFGTCM  190 (370)
T ss_pred             CCeEecCCCHHHEEECC------------------------CCCEEEEecccce
Confidence            35899999999999975                        3678889987653


No 102
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=94.78  E-value=0.041  Score=44.29  Aligned_cols=17  Identities=41%  Similarity=0.524  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++.+
T Consensus       123 ~~i~H~dlkp~nil~~~  139 (263)
T cd05052         123 KNFIHRDLAARNCLVGE  139 (263)
T ss_pred             CCEeecccCcceEEEcC
Confidence            35899999999999975


No 103
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=94.77  E-value=0.033  Score=46.74  Aligned_cols=30  Identities=20%  Similarity=0.434  Sum_probs=24.6

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||++.|||++.                        .+.++|+||..+.
T Consensus       121 ~~i~H~Dlkp~NIll~~------------------------~~~~kL~Dfg~a~  150 (330)
T cd05601         121 MGYVHRDIKPENVLIDR------------------------TGHIKLADFGSAA  150 (330)
T ss_pred             CCeEcccCchHheEECC------------------------CCCEEeccCCCCe
Confidence            35899999999999975                        3678899987663


No 104
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=94.76  E-value=0.036  Score=46.58  Aligned_cols=29  Identities=21%  Similarity=0.453  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        ++.++|+||-.+.
T Consensus       115 ~ivHrDlkp~NIll~~------------------------~~~~kl~DfG~a~  143 (323)
T cd05571         115 DVVYRDLKLENLMLDK------------------------DGHIKITDFGLCK  143 (323)
T ss_pred             CeEeCCCCHHHEEECC------------------------CCCEEEeeCCCCc
Confidence            5899999999999975                        3567888887654


No 105
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=94.76  E-value=0.043  Score=45.81  Aligned_cols=30  Identities=27%  Similarity=0.423  Sum_probs=24.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+||+|.|||+..                        .+.++|+||..+..
T Consensus       113 ~i~HrDlkp~Nili~~------------------------~~~~kl~Dfg~~~~  142 (312)
T cd05585         113 NVIYRDLKPENILLDY------------------------QGHIALCDFGLCKL  142 (312)
T ss_pred             CeEeCCCCHHHeEECC------------------------CCcEEEEECccccc
Confidence            4899999999999975                        35688888876653


No 106
>PHA03212 serine/threonine kinase US3; Provisional
Probab=94.73  E-value=0.038  Score=48.42  Aligned_cols=28  Identities=25%  Similarity=0.377  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .+.|+||+|.|||+..                        .+.++|+||-.|
T Consensus       202 ~IvHrDiKP~NIll~~------------------------~~~vkL~DFG~a  229 (391)
T PHA03212        202 RIIHRDIKAENIFINH------------------------PGDVCLGDFGAA  229 (391)
T ss_pred             CcccCCCChHhEEEcC------------------------CCCEEEEeCCcc
Confidence            5899999999999975                        356888898765


No 107
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=94.72  E-value=0.03  Score=47.21  Aligned_cols=16  Identities=25%  Similarity=0.314  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||++.
T Consensus       116 ~ivHrDlkp~Nili~~  131 (327)
T cd05617         116 GIIYRDLKLDNVLLDA  131 (327)
T ss_pred             CeeccCCCHHHEEEeC
Confidence            5899999999999976


No 108
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=94.72  E-value=0.032  Score=44.77  Aligned_cols=29  Identities=28%  Similarity=0.515  Sum_probs=23.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++.+                        ...+.|+||..+.
T Consensus       122 ~i~H~di~p~Nili~~------------------------~~~~~l~dfg~~~  150 (260)
T cd05070         122 NYIHRDLRSANILVGD------------------------GLVCKIADFGLAR  150 (260)
T ss_pred             CcccCCCccceEEEeC------------------------CceEEeCCceeee
Confidence            4899999999999986                        3567788887764


No 109
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=94.67  E-value=0.03  Score=47.19  Aligned_cols=16  Identities=13%  Similarity=0.291  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||++.
T Consensus       115 ~ivH~Dlkp~NIll~~  130 (323)
T cd05595         115 DVVYRDIKLENLMLDK  130 (323)
T ss_pred             CeEecCCCHHHEEEcC
Confidence            5899999999999976


No 110
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=94.66  E-value=0.04  Score=44.03  Aligned_cols=32  Identities=31%  Similarity=0.440  Sum_probs=25.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      ..++|+|+++.||+++.                        ++.++++||.++...
T Consensus       121 ~~i~H~di~p~Nili~~------------------------~~~~~l~d~g~~~~~  152 (256)
T cd05039         121 KNFVHRDLAARNVLVSE------------------------DLVAKVSDFGLAKEA  152 (256)
T ss_pred             CCccchhcccceEEEeC------------------------CCCEEEccccccccc
Confidence            35899999999999975                        356788888766543


No 111
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=94.60  E-value=0.034  Score=46.70  Aligned_cols=16  Identities=19%  Similarity=0.293  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||++.
T Consensus       121 ~ivHrDlkp~Nill~~  136 (323)
T cd05616         121 GIIYRDLKLDNVMLDS  136 (323)
T ss_pred             CEEecCCCHHHeEECC
Confidence            5899999999999976


No 112
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=94.58  E-value=0.036  Score=45.29  Aligned_cols=30  Identities=27%  Similarity=0.392  Sum_probs=23.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||+++.                        ++.++|+||.++.
T Consensus       151 ~~ivH~dlkp~Nil~~~------------------------~~~~kL~Dfg~~~  180 (293)
T cd05053         151 KKCIHRDLAARNVLVTE------------------------DHVMKIADFGLAR  180 (293)
T ss_pred             CCccccccceeeEEEcC------------------------CCeEEeCcccccc
Confidence            35899999999999975                        3567888887654


No 113
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=94.55  E-value=0.033  Score=46.10  Aligned_cols=16  Identities=31%  Similarity=0.521  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       123 ~ivH~dlkp~Nill~~  138 (303)
T cd07869         123 YILHRDLKPQNLLISD  138 (303)
T ss_pred             CeecCCCCHHHEEECC
Confidence            4899999999999975


No 114
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=94.54  E-value=0.031  Score=46.29  Aligned_cols=29  Identities=28%  Similarity=0.592  Sum_probs=23.5

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        .+.++++||..+.
T Consensus       135 ~i~H~dL~p~Nili~~------------------------~~~~~l~Dfg~~~  163 (297)
T cd06656         135 QVIHRDIKSDNILLGM------------------------DGSVKLTDFGFCA  163 (297)
T ss_pred             CcccCCCCHHHEEECC------------------------CCCEEECcCccce
Confidence            5899999999999975                        3568888887653


No 115
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=94.54  E-value=0.042  Score=43.72  Aligned_cols=26  Identities=23%  Similarity=0.350  Sum_probs=19.1

Q ss_pred             HHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664         18 KHLLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        18 ~~l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      +.+........++|+|+++.||++..
T Consensus       110 ~~l~~lh~~~~~~H~~l~~~ni~~~~  135 (264)
T cd06623         110 KGLDYLHTKRHIIHRDIKPSNLLINS  135 (264)
T ss_pred             HHHHHHhccCCCccCCCCHHHEEECC
Confidence            33444444367899999999999976


No 116
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=94.53  E-value=0.053  Score=45.80  Aligned_cols=29  Identities=24%  Similarity=0.395  Sum_probs=24.1

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        ++.++|+||..+.
T Consensus       138 ~ivH~dlkp~NIll~~------------------------~~~~kl~Dfg~~~  166 (329)
T PTZ00263        138 DIIYRDLKPENLLLDN------------------------KGHVKVTDFGFAK  166 (329)
T ss_pred             CeeecCCCHHHEEECC------------------------CCCEEEeeccCce
Confidence            4899999999999975                        3578899987654


No 117
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=94.53  E-value=0.042  Score=46.44  Aligned_cols=16  Identities=19%  Similarity=0.337  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||++.
T Consensus       115 ~ivHrDikp~NIll~~  130 (328)
T cd05593         115 KIVYRDLKLENLMLDK  130 (328)
T ss_pred             CeEecccCHHHeEECC
Confidence            5899999999999975


No 118
>KOG0581|consensus
Probab=94.52  E-value=0.041  Score=48.48  Aligned_cols=48  Identities=25%  Similarity=0.379  Sum_probs=35.8

Q ss_pred             HhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHH
Q psy15664         20 LLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFV   93 (174)
Q Consensus        20 l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~   93 (174)
                      |.......-+.|+|++|.|||++.                        .+.++|-||=-++.--..  +||-|.
T Consensus       191 L~YLh~~~~IIHRDIKPsNlLvNs------------------------kGeVKicDFGVS~~lvnS--~a~tfv  238 (364)
T KOG0581|consen  191 LSYLHEERKIIHRDIKPSNLLVNS------------------------KGEVKICDFGVSGILVNS--IANTFV  238 (364)
T ss_pred             HHHHhhccCeeeccCCHHHeeecc------------------------CCCEEeccccccHHhhhh--hccccc
Confidence            344454577999999999999986                        578999999877764444  666554


No 119
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=94.51  E-value=0.045  Score=43.66  Aligned_cols=16  Identities=44%  Similarity=0.644  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       117 ~i~H~di~p~nil~~~  132 (257)
T cd05040         117 RFIHRDLAARNILLAS  132 (257)
T ss_pred             CccccccCcccEEEec
Confidence            5799999999999986


No 120
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=94.51  E-value=0.046  Score=46.56  Aligned_cols=16  Identities=25%  Similarity=0.549  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||++.
T Consensus       188 ~ivHrDlkp~NIll~~  203 (353)
T PLN00034        188 HIVHRDIKPSNLLINS  203 (353)
T ss_pred             CEeecCCCHHHEEEcC
Confidence            5899999999999976


No 121
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=94.50  E-value=0.043  Score=46.12  Aligned_cols=17  Identities=29%  Similarity=0.432  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||++.|||++.
T Consensus       115 ~giiHrDlkp~Nili~~  131 (325)
T cd05602         115 LNIVYRDLKPENILLDS  131 (325)
T ss_pred             CCeEecCCCHHHeEECC
Confidence            35899999999999975


No 122
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=94.49  E-value=0.053  Score=44.98  Aligned_cols=30  Identities=27%  Similarity=0.412  Sum_probs=25.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+|+++.||++..                        .+.++|+||+.+..
T Consensus       123 ~i~H~dlkp~Nili~~------------------------~~~~~l~dfg~~~~  152 (316)
T cd05574         123 GIVYRDLKPENILLHE------------------------SGHIMLSDFDLSKQ  152 (316)
T ss_pred             CeeccCCChHHeEEcC------------------------CCCEEEeecchhhc
Confidence            4899999999999986                        36789999998764


No 123
>PHA03209 serine/threonine kinase US3; Provisional
Probab=94.46  E-value=0.044  Score=46.97  Aligned_cols=29  Identities=17%  Similarity=0.288  Sum_probs=23.6

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||+..                        .+.++|+||..+.
T Consensus       177 ~ivHrDlkp~Nill~~------------------------~~~~kl~DfG~a~  205 (357)
T PHA03209        177 RIIHRDVKTENIFIND------------------------VDQVCIGDLGAAQ  205 (357)
T ss_pred             CeecCCCCHHHEEECC------------------------CCCEEEecCcccc
Confidence            4899999999999975                        3567888887664


No 124
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=94.45  E-value=0.038  Score=45.58  Aligned_cols=17  Identities=35%  Similarity=0.501  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||++.|||++.
T Consensus       123 ~~i~H~dlkp~Nil~~~  139 (301)
T cd07873         123 RKVLHRDLKPQNLLINE  139 (301)
T ss_pred             CCeeCCCCCHHHEEECC
Confidence            35899999999999976


No 125
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=94.45  E-value=0.048  Score=45.02  Aligned_cols=29  Identities=24%  Similarity=0.418  Sum_probs=23.9

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||+|.|||++.                        .+.++|+||..+.
T Consensus       121 ~i~H~dlkp~NIli~~------------------------~~~~kl~Dfg~~~  149 (291)
T cd05612         121 EIVYRDLKPENILLDK------------------------EGHIKLTDFGFAK  149 (291)
T ss_pred             CeeecCCCHHHeEECC------------------------CCCEEEEecCcch
Confidence            5899999999999975                        3578899987654


No 126
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=94.44  E-value=0.043  Score=46.09  Aligned_cols=29  Identities=31%  Similarity=0.513  Sum_probs=23.5

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.|||++.                        ++.++|+||..+.
T Consensus       116 givH~dikp~NIll~~------------------------~~~~kl~Dfg~~~  144 (323)
T cd05575         116 NIIYRDLKPENILLDS------------------------QGHVVLTDFGLCK  144 (323)
T ss_pred             CeEeCCCCHHHeEECC------------------------CCcEEEeccCCCc
Confidence            4899999999999975                        3568888887654


No 127
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=94.43  E-value=0.056  Score=46.33  Aligned_cols=29  Identities=31%  Similarity=0.635  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        .+.++|+||-.|.
T Consensus       121 ~ivHrDlkp~Nill~~------------------------~~~ikL~DFG~a~  149 (376)
T cd05598         121 GFIHRDIKPDNILIDR------------------------DGHIKLTDFGLCT  149 (376)
T ss_pred             CeEeCCCCHHHEEECC------------------------CCCEEEEeCCCCc
Confidence            4899999999999975                        4679999998764


No 128
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=94.42  E-value=0.04  Score=46.33  Aligned_cols=16  Identities=31%  Similarity=0.362  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||++.
T Consensus       120 ~ivH~dlkp~Nil~~~  135 (323)
T cd05584         120 GIIYRDLKPENILLDA  135 (323)
T ss_pred             CeecCCCCHHHeEECC
Confidence            5899999999999975


No 129
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=94.42  E-value=0.051  Score=48.77  Aligned_cols=29  Identities=24%  Similarity=0.374  Sum_probs=23.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||+|.|||++.                        .+.++|+||..|.
T Consensus       189 ~ivHrDlkp~NIll~~------------------------~~~~kL~DFgla~  217 (478)
T PTZ00267        189 KMMHRDLKSANIFLMP------------------------TGIIKLGDFGFSK  217 (478)
T ss_pred             CEEECCcCHHhEEECC------------------------CCcEEEEeCcCce
Confidence            5899999999999985                        3568888887653


No 130
>PRK09188 serine/threonine protein kinase; Provisional
Probab=94.42  E-value=0.069  Score=47.10  Aligned_cols=40  Identities=30%  Similarity=0.323  Sum_probs=30.4

Q ss_pred             eeeeeccC-CCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHH
Q psy15664         27 VTFCHNDL-QEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIAN   90 (174)
Q Consensus        27 ~v~cHNDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan   90 (174)
                      ..++|+|| +|+|||++.                        ++.++||||..|..-.+.-.++.
T Consensus       130 ~gIiHrDL~KP~NILv~~------------------------~~~ikLiDFGlA~~~~~~~~~~~  170 (365)
T PRK09188        130 AGITHNDLAKPQNWLMGP------------------------DGEAAVIDFQLASVFRRRGALYR  170 (365)
T ss_pred             CCCeeCCCCCcceEEEcC------------------------CCCEEEEECccceecccCcchhh
Confidence            36899999 899999964                        35799999998886555443333


No 131
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=94.40  E-value=0.054  Score=44.94  Aligned_cols=16  Identities=38%  Similarity=0.414  Sum_probs=14.3

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||+..
T Consensus       128 ~ivHrDlkp~Nil~~~  143 (317)
T cd07868         128 WVLHRDLKPANILVMG  143 (317)
T ss_pred             CEEcCCCCHHHEEEec
Confidence            4899999999999964


No 132
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=94.39  E-value=0.049  Score=46.79  Aligned_cols=30  Identities=27%  Similarity=0.474  Sum_probs=25.4

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||+|.|||++.                        ++.++|+||..|.
T Consensus       120 ~givHrDlkp~NIll~~------------------------~~~~kl~DfGla~  149 (377)
T cd05629         120 LGFIHRDIKPDNILIDR------------------------GGHIKLSDFGLST  149 (377)
T ss_pred             CCeeccCCCHHHEEECC------------------------CCCEEEeeccccc
Confidence            35999999999999975                        4679999998774


No 133
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=94.38  E-value=0.051  Score=45.57  Aligned_cols=16  Identities=31%  Similarity=0.314  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       116 ~ivHrDikp~Nill~~  131 (321)
T cd05591         116 GVIYRDLKLDNILLDA  131 (321)
T ss_pred             CeeccCCCHHHeEECC
Confidence            4899999999999975


No 134
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=94.38  E-value=0.045  Score=46.28  Aligned_cols=16  Identities=25%  Similarity=0.318  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||++.
T Consensus       116 ~ivH~Dikp~Nili~~  131 (329)
T cd05618         116 GIIYRDLKLDNVLLDS  131 (329)
T ss_pred             CeeeCCCCHHHEEECC
Confidence            5899999999999975


No 135
>PHA02882 putative serine/threonine kinase; Provisional
Probab=94.37  E-value=0.057  Score=44.70  Aligned_cols=16  Identities=25%  Similarity=0.470  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|++|.|||++.
T Consensus       146 ~iiHrDiKp~Nill~~  161 (294)
T PHA02882        146 GISHGDIKPENIMVDG  161 (294)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            5899999999999975


No 136
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=94.37  E-value=0.055  Score=42.71  Aligned_cols=30  Identities=23%  Similarity=0.337  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+|+++.||++..                        .+.++|+||.++..
T Consensus       119 ~i~H~dl~p~ni~i~~------------------------~~~~~l~d~~~~~~  148 (254)
T cd06627         119 GVIHRDIKAANILTTK------------------------DGVVKLADFGVATK  148 (254)
T ss_pred             CcccCCCCHHHEEECC------------------------CCCEEEecccccee
Confidence            5789999999999975                        35789999987764


No 137
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=94.36  E-value=0.048  Score=46.97  Aligned_cols=29  Identities=31%  Similarity=0.635  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||+|.|||++.                        .+.++|+||..|.
T Consensus       121 ~ivHrDlKp~NILl~~------------------------~g~~kL~DFGla~  149 (382)
T cd05625         121 GFIHRDIKPDNILIDR------------------------DGHIKLTDFGLCT  149 (382)
T ss_pred             CeecCCCCHHHEEECC------------------------CCCEEEeECCCCc
Confidence            4899999999999975                        4679999998764


No 138
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=94.36  E-value=0.048  Score=46.55  Aligned_cols=29  Identities=28%  Similarity=0.542  Sum_probs=24.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|++|.|||+..                        ++.++|+||..+.
T Consensus       146 ~ivH~Dlkp~NIll~~------------------------~~~~kL~DfG~a~  174 (364)
T cd07875         146 GIIHRDLKPSNIVVKS------------------------DCTLKILDFGLAR  174 (364)
T ss_pred             CeecCCCCHHHEEECC------------------------CCcEEEEeCCCcc
Confidence            5899999999999975                        3568888887764


No 139
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=94.35  E-value=0.042  Score=45.60  Aligned_cols=17  Identities=47%  Similarity=0.614  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.|||++.
T Consensus       143 ~gi~H~dlkp~Nili~~  159 (303)
T cd05088         143 KQFIHRDLAARNILVGE  159 (303)
T ss_pred             CCccccccchheEEecC
Confidence            46899999999999975


No 140
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=94.34  E-value=0.054  Score=45.77  Aligned_cols=28  Identities=29%  Similarity=0.628  Sum_probs=23.1

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .++|+||++.|||+..                        .+.++|+||..+
T Consensus       122 ~ivH~dlkp~Nill~~------------------------~~~~kl~Dfg~~  149 (331)
T cd05597         122 GYVHRDIKPDNVLLDK------------------------NGHIRLADFGSC  149 (331)
T ss_pred             CeEECCCCHHHEEECC------------------------CCCEEEEECCce
Confidence            4789999999999975                        356888998764


No 141
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=94.32  E-value=0.038  Score=45.47  Aligned_cols=17  Identities=35%  Similarity=0.518  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||+|.|||++.
T Consensus       122 ~~ivH~dlkp~Nil~~~  138 (288)
T cd07871         122 RKILHRDLKPQNLLINE  138 (288)
T ss_pred             CCcccCCCCHHHEEECC
Confidence            35899999999999975


No 142
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=94.31  E-value=0.051  Score=45.84  Aligned_cols=16  Identities=31%  Similarity=0.495  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       138 ~ivHrdikp~Nil~~~  153 (343)
T cd07878         138 GIIHRDLKPSNVAVNE  153 (343)
T ss_pred             CeecccCChhhEEECC
Confidence            5899999999999975


No 143
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=94.31  E-value=0.048  Score=46.04  Aligned_cols=29  Identities=31%  Similarity=0.607  Sum_probs=23.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      ..++|+||++.|||++.                        ++.++|+||..+
T Consensus       121 ~~iiHrDlkp~Nili~~------------------------~~~~kL~DfG~a  149 (332)
T cd05623         121 LHYVHRDIKPDNILMDM------------------------NGHIRLADFGSC  149 (332)
T ss_pred             CCeEecCCCHHHEEECC------------------------CCCEEEeecchh
Confidence            34899999999999975                        356888888754


No 144
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=94.29  E-value=0.066  Score=44.99  Aligned_cols=16  Identities=44%  Similarity=0.567  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||++.
T Consensus       194 ~ivHrDiKp~Nil~~~  209 (338)
T cd05102         194 KCIHRDLAARNILLSE  209 (338)
T ss_pred             CEECCCCccceEEEcC
Confidence            5899999999999975


No 145
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=94.29  E-value=0.052  Score=43.39  Aligned_cols=29  Identities=34%  Similarity=0.525  Sum_probs=23.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        ++.++++||..+.
T Consensus       123 ~i~h~di~p~nili~~------------------------~~~~~l~d~g~~~  151 (261)
T cd05034         123 NYIHRDLAARNILVGE------------------------NLVCKIADFGLAR  151 (261)
T ss_pred             CcccCCcchheEEEcC------------------------CCCEEECccccce
Confidence            4899999999999976                        3678888887654


No 146
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=94.28  E-value=0.048  Score=45.77  Aligned_cols=16  Identities=19%  Similarity=0.289  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||++.
T Consensus       121 ~ivH~dlkp~Nill~~  136 (324)
T cd05587         121 GIIYRDLKLDNVMLDA  136 (324)
T ss_pred             CeEecCCCHHHeEEcC
Confidence            5899999999999976


No 147
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=94.28  E-value=0.047  Score=44.59  Aligned_cols=17  Identities=24%  Similarity=0.311  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       124 ~~~~H~dl~p~nil~~~  140 (288)
T cd05583         124 LGIIYRDIKLENILLDS  140 (288)
T ss_pred             CCeeccCCCHHHeEECC
Confidence            35899999999999975


No 148
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=94.28  E-value=0.062  Score=42.81  Aligned_cols=16  Identities=38%  Similarity=0.430  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       114 ~i~H~dl~p~nil~~~  129 (252)
T cd05084         114 HCIHRDLAARNCLVTE  129 (252)
T ss_pred             CccccccchheEEEcC
Confidence            4799999999999975


No 149
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=94.27  E-value=0.05  Score=45.99  Aligned_cols=17  Identities=24%  Similarity=0.591  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||++.|||++.
T Consensus       121 ~~iiHrDlkp~Nill~~  137 (331)
T cd05624         121 LHYVHRDIKPDNVLLDM  137 (331)
T ss_pred             CCeeeccCchHHEEEcC
Confidence            35899999999999975


No 150
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=94.26  E-value=0.055  Score=43.65  Aligned_cols=17  Identities=35%  Similarity=0.538  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       128 ~~i~H~dl~p~nil~~~  144 (284)
T cd05038         128 QRYIHRDLAARNILVES  144 (284)
T ss_pred             CCeecCCCCHHhEEEcC
Confidence            35899999999999976


No 151
>KOG0594|consensus
Probab=94.26  E-value=0.077  Score=46.20  Aligned_cols=17  Identities=29%  Similarity=0.419  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      -.+.|+||+|.|||+++
T Consensus       139 ~~IlHRDLKPQNlLi~~  155 (323)
T KOG0594|consen  139 HGILHRDLKPQNLLISS  155 (323)
T ss_pred             CCeecccCCcceEEECC
Confidence            35789999999999987


No 152
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=94.25  E-value=0.065  Score=43.61  Aligned_cols=16  Identities=31%  Similarity=0.605  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|++|.|||+..
T Consensus       127 ~i~H~dlkp~Nili~~  142 (283)
T cd05080         127 HYIHRDLAARNVLLDN  142 (283)
T ss_pred             CeeccccChheEEEcC
Confidence            5899999999999975


No 153
>TIGR02457 TreS_Cterm trehalose synthase-fused probable maltokinase. Three pathways for the biosynthesis of trehalose, an osmoprotectant that in some species is also a precursor of certain cell wall glycolipids. Trehalose synthase, TreS, can interconvert maltose and trehalose, but while the equilibrium may favor trehalose, physiological concentrations of trehalose may be much greater than that of maltose and TreS may act largely in its degradation. This model describes a domain found only as a C-terminal fusion to TreS proteins. The most closely related proteins outside this family, Pep2 of Streptomyces coelicolor and Mak1 of Actinoplanes missouriensis, have known maltokinase activity. We suggest this domain acts as a maltokinase and helps drive conversion of trehalose to maltose.
Probab=94.24  E-value=0.058  Score=49.87  Aligned_cols=44  Identities=27%  Similarity=0.249  Sum_probs=33.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc---------cCccchhhHHHHHHHHh
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC---------SYNYRAFDIANHFVESV   96 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa---------~~n~~~fDlan~f~E~~   96 (174)
                      .=||+|+|.||+|+..                         +..+|||||==         ....+.=|+|..+..+-
T Consensus       380 ~RiHGD~HLgqvL~t~-------------------------~d~~IiDFEGEP~Rpl~ERR~k~sPLRDVAGMLRSf~  432 (528)
T TIGR02457       380 IRIHGDFHLGQVLVVQ-------------------------DDAVLIDFEGEPARPLAERRAKRSPLRDVAGMLRSFD  432 (528)
T ss_pred             EeEecCcchhcEEEeC-------------------------CCeEEEcCCCCCCCChHHhccCCChHHHHHHHHHHHH
Confidence            4499999999999875                         46779999842         23456678888887744


No 154
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=94.24  E-value=0.047  Score=46.68  Aligned_cols=29  Identities=21%  Similarity=0.368  Sum_probs=23.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||+|.|||++.                        ++.++|+||..+.
T Consensus       151 ~ivHrDLkp~NILl~~------------------------~~~ikL~DFG~a~  179 (340)
T PTZ00426        151 NIVYRDLKPENLLLDK------------------------DGFIKMTDFGFAK  179 (340)
T ss_pred             CeEccCCCHHHEEECC------------------------CCCEEEecCCCCe
Confidence            5899999999999975                        3568888887664


No 155
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=94.23  E-value=0.038  Score=46.51  Aligned_cols=16  Identities=38%  Similarity=0.656  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++++|||+..
T Consensus       125 givH~dlkp~Nili~~  140 (332)
T cd07857         125 NVLHRDLKPGNLLVNA  140 (332)
T ss_pred             CcccCCCCHHHeEEcC
Confidence            4899999999999976


No 156
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=94.22  E-value=0.048  Score=44.85  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||++.||+++.
T Consensus       134 ~~i~H~dl~p~nill~~  150 (296)
T cd06618         134 HGVIHRDVKPSNILLDA  150 (296)
T ss_pred             CCEecCCCcHHHEEEcC
Confidence            35899999999999975


No 157
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=94.22  E-value=0.053  Score=43.85  Aligned_cols=16  Identities=31%  Similarity=0.526  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       119 ~i~H~dl~p~ni~~~~  134 (286)
T cd07832         119 GIMHRDLKPANLLISA  134 (286)
T ss_pred             CeecCCcCHHHEEEcC
Confidence            4899999999999986


No 158
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=94.20  E-value=0.058  Score=44.56  Aligned_cols=29  Identities=34%  Similarity=0.575  Sum_probs=23.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|++|.|||++.                        .+.++|+||-++.
T Consensus       158 ~ivH~dlkp~Nill~~------------------------~~~~kl~DfG~~~  186 (304)
T cd05096         158 NFVHRDLATRNCLVGE------------------------NLTIKIADFGMSR  186 (304)
T ss_pred             CccccCcchhheEEcC------------------------CccEEECCCccce
Confidence            4789999999999986                        3567888887654


No 159
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=94.19  E-value=0.053  Score=44.74  Aligned_cols=17  Identities=41%  Similarity=0.597  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.|||+..
T Consensus       138 ~~ivH~dlkp~Nill~~  154 (297)
T cd05089         138 KQFIHRDLAARNVLVGE  154 (297)
T ss_pred             CCcccCcCCcceEEECC
Confidence            35899999999999976


No 160
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=94.19  E-value=0.06  Score=45.25  Aligned_cols=16  Identities=25%  Similarity=0.322  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||++.
T Consensus       116 ~ivH~dlkp~NIli~~  131 (320)
T cd05590         116 GIIYRDLKLDNVLLDH  131 (320)
T ss_pred             CeEeCCCCHHHeEECC
Confidence            5899999999999975


No 161
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=94.18  E-value=0.053  Score=44.47  Aligned_cols=31  Identities=19%  Similarity=0.363  Sum_probs=24.8

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+|+++.|||+..                        .+.++|+||.++..
T Consensus       120 ~~i~H~dl~p~nili~~------------------------~~~~kl~dfg~~~~  150 (290)
T cd05580         120 LDIVYRDLKPENLLLDS------------------------DGYIKITDFGFAKR  150 (290)
T ss_pred             CCEecCCCCHHHEEECC------------------------CCCEEEeeCCCccc
Confidence            45899999999999976                        35688888876653


No 162
>KOG4250|consensus
Probab=94.18  E-value=0.062  Score=50.98  Aligned_cols=34  Identities=24%  Similarity=0.343  Sum_probs=25.0

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      -.+||+||+||||++..+..+                    +.--+|+||=||-
T Consensus       139 n~IvHRDlKP~NIvl~~Gedg--------------------q~IyKLtDfG~Ar  172 (732)
T KOG4250|consen  139 NGIVHRDLKPGNIVLQIGEDG--------------------QSIYKLTDFGAAR  172 (732)
T ss_pred             cCceeccCCCCcEEEeecCCC--------------------ceEEeeecccccc
Confidence            469999999999999874221                    2346788887664


No 163
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=94.16  E-value=0.053  Score=44.06  Aligned_cols=29  Identities=21%  Similarity=0.408  Sum_probs=23.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|++|.|||+.+                        ...++|+||..+.
T Consensus       144 gi~H~dlkp~Nil~~~------------------------~~~~kl~Dfg~~~  172 (283)
T cd05091         144 HVVHKDLATRNVLVFD------------------------KLNVKISDLGLFR  172 (283)
T ss_pred             CccccccchhheEecC------------------------CCceEeccccccc
Confidence            4799999999999975                        3567888887543


No 164
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=94.16  E-value=0.055  Score=46.38  Aligned_cols=16  Identities=31%  Similarity=0.621  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||++.
T Consensus       123 ~ivH~dlkp~Nili~~  138 (372)
T cd07853         123 GILHRDIKPGNLLVNS  138 (372)
T ss_pred             CeeCCCCChHHEEECC
Confidence            4899999999999976


No 165
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=94.14  E-value=0.049  Score=45.20  Aligned_cols=16  Identities=38%  Similarity=0.573  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       124 ~ivH~dlkp~Nill~~  139 (309)
T cd07872         124 KVLHRDLKPQNLLINE  139 (309)
T ss_pred             CeecCCCCHHHEEECC
Confidence            5899999999999976


No 166
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=94.11  E-value=0.05  Score=43.75  Aligned_cols=16  Identities=38%  Similarity=0.638  Sum_probs=14.3

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       132 ~i~H~dlkp~Nil~~~  147 (272)
T cd05075         132 SFIHRDLAARNCMLNE  147 (272)
T ss_pred             CeeccccchhheEEcC
Confidence            4799999999999975


No 167
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=94.10  E-value=0.048  Score=45.75  Aligned_cols=16  Identities=19%  Similarity=0.297  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       116 ~ivHrDlkp~Nil~~~  131 (316)
T cd05620         116 GIIYRDLKLDNVMLDR  131 (316)
T ss_pred             CeEecCCCHHHeEECC
Confidence            5899999999999975


No 168
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=94.10  E-value=0.064  Score=45.12  Aligned_cols=29  Identities=24%  Similarity=0.416  Sum_probs=24.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        .+.++|+||..+.
T Consensus       121 ~ivH~dlkp~Nil~~~------------------------~~~~kL~Dfg~a~  149 (333)
T cd05600         121 GYIHRDLKPENFLIDA------------------------SGHIKLTDFGLSK  149 (333)
T ss_pred             CccccCCCHHHEEECC------------------------CCCEEEEeCcCCc
Confidence            4899999999999975                        3578999997664


No 169
>PTZ00036 glycogen synthase kinase; Provisional
Probab=94.10  E-value=0.058  Score=47.97  Aligned_cols=17  Identities=35%  Similarity=0.641  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||+|.|||++.
T Consensus       189 ~~IiHrDLKp~NILl~~  205 (440)
T PTZ00036        189 KFICHRDLKPQNLLIDP  205 (440)
T ss_pred             CCEecCCcCHHHEEEcC
Confidence            35899999999999975


No 170
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=94.09  E-value=0.076  Score=42.72  Aligned_cols=29  Identities=31%  Similarity=0.383  Sum_probs=23.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .+.|+|++++||++..                        ++.++++||..+.
T Consensus       120 ~i~H~dl~p~nili~~------------------------~~~~kl~d~g~~~  148 (256)
T cd05113         120 QFIHRDLAARNCLVDD------------------------QGCVKVSDFGLSR  148 (256)
T ss_pred             CeeccccCcceEEEcC------------------------CCCEEECCCccce
Confidence            5899999999999975                        3568888887654


No 171
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=94.08  E-value=0.063  Score=43.76  Aligned_cols=28  Identities=29%  Similarity=0.434  Sum_probs=23.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .++|+|++|.|||+..                        ++.++|+||..+
T Consensus       130 ~iiH~dlkp~Nil~~~------------------------~~~~kl~Dfg~~  157 (290)
T cd07862         130 RVVHRDLKPQNILVTS------------------------SGQIKLADFGLA  157 (290)
T ss_pred             CeeeCCCCHHHEEEcC------------------------CCCEEEccccce
Confidence            4899999999999975                        356888888655


No 172
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=94.08  E-value=0.084  Score=42.23  Aligned_cols=29  Identities=28%  Similarity=0.441  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.|||+..                        .+.++|+||..+.
T Consensus       115 ~i~H~di~p~nili~~------------------------~~~~kl~df~~~~  143 (257)
T cd05060         115 HFVHRDLAARNVLLVN------------------------RHQAKISDFGMSR  143 (257)
T ss_pred             CeeccCcccceEEEcC------------------------CCcEEeccccccc
Confidence            4899999999999975                        3567888887654


No 173
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=94.08  E-value=0.061  Score=43.40  Aligned_cols=17  Identities=35%  Similarity=0.601  Sum_probs=14.8

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.|||++.
T Consensus       125 ~~i~h~dlkp~nili~~  141 (267)
T cd05066         125 MGYVHRDLAARNILVNS  141 (267)
T ss_pred             CCEeehhhchhcEEECC
Confidence            35899999999999975


No 174
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=94.05  E-value=0.055  Score=45.70  Aligned_cols=16  Identities=25%  Similarity=0.314  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||++.
T Consensus       116 ~ivH~dlkp~Nili~~  131 (329)
T cd05588         116 GIIYRDLKLDNVLLDA  131 (329)
T ss_pred             CeEecCCCHHHeEECC
Confidence            5899999999999975


No 175
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=94.00  E-value=0.057  Score=45.92  Aligned_cols=29  Identities=24%  Similarity=0.573  Sum_probs=24.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        ++.++|+||..+.
T Consensus       121 ~ivH~Dlkp~NIl~~~------------------------~~~~kl~Dfg~~~  149 (364)
T cd05599         121 GYIHRDIKPDNLLLDA------------------------KGHIKLSDFGLCT  149 (364)
T ss_pred             CeEeccCCHHHeEECC------------------------CCCEEEeecccce
Confidence            4789999999999975                        4679999998774


No 176
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=94.00  E-value=0.065  Score=44.68  Aligned_cols=16  Identities=38%  Similarity=0.513  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       123 ~ivH~dlkp~NIll~~  138 (338)
T cd07859         123 NVFHRDLKPKNILANA  138 (338)
T ss_pred             CeecCCCCHHHeEECC
Confidence            4899999999999976


No 177
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=94.00  E-value=0.061  Score=44.97  Aligned_cols=29  Identities=28%  Similarity=0.359  Sum_probs=24.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||++.                        ++.++|+||..+.
T Consensus       118 ~i~H~dlkp~Nil~~~------------------------~~~~kL~Dfg~~~  146 (318)
T cd05582         118 GIIYRDLKPENILLDE------------------------EGHIKLTDFGLSK  146 (318)
T ss_pred             CEecCCCCHHHeEECC------------------------CCcEEEeeccCCc
Confidence            5899999999999975                        3578999997654


No 178
>PHA03207 serine/threonine kinase US3; Provisional
Probab=93.99  E-value=0.044  Score=47.61  Aligned_cols=16  Identities=31%  Similarity=0.528  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||+..
T Consensus       205 givHrDlkp~Nill~~  220 (392)
T PHA03207        205 GIIHRDVKTENIFLDE  220 (392)
T ss_pred             CccccCCCHHHEEEcC
Confidence            5899999999999976


No 179
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=93.99  E-value=0.076  Score=45.92  Aligned_cols=17  Identities=29%  Similarity=0.618  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||+|.|||++.
T Consensus       161 ~~ivHrDLkp~NIll~~  177 (371)
T cd05622         161 MGFIHRDVKPDNMLLDK  177 (371)
T ss_pred             CCEEeCCCCHHHEEECC
Confidence            35899999999999975


No 180
>KOG1166|consensus
Probab=93.98  E-value=0.12  Score=51.07  Aligned_cols=48  Identities=23%  Similarity=0.361  Sum_probs=33.4

Q ss_pred             HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      -++..+-+.|..    ..+.|+||+|.|+|+.......+                 +...|+||||=+|
T Consensus       801 ~qml~ive~lH~----~~IIHgDiKPDNfll~~~~~~~~-----------------~~~~l~lIDfG~s  848 (974)
T KOG1166|consen  801 CQMLRIVEHLHA----MGIIHGDIKPDNFLLRREICADS-----------------DSKGLYLIDFGRS  848 (974)
T ss_pred             HHHHHHHHHHHh----cceecccCCcceeEeecccCCCC-----------------cccceEEEecccc
Confidence            445555555544    45999999999999987433211                 2477999999655


No 181
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=93.98  E-value=0.088  Score=41.98  Aligned_cols=30  Identities=23%  Similarity=0.323  Sum_probs=24.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||++..                        .+.++++||..+.
T Consensus       119 ~~i~H~dl~p~nili~~------------------------~~~~~l~dfg~~~  148 (255)
T cd08219         119 KRVLHRDIKSKNIFLTQ------------------------NGKVKLGDFGSAR  148 (255)
T ss_pred             CCcccCCCCcceEEECC------------------------CCcEEEcccCcce
Confidence            35899999999999975                        3568888988664


No 182
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=93.97  E-value=0.08  Score=42.76  Aligned_cols=16  Identities=38%  Similarity=0.466  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       142 ~i~h~dlkp~nili~~  157 (280)
T cd05049         142 HFVHRDLATRNCLVGY  157 (280)
T ss_pred             CeeccccccceEEEcC
Confidence            5789999999999976


No 183
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=93.97  E-value=0.067  Score=43.69  Aligned_cols=29  Identities=28%  Similarity=0.379  Sum_probs=23.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      ..++|+||++.|||+..                        ++.++|+||..+
T Consensus       124 ~~i~H~dl~p~nil~~~------------------------~~~~kl~dfg~~  152 (290)
T cd05613         124 LGIIYRDIKLENILLDS------------------------NGHVVLTDFGLS  152 (290)
T ss_pred             CCeeccCCCHHHeEECC------------------------CCCEEEeeCccc
Confidence            35899999999999975                        356888888655


No 184
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=93.97  E-value=0.067  Score=43.21  Aligned_cols=16  Identities=44%  Similarity=0.748  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.||++.+
T Consensus       122 ~i~H~dl~p~Nill~~  137 (262)
T cd05071         122 NYVHRDLRAANILVGE  137 (262)
T ss_pred             CccccccCcccEEEcC
Confidence            4789999999999976


No 185
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=93.97  E-value=0.076  Score=43.12  Aligned_cols=17  Identities=29%  Similarity=0.516  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       128 ~~i~H~di~p~nil~~~  144 (279)
T cd05057         128 KRLVHRDLAARNVLVKT  144 (279)
T ss_pred             CCEEecccCcceEEEcC
Confidence            46899999999999975


No 186
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=93.97  E-value=0.049  Score=44.65  Aligned_cols=16  Identities=38%  Similarity=0.445  Sum_probs=14.3

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       117 ~ivH~dikp~Nil~~~  132 (279)
T cd05633         117 FVVYRDLKPANILLDE  132 (279)
T ss_pred             CcCCCCCCHHHEEECC
Confidence            3789999999999975


No 187
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=93.96  E-value=0.075  Score=43.61  Aligned_cols=16  Identities=38%  Similarity=0.522  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       143 ~i~H~dlkp~Nil~~~  158 (291)
T cd05094         143 HFVHRDLATRNCLVGA  158 (291)
T ss_pred             CeeecccCcceEEEcc
Confidence            5899999999999986


No 188
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=93.96  E-value=0.054  Score=43.95  Aligned_cols=16  Identities=31%  Similarity=0.532  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       119 ~i~H~dl~~~nil~~~  134 (284)
T cd07839         119 NVLHRDLKPQNLLINK  134 (284)
T ss_pred             CEecCCCCHHHEEEcC
Confidence            5899999999999976


No 189
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=93.95  E-value=0.074  Score=43.34  Aligned_cols=30  Identities=23%  Similarity=0.482  Sum_probs=24.4

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||+++.                        .+.++|+||.++.
T Consensus       135 ~gi~H~dl~p~ni~i~~------------------------~~~~~l~d~~~~~  164 (286)
T cd06614         135 QNVIHRDIKSDNILLSK------------------------DGSVKLADFGFAA  164 (286)
T ss_pred             CCeeeCCCChhhEEEcC------------------------CCCEEECccchhh
Confidence            45899999999999985                        3568888887654


No 190
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=93.95  E-value=0.084  Score=41.71  Aligned_cols=31  Identities=23%  Similarity=0.306  Sum_probs=24.6

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+|+++.||++..                        .+.++++||..+..
T Consensus       112 ~~~~H~~l~p~ni~~~~------------------------~~~~~l~d~~~~~~  142 (250)
T cd05123         112 LGIIYRDLKPENILLDA------------------------DGHIKLTDFGLAKE  142 (250)
T ss_pred             CCceecCCCcceEEEcC------------------------CCcEEEeecCccee
Confidence            45899999999999976                        35678888876643


No 191
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=93.95  E-value=0.075  Score=43.03  Aligned_cols=17  Identities=47%  Similarity=0.614  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|++|.|||+..
T Consensus       131 ~~i~H~dikp~nili~~  147 (270)
T cd05047         131 KQFIHRDLAARNILVGE  147 (270)
T ss_pred             CCEeecccccceEEEcC
Confidence            46899999999999976


No 192
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=93.95  E-value=0.058  Score=45.80  Aligned_cols=29  Identities=28%  Similarity=0.542  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|++|.|||+..                        ++.++|+||..+.
T Consensus       139 givHrDikp~Nill~~------------------------~~~~kl~Dfg~~~  167 (355)
T cd07874         139 GIIHRDLKPSNIVVKS------------------------DCTLKILDFGLAR  167 (355)
T ss_pred             CcccCCCChHHEEECC------------------------CCCEEEeeCcccc
Confidence            5899999999999975                        3567888887664


No 193
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=93.90  E-value=0.077  Score=42.38  Aligned_cols=29  Identities=34%  Similarity=0.419  Sum_probs=23.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++++                        +..++++||.++.
T Consensus       124 ~i~h~dl~~~nilv~~------------------------~~~~kl~d~g~~~  152 (261)
T cd05148         124 NSIHRDLAARNILVGE------------------------DLVCKVADFGLAR  152 (261)
T ss_pred             CeeccccCcceEEEcC------------------------CceEEEccccchh
Confidence            4899999999999976                        3567888887764


No 194
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=93.88  E-value=0.057  Score=45.08  Aligned_cols=16  Identities=38%  Similarity=0.565  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       123 gi~H~dlkp~nili~~  138 (330)
T cd07834         123 NVIHRDLKPSNILVNS  138 (330)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            4899999999999986


No 195
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=93.88  E-value=0.091  Score=42.99  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       122 ~i~H~dl~p~nill~~  137 (298)
T cd07841         122 WILHRDLKPNNLLIAS  137 (298)
T ss_pred             CeeecCCChhhEEEcC
Confidence            4899999999999986


No 196
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=93.87  E-value=0.059  Score=44.15  Aligned_cols=16  Identities=25%  Similarity=0.380  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       117 ~i~H~dlkp~Nili~~  132 (280)
T cd05608         117 RIIYRDLKPENVLLDN  132 (280)
T ss_pred             CcccCCCCHHHEEECC
Confidence            5899999999999975


No 197
>PTZ00284 protein kinase; Provisional
Probab=93.86  E-value=0.059  Score=47.99  Aligned_cols=22  Identities=27%  Similarity=0.461  Sum_probs=17.1

Q ss_pred             hcCCCeeeeeccCCCCCeeecC
Q psy15664         22 KIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        22 ~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      .......++|+||++.|||+..
T Consensus       246 yLH~~~gIiHrDlKP~NILl~~  267 (467)
T PTZ00284        246 YFHTELHLMHTDLKPENILMET  267 (467)
T ss_pred             HHHhcCCeecCCCCHHHEEEec
Confidence            3333356899999999999975


No 198
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=93.85  E-value=0.058  Score=45.97  Aligned_cols=16  Identities=31%  Similarity=0.555  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||+..
T Consensus       143 ~ivHrDlkp~NIl~~~  158 (359)
T cd07876         143 GIIHRDLKPSNIVVKS  158 (359)
T ss_pred             CcccCCCCHHHEEECC
Confidence            5899999999999975


No 199
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=93.84  E-value=0.084  Score=48.94  Aligned_cols=30  Identities=23%  Similarity=0.465  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||+|.|||++.                       ....++|+||-.|.
T Consensus       275 gIiHRDLKP~NILl~~-----------------------~~~~~KL~DFGlA~  304 (566)
T PLN03225        275 GIVHRDVKPQNIIFSE-----------------------GSGSFKIIDLGAAA  304 (566)
T ss_pred             CEEeCcCCHHHEEEeC-----------------------CCCcEEEEeCCCcc
Confidence            5899999999999975                       23568999998774


No 200
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=93.83  E-value=0.068  Score=43.87  Aligned_cols=16  Identities=31%  Similarity=0.407  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       122 ~iiH~dikp~Nili~~  137 (285)
T cd05632         122 NTVYRDLKPENILLDD  137 (285)
T ss_pred             CeeecCCCHHHEEECC
Confidence            4899999999999975


No 201
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=93.83  E-value=0.088  Score=41.74  Aligned_cols=17  Identities=18%  Similarity=0.341  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       120 ~~i~h~dl~~~nili~~  136 (256)
T cd08529         120 KKILHRDIKSLNLFLDA  136 (256)
T ss_pred             CCcccCCCCcceEEEeC
Confidence            46899999999999986


No 202
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=93.82  E-value=0.085  Score=43.96  Aligned_cols=16  Identities=31%  Similarity=0.584  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||+..
T Consensus       129 ~iiH~dlkp~Nill~~  144 (316)
T cd05108         129 RLVHRDLAARNVLVKT  144 (316)
T ss_pred             CeeccccchhheEecC
Confidence            4799999999999975


No 203
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=93.82  E-value=0.059  Score=44.15  Aligned_cols=16  Identities=31%  Similarity=0.557  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++++||++..
T Consensus       135 ~i~H~dl~p~nil~~~  150 (311)
T cd07866         135 HILHRDIKAANILIDN  150 (311)
T ss_pred             CeecCCCCHHHEEECC
Confidence            5899999999999976


No 204
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=93.81  E-value=0.079  Score=42.50  Aligned_cols=16  Identities=38%  Similarity=0.627  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       115 ~i~H~dlkp~nill~~  130 (257)
T cd05116         115 NFVHRDLAARNVLLVT  130 (257)
T ss_pred             CEeecccchhhEEEcC
Confidence            4799999999999976


No 205
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=93.80  E-value=0.035  Score=51.37  Aligned_cols=37  Identities=27%  Similarity=0.432  Sum_probs=27.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      -.|.|.|+|||||+++.+..                    ..+++++|||=-++.-+
T Consensus       279 ~GffHaDpHPGNIlv~~~g~--------------------~~~~i~llDFGivg~l~  315 (537)
T PRK04750        279 DGFFHADMHPGNIFVSYDPP--------------------ENPRYIALDFGIVGSLN  315 (537)
T ss_pred             CCeeeCCCChHHeEEecCCC--------------------CCCeEEEEecceEEECC
Confidence            46999999999999986211                    13589999997666443


No 206
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=93.78  E-value=0.078  Score=43.34  Aligned_cols=16  Identities=31%  Similarity=0.443  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+||++.|||++.
T Consensus       123 ~i~H~dlkp~Nil~~~  138 (291)
T cd07870         123 HILHRDLKPQNLLISY  138 (291)
T ss_pred             CcccCCCChHHEEEcC
Confidence            5899999999999975


No 207
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=93.78  E-value=0.062  Score=45.11  Aligned_cols=17  Identities=24%  Similarity=0.286  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||++.|||++.
T Consensus       115 ~~ivH~dlkp~Nill~~  131 (316)
T cd05592         115 KGIIYRDLKLDNVLLDK  131 (316)
T ss_pred             CCEEeCCCCHHHeEECC
Confidence            35899999999999975


No 208
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=93.71  E-value=0.087  Score=41.81  Aligned_cols=29  Identities=34%  Similarity=0.379  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        +..++|+||..+.
T Consensus       113 ~~~H~dl~p~nili~~------------------------~~~~~l~d~g~~~  141 (250)
T cd05085         113 NCIHRDLAARNCLVGE------------------------NNVLKISDFGMSR  141 (250)
T ss_pred             CeeecccChheEEEcC------------------------CCeEEECCCccce
Confidence            5899999999999975                        3567888887654


No 209
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=93.71  E-value=0.077  Score=43.30  Aligned_cols=17  Identities=29%  Similarity=0.536  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|++|.||++..
T Consensus       128 ~gi~H~dlkp~Nil~~~  144 (284)
T cd05079         128 RQYVHRDLAARNVLVES  144 (284)
T ss_pred             CCeeecccchheEEEcC
Confidence            35899999999999975


No 210
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=93.71  E-value=0.069  Score=44.82  Aligned_cols=16  Identities=25%  Similarity=0.353  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+||++.|||++.
T Consensus       121 ~ivHrdlkp~Nill~~  136 (324)
T cd05589         121 KIVYRDLKLDNLLLDT  136 (324)
T ss_pred             CeEecCCCHHHeEECC
Confidence            4789999999999976


No 211
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=93.69  E-value=0.087  Score=43.86  Aligned_cols=17  Identities=35%  Similarity=0.450  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.|||++.
T Consensus       153 ~gi~H~dlkp~Nill~~  169 (314)
T cd05099         153 RRCIHRDLAARNVLVTE  169 (314)
T ss_pred             CCeeeccccceeEEEcC
Confidence            35899999999999975


No 212
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=93.68  E-value=0.074  Score=42.37  Aligned_cols=29  Identities=34%  Similarity=0.371  Sum_probs=23.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        .+.++++||..+.
T Consensus       120 ~i~h~dl~p~ni~i~~------------------------~~~~~l~d~g~~~  148 (256)
T cd05112         120 NVIHRDLAARNCLVGE------------------------NQVVKVSDFGMTR  148 (256)
T ss_pred             CccccccccceEEEcC------------------------CCeEEECCCccee
Confidence            4899999999999975                        3567888887653


No 213
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=93.67  E-value=0.071  Score=43.26  Aligned_cols=16  Identities=38%  Similarity=0.590  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||++.
T Consensus       139 ~~vH~dlkp~Nil~~~  154 (277)
T cd05062         139 KFVHRDLAARNCMVAE  154 (277)
T ss_pred             CcccCCcchheEEEcC
Confidence            4899999999999986


No 214
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=93.67  E-value=0.097  Score=42.17  Aligned_cols=16  Identities=31%  Similarity=0.385  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||++.
T Consensus       120 ~ivH~dlkp~Nill~~  135 (269)
T cd05042         120 DFIHSDLALRNCQLTA  135 (269)
T ss_pred             CEecccccHhheEecC
Confidence            4789999999999976


No 215
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=93.63  E-value=0.09  Score=43.16  Aligned_cols=16  Identities=31%  Similarity=0.459  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       122 ~iiH~dikp~Nill~~  137 (285)
T cd05631         122 RIVYRDLKPENILLDD  137 (285)
T ss_pred             CEEeCCCCHHHEEECC
Confidence            5899999999999975


No 216
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=93.62  E-value=0.091  Score=43.37  Aligned_cols=16  Identities=38%  Similarity=0.526  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.|||+..
T Consensus       157 givH~dlkp~Nili~~  172 (304)
T cd05101         157 KCIHRDLAARNVLVTE  172 (304)
T ss_pred             CeeecccccceEEEcC
Confidence            5899999999999975


No 217
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=93.61  E-value=0.076  Score=43.11  Aligned_cols=29  Identities=24%  Similarity=0.400  Sum_probs=23.6

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        .+.+.|+||..+.
T Consensus       144 ~i~H~dlkp~nili~~------------------------~~~~kl~dfg~~~  172 (286)
T cd06638         144 KTIHRDVKGNNILLTT------------------------EGGVKLVDFGVSA  172 (286)
T ss_pred             CccccCCCHHhEEECC------------------------CCCEEEccCCcee
Confidence            5899999999999986                        3458888887653


No 218
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=93.61  E-value=0.068  Score=45.92  Aligned_cols=28  Identities=46%  Similarity=0.579  Sum_probs=24.6

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeee
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFE   77 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfE   77 (174)
                      ...+.|+|+.+-|||+++                        ++.+++|||-
T Consensus       220 ~~GiVHGDlSefNIlV~~------------------------dg~~~vIDwP  247 (304)
T COG0478         220 RRGIVHGDLSEFNILVTE------------------------DGDIVVIDWP  247 (304)
T ss_pred             HcCccccCCchheEEEec------------------------CCCEEEEeCc
Confidence            467999999999999986                        4689999995


No 219
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=93.60  E-value=0.077  Score=43.01  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       119 ~~~H~dl~p~nil~~~  134 (283)
T cd07835         119 RVLHRDLKPQNLLIDR  134 (283)
T ss_pred             CeeCCCCCHHHEEEcC
Confidence            5899999999999976


No 220
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=93.59  E-value=0.097  Score=43.23  Aligned_cols=16  Identities=38%  Similarity=0.414  Sum_probs=14.2

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       128 ~ivH~Dlkp~Nil~~~  143 (317)
T cd07867         128 WVLHRDLKPANILVMG  143 (317)
T ss_pred             CEEcCCCCHHHEEEcc
Confidence            4899999999999964


No 221
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=93.58  E-value=0.092  Score=42.92  Aligned_cols=16  Identities=31%  Similarity=0.524  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       148 ~ivH~dlkp~nili~~  163 (291)
T cd06639         148 RIIHRDVKGNNILLTT  163 (291)
T ss_pred             CeeccCCCHHHEEEcC
Confidence            5899999999999975


No 222
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=93.58  E-value=0.11  Score=41.29  Aligned_cols=29  Identities=34%  Similarity=0.379  Sum_probs=23.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||+++.                        ++.++|+||..+.
T Consensus       113 ~i~h~di~p~nili~~------------------------~~~~~l~d~g~~~  141 (251)
T cd05041         113 NCIHRDLAARNCLVGE------------------------NNVLKISDFGMSR  141 (251)
T ss_pred             CEehhhcCcceEEEcC------------------------CCcEEEeeccccc
Confidence            5799999999999975                        3568888886654


No 223
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=93.57  E-value=0.068  Score=41.28  Aligned_cols=32  Identities=28%  Similarity=0.335  Sum_probs=26.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      .++|+|+.+.||++.+                        .+.++++||..+..-.
T Consensus       107 ~i~h~~i~~~ni~~~~------------------------~~~~~l~d~~~~~~~~  138 (244)
T smart00220      107 GIIHRDLKPENILLDE------------------------DGHVKLADFGLARQLD  138 (244)
T ss_pred             CeecCCcCHHHeEECC------------------------CCcEEEccccceeeec
Confidence            6899999999999986                        3578889988766543


No 224
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=93.57  E-value=0.078  Score=40.81  Aligned_cols=32  Identities=25%  Similarity=0.314  Sum_probs=27.1

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      .++|+|+++.||+++.                        ...++++||+.+....
T Consensus       118 ~i~h~di~~~ni~v~~------------------------~~~~~l~d~g~~~~~~  149 (225)
T smart00221      118 GIVHRDLKPENILLGM------------------------DGLVKLADFGLARFIH  149 (225)
T ss_pred             CeecCCCCHHHEEEcC------------------------CCCEEEeeCceeeEec
Confidence            7899999999999986                        3689999998776543


No 225
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=93.56  E-value=0.13  Score=42.05  Aligned_cols=17  Identities=35%  Similarity=0.640  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       129 ~~i~H~dlkp~Nili~~  145 (292)
T cd06644         129 MKIIHRDLKAGNVLLTL  145 (292)
T ss_pred             CCeeecCCCcceEEEcC
Confidence            46889999999999975


No 226
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=93.55  E-value=0.085  Score=42.46  Aligned_cols=17  Identities=35%  Similarity=0.632  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       125 ~~i~H~di~p~nili~~  141 (266)
T cd05033         125 MNYVHRDLAARNILVNS  141 (266)
T ss_pred             CCcccCCCCcceEEEcC
Confidence            35899999999999976


No 227
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=93.53  E-value=0.1  Score=42.73  Aligned_cols=17  Identities=41%  Similarity=0.532  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|++|.|||+..
T Consensus       139 ~~i~H~dlkp~Nili~~  155 (288)
T cd05093         139 QHFVHRDLATRNCLVGE  155 (288)
T ss_pred             CCeeecccCcceEEEcc
Confidence            35899999999999976


No 228
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=93.53  E-value=0.1  Score=41.49  Aligned_cols=30  Identities=30%  Similarity=0.437  Sum_probs=23.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||++.||+++.                        .+.++|+||..+.
T Consensus       120 ~~i~h~dl~p~ni~i~~------------------------~~~~~l~d~g~~~  149 (262)
T cd06613         120 TGKIHRDIKGANILLTE------------------------DGDVKLADFGVSA  149 (262)
T ss_pred             CCceecCCChhhEEECC------------------------CCCEEECccccch
Confidence            35899999999999986                        3567888887654


No 229
>KOG0596|consensus
Probab=93.53  E-value=0.11  Score=48.46  Aligned_cols=41  Identities=24%  Similarity=0.276  Sum_probs=29.6

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHH
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVE   94 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E   94 (174)
                      -.+.|.||+|.|+|+-.                         +.|+||||--|.  -..-|-.|...|
T Consensus       479 ~gIVHSDLKPANFLlVk-------------------------G~LKLIDFGIA~--aI~~DTTsI~kd  519 (677)
T KOG0596|consen  479 HGIVHSDLKPANFLLVK-------------------------GRLKLIDFGIAN--AIQPDTTSIVKD  519 (677)
T ss_pred             hceeecCCCcccEEEEe-------------------------eeEEeeeechhc--ccCccccceeec
Confidence            45899999999999976                         799999996443  233344444444


No 230
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=93.52  E-value=0.096  Score=43.07  Aligned_cols=16  Identities=38%  Similarity=0.563  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       150 ~i~H~dlkp~Nili~~  165 (296)
T cd05095         150 NFVHRDLATRNCLVGK  165 (296)
T ss_pred             CeecccCChheEEEcC
Confidence            4899999999999975


No 231
>COG2187 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=93.51  E-value=1.4  Score=38.24  Aligned_cols=68  Identities=21%  Similarity=0.249  Sum_probs=48.1

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeee----cccCccchhhHHHHHHHHhhhc
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFE----YCSYNYRAFDIANHFVESVYDY   99 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfE----Ya~~n~~~fDlan~f~E~~~dy   99 (174)
                      ...++=||+||+.+||.+-+                         +++.|.|.-    --.+.++.+|+|-..++.-   
T Consensus       206 ~g~IRecHGDLhl~ni~l~d-------------------------g~~~LFDCIEFNd~fr~iDv~~D~AFl~MDLe---  257 (337)
T COG2187         206 EGFIRECHGDLHLRNICLWD-------------------------GEPALFDCIEFNDPFRFIDVLYDLAFLAMDLE---  257 (337)
T ss_pred             cCCceecccchhhcceeeec-------------------------CcceEEEEeecCCcchHHHHHHHHHHHHhhHh---
Confidence            46789999999999999986                         677888862    2334566677776665432   


Q ss_pred             cCCCCCcccccCCCCCCHHHHHHHHHHHHhccC
Q psy15664        100 SYKHFPHYTVKRENYPSYSLRKSFVETYLSRMN  132 (174)
Q Consensus       100 ~~~~~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~  132 (174)
                                   ..-.++.-..|+..|+.+.+
T Consensus       258 -------------~~gr~dla~~~ln~Yl~~tg  277 (337)
T COG2187         258 -------------FRGRKDLARRFLNTYLEETG  277 (337)
T ss_pred             -------------hcCChHHHHHHHHHHHHHhC
Confidence                         12245667889999997754


No 232
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=93.49  E-value=0.085  Score=45.52  Aligned_cols=30  Identities=30%  Similarity=0.596  Sum_probs=25.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||+|.|||++.                        .+.++|+||..+.
T Consensus       120 ~givHrDlKp~Nili~~------------------------~~~~kL~DFGl~~  149 (381)
T cd05626         120 MGFIHRDIKPDNILIDL------------------------DGHIKLTDFGLCT  149 (381)
T ss_pred             CCeeecCCcHHHEEECC------------------------CCCEEEeeCcCCc
Confidence            35899999999999975                        4679999998763


No 233
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=93.49  E-value=0.084  Score=42.23  Aligned_cols=30  Identities=33%  Similarity=0.439  Sum_probs=24.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+|+++.||++..                        +..++++||+++..
T Consensus       120 ~i~H~dl~p~ni~i~~------------------------~~~~kl~d~g~~~~  149 (256)
T cd05114         120 SFIHRDLAARNCLVSS------------------------TGVVKVSDFGMTRY  149 (256)
T ss_pred             CccccccCcceEEEcC------------------------CCeEEECCCCCccc
Confidence            4899999999999975                        35688888887653


No 234
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=93.49  E-value=0.11  Score=42.33  Aligned_cols=16  Identities=31%  Similarity=0.571  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.|||+..
T Consensus       129 ~iiH~dlkp~nili~~  144 (279)
T cd05111         129 RMVHRNLAARNILLKS  144 (279)
T ss_pred             CEeccccCcceEEEcC
Confidence            3899999999999975


No 235
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=93.45  E-value=0.079  Score=42.34  Aligned_cols=30  Identities=27%  Similarity=0.440  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+||++.||+++.                        ++.++++||+.+..
T Consensus       120 ~i~h~dl~~~nil~~~------------------------~~~~~l~d~~~~~~  149 (258)
T cd05578         120 GIIHRDIKPDNILLDE------------------------QGHVHITDFNIATK  149 (258)
T ss_pred             CeeccCCCHHHeEEcC------------------------CCCEEEeecccccc
Confidence            5899999999999976                        46788899887654


No 236
>KOG0603|consensus
Probab=93.42  E-value=0.12  Score=48.33  Aligned_cols=36  Identities=31%  Similarity=0.349  Sum_probs=29.1

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA   85 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~   85 (174)
                      ..+.|+||+|+|||+.+                       +.+.|+++||=++....+.
T Consensus       434 ~gvvhRDLkp~NIL~~~-----------------------~~g~lrltyFG~a~~~~~~  469 (612)
T KOG0603|consen  434 QGVVHRDLKPGNILLDG-----------------------SAGHLRLTYFGFWSELERS  469 (612)
T ss_pred             cCeeecCCChhheeecC-----------------------CCCcEEEEEechhhhCchh
Confidence            56889999999999963                       2467999999888776665


No 237
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=93.42  E-value=0.091  Score=42.24  Aligned_cols=16  Identities=31%  Similarity=0.528  Sum_probs=14.3

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       126 ~i~H~dl~p~nil~~~  141 (265)
T cd06652         126 MIVHRDIKGANILRDS  141 (265)
T ss_pred             CEecCCCCHHHEEecC
Confidence            3789999999999975


No 238
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=93.41  E-value=0.11  Score=41.28  Aligned_cols=17  Identities=24%  Similarity=0.335  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.|||+..
T Consensus       120 ~~i~H~dlkp~Nill~~  136 (259)
T cd05037         120 KKLVHGNVCGKNILVAR  136 (259)
T ss_pred             CCeecccCccceEEEec
Confidence            35899999999999986


No 239
>KOG3087|consensus
Probab=93.37  E-value=0.37  Score=39.64  Aligned_cols=83  Identities=29%  Similarity=0.370  Sum_probs=49.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc----cchhhHHHHHHHHhhhccCCC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN----YRAFDIANHFVESVYDYSYKH  103 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n----~~~fDlan~f~E~~~dy~~~~  103 (174)
                      -+||+||-..|||+..+.                     ++-.+.+|||=.+..+    +.+.||  +..|-+.-.++++
T Consensus       133 diiHGDLTTSNill~~~~---------------------~~~~~~lIdfgls~~s~~~EDKgVDL--YVlErA~lsTh~~  189 (229)
T KOG3087|consen  133 DIIHGDLTTSNILLRSDG---------------------NQITPILIDFGLSSVSRLPEDKGVDL--YVLERAVLSTHDK  189 (229)
T ss_pred             CeecccccccceEEecCC---------------------CcCceEEEeecchhcccCccccccee--eeehHhHhccCcc
Confidence            599999999999998632                     2244699999887665    445555  2223332222211


Q ss_pred             CCcccccCCCCCCHHHHHHHHHHHHhccCCCCCcHHHHHHHHH
Q psy15664        104 FPHYTVKRENYPSYSLRKSFVETYLSRMNQEDSTPESVLEEVK  146 (174)
Q Consensus       104 ~p~~~~~~~~~p~~~~~~~fl~~Yl~~~~~~~~~v~~l~~~v~  146 (174)
                                  .......|+..|-..-++ ...|.+=+++|+
T Consensus       190 ------------~~~~fe~~~~~Y~~~~K~-~~avlkk~eeVR  219 (229)
T KOG3087|consen  190 ------------KALLFEGFLEGYRASGKQ-SKAVLKKLEEVR  219 (229)
T ss_pred             ------------cHHHHHHHHHHHHhcchh-hHHHHHHHHHHh
Confidence                        233568899999844332 234444455554


No 240
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=93.36  E-value=0.11  Score=42.04  Aligned_cols=16  Identities=44%  Similarity=0.598  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       144 ~i~H~dlkp~Nil~~~  159 (283)
T cd05048         144 HFVHRDLAARNCLVGE  159 (283)
T ss_pred             CeeccccccceEEEcC
Confidence            4899999999999976


No 241
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=93.34  E-value=0.085  Score=44.41  Aligned_cols=17  Identities=18%  Similarity=0.237  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|+++.|||++.
T Consensus       120 ~~ivHrDikp~Nill~~  136 (323)
T cd05615         120 RGIIYRDLKLDNVMLDS  136 (323)
T ss_pred             CCeeccCCCHHHeEECC
Confidence            35899999999999976


No 242
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=93.33  E-value=0.091  Score=41.60  Aligned_cols=31  Identities=32%  Similarity=0.398  Sum_probs=25.0

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+|+++.||++..                        ++.++++||..+..
T Consensus       112 ~~i~H~di~~~nil~~~------------------------~~~~~l~dfg~~~~  142 (265)
T cd05579         112 NGIIHRDLKPDNILIDS------------------------NGHLKLTDFGLSKV  142 (265)
T ss_pred             cCeecCCCCHHHeEEcC------------------------CCCEEEEecccchh
Confidence            45899999999999986                        35788899876543


No 243
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=93.32  E-value=0.091  Score=43.49  Aligned_cols=29  Identities=24%  Similarity=0.381  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        .+.++++||..+.
T Consensus       121 ~i~H~dl~p~NIll~~------------------------~~~~~l~dfg~~~  149 (305)
T cd05609         121 GIVHRDLKPDNLLITS------------------------MGHIKLTDFGLSK  149 (305)
T ss_pred             CccccCCchHHEEECC------------------------CCCEEEeeCCCcc
Confidence            5899999999999975                        3567888887654


No 244
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=93.32  E-value=0.13  Score=41.40  Aligned_cols=30  Identities=27%  Similarity=0.332  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+||++.||++..                        .+.++|+||.++..
T Consensus       118 ~i~H~dl~p~nili~~------------------------~~~~~l~df~~~~~  147 (283)
T cd05118         118 GILHRDLKPENLLINT------------------------EGVLKLADFGLARS  147 (283)
T ss_pred             CeeecCcCHHHEEECC------------------------CCcEEEeeeeeeEe
Confidence            4899999999999975                        36789999987643


No 245
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=93.32  E-value=0.047  Score=50.36  Aligned_cols=31  Identities=35%  Similarity=0.540  Sum_probs=26.0

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      -.|-|.|+|||||++..                        ++++.++||=-.|.
T Consensus       284 dgffHaDpHpGNi~v~~------------------------~g~i~~lDfGi~g~  314 (517)
T COG0661         284 DGFFHADPHPGNILVRS------------------------DGRIVLLDFGIVGR  314 (517)
T ss_pred             cCccccCCCccceEEec------------------------CCcEEEEcCcceec
Confidence            46999999999999986                        47899999965554


No 246
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=93.30  E-value=0.09  Score=45.38  Aligned_cols=16  Identities=31%  Similarity=0.623  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||++.
T Consensus       162 ~ivHrDLkp~NILl~~  177 (370)
T cd05596         162 GFIHRDVKPDNMLLDK  177 (370)
T ss_pred             CeeccCCCHHHEEEcC
Confidence            4899999999999975


No 247
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=93.29  E-value=0.078  Score=43.87  Aligned_cols=16  Identities=31%  Similarity=0.538  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||++..
T Consensus       128 ~i~H~dl~p~nil~~~  143 (309)
T cd07845         128 FIIHRDLKVSNLLLTD  143 (309)
T ss_pred             CeecCCCCHHHEEECC
Confidence            4899999999999976


No 248
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=93.29  E-value=0.12  Score=42.06  Aligned_cols=16  Identities=31%  Similarity=0.490  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       130 ~i~H~dl~~~nil~~~  145 (295)
T cd07837         130 GVMHRDLKPQNLLVDK  145 (295)
T ss_pred             CeeecCCChHHEEEec
Confidence            5899999999999975


No 249
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=93.28  E-value=0.093  Score=41.79  Aligned_cols=31  Identities=19%  Similarity=0.210  Sum_probs=24.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+|+++.||++..                        .+.++++||..+..
T Consensus       120 ~~i~h~dl~p~ni~~~~------------------------~~~~kl~d~~~~~~  150 (256)
T cd08221         120 AGILHRDIKTLNIFLTK------------------------AGLIKLGDFGISKI  150 (256)
T ss_pred             CCccccCCChHhEEEeC------------------------CCCEEECcCcceEE
Confidence            34789999999999986                        35678888876543


No 250
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=93.27  E-value=0.16  Score=41.46  Aligned_cols=17  Identities=18%  Similarity=0.427  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|+++.||++..
T Consensus       114 ~~ivH~dikp~Nili~~  130 (277)
T cd05607         114 MDIVYRDMKPENVLLDD  130 (277)
T ss_pred             CCEEEccCChHhEEEcC
Confidence            35899999999999976


No 251
>PHA03211 serine/threonine kinase US3; Provisional
Probab=93.26  E-value=0.093  Score=47.39  Aligned_cols=16  Identities=25%  Similarity=0.470  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||+..
T Consensus       280 gIvHrDLKP~NILl~~  295 (461)
T PHA03211        280 GIIHRDIKTENVLVNG  295 (461)
T ss_pred             CEEECcCCHHHEEECC
Confidence            4889999999999975


No 252
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=93.23  E-value=0.12  Score=41.56  Aligned_cols=17  Identities=35%  Similarity=0.522  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|++|.||+++.
T Consensus       138 ~~i~H~di~p~nill~~  154 (277)
T cd05032         138 KKFVHRDLAARNCMVAE  154 (277)
T ss_pred             CCccccccChheEEEcC
Confidence            35799999999999986


No 253
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=93.23  E-value=0.091  Score=42.76  Aligned_cols=16  Identities=25%  Similarity=0.524  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||++..
T Consensus       120 ~i~H~dlkp~Nill~~  135 (287)
T cd07848         120 DIVHRDIKPENLLISH  135 (287)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            4799999999999975


No 254
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=93.21  E-value=0.092  Score=42.86  Aligned_cols=16  Identities=38%  Similarity=0.563  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.||++..
T Consensus       150 ~i~H~dlkp~Nili~~  165 (296)
T cd05051         150 NFVHRDLATRNCLVGK  165 (296)
T ss_pred             CccccccchhceeecC
Confidence            4789999999999986


No 255
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=93.21  E-value=0.12  Score=42.54  Aligned_cols=17  Identities=35%  Similarity=0.559  Sum_probs=14.8

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|++|.|||++.
T Consensus       148 ~~i~H~dlkp~Nill~~  164 (295)
T cd05097         148 LNFVHRDLATRNCLVGN  164 (295)
T ss_pred             cCeeccccChhhEEEcC
Confidence            35789999999999975


No 256
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=93.20  E-value=0.13  Score=41.41  Aligned_cols=16  Identities=38%  Similarity=0.648  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+||++.|||+..
T Consensus       115 ~i~H~dlkp~nil~~~  130 (257)
T cd05115         115 NFVHRDLAARNVLLVN  130 (257)
T ss_pred             CeeecccchheEEEcC
Confidence            5899999999999975


No 257
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=93.20  E-value=0.094  Score=43.05  Aligned_cols=16  Identities=31%  Similarity=0.459  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       122 ~ivH~dlkp~Nil~~~  137 (285)
T cd05605         122 RIVYRDLKPENILLDD  137 (285)
T ss_pred             CcEecCCCHHHEEECC
Confidence            5899999999999976


No 258
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=93.14  E-value=0.11  Score=41.51  Aligned_cols=29  Identities=34%  Similarity=0.417  Sum_probs=23.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        .+.++++||..+.
T Consensus       120 ~i~H~dl~p~ni~i~~------------------------~~~~kl~dfg~~~  148 (256)
T cd05059         120 GFIHRDLAARNCLVGE------------------------DNVVKVSDFGLAR  148 (256)
T ss_pred             CcccccccHhhEEECC------------------------CCcEEECCcccce
Confidence            4799999999999976                        3567888887654


No 259
>KOG1163|consensus
Probab=93.14  E-value=0.11  Score=44.27  Aligned_cols=32  Identities=28%  Similarity=0.426  Sum_probs=25.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      ..|.|+|++|.|+|..-+-.                     ..++.+|||-.|
T Consensus       130 r~fiHRDIKPdNFLMGlgrh---------------------~~kl~LIDFGLa  161 (341)
T KOG1163|consen  130 RNFIHRDIKPDNFLMGLGRH---------------------CNKLYLIDFGLA  161 (341)
T ss_pred             hccccccCCccceeeccccc---------------------cceEEEEeccch
Confidence            47999999999999875322                     368999999654


No 260
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=93.13  E-value=0.16  Score=41.29  Aligned_cols=30  Identities=23%  Similarity=0.391  Sum_probs=24.0

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||++..                        .+.++++||..+.
T Consensus       120 ~~i~h~dl~p~Ni~i~~------------------------~~~~~l~dfg~~~  149 (277)
T cd06641         120 EKKIHRDIKAANVLLSE------------------------HGEVKLADFGVAG  149 (277)
T ss_pred             CCeecCCCCHHhEEECC------------------------CCCEEEeecccce
Confidence            46899999999999975                        3568888887653


No 261
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=93.12  E-value=0.12  Score=41.38  Aligned_cols=30  Identities=13%  Similarity=0.163  Sum_probs=23.8

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||++.||++..                        .+.+.++||..+.
T Consensus       125 ~~i~H~dl~~~nil~~~------------------------~~~~~l~d~g~~~  154 (267)
T cd08228         125 RRVMHRDIKPANVFITA------------------------TGVVKLGDLGLGR  154 (267)
T ss_pred             CCeeCCCCCHHHEEEcC------------------------CCCEEECccccce
Confidence            35899999999999975                        3567888887654


No 262
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=93.11  E-value=0.13  Score=43.70  Aligned_cols=16  Identities=44%  Similarity=0.567  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       193 ~ivHrDikp~Nill~~  208 (337)
T cd05054         193 KCIHRDLAARNILLSE  208 (337)
T ss_pred             CeecCCCCcceEEEeC
Confidence            5899999999999985


No 263
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=93.10  E-value=0.12  Score=41.30  Aligned_cols=16  Identities=44%  Similarity=0.709  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.||++..
T Consensus       133 ~i~H~dlkp~Nil~~~  148 (273)
T cd05035         133 NFIHRDLAARNCMLRE  148 (273)
T ss_pred             CeeccccchheEEECC
Confidence            5799999999999975


No 264
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=93.07  E-value=0.11  Score=41.60  Aligned_cols=34  Identities=26%  Similarity=0.337  Sum_probs=24.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||+++.+...                   ....++++||.++.
T Consensus       126 ~i~H~dl~p~nil~~~~~~~-------------------~~~~~~l~dfg~~~  159 (269)
T cd05044         126 HFIHRDLAARNCLVSEKGYD-------------------ADRVVKIGDFGLAR  159 (269)
T ss_pred             CcccCCCChheEEEecCCCC-------------------CCcceEECCccccc
Confidence            47999999999999863211                   12368888987764


No 265
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=93.06  E-value=0.077  Score=43.88  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||++.
T Consensus       136 gi~H~dLkp~Nill~~  151 (296)
T cd06654         136 QVIHRDIKSDNILLGM  151 (296)
T ss_pred             CcccCCCCHHHEEEcC
Confidence            4899999999999975


No 266
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=93.06  E-value=0.12  Score=42.33  Aligned_cols=17  Identities=24%  Similarity=0.411  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       134 ~~i~H~dl~p~Nil~~~  150 (285)
T cd06648         134 QGVIHRDIKSDSILLTS  150 (285)
T ss_pred             CCeecCCCChhhEEEcC
Confidence            35899999999999975


No 267
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=93.06  E-value=0.12  Score=41.48  Aligned_cols=31  Identities=23%  Similarity=0.327  Sum_probs=24.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+|+++.||++..                        ++.++|+||..+..
T Consensus       112 ~~~~h~dl~~~nilv~~------------------------~~~~~l~df~~~~~  142 (262)
T cd05572         112 RGIIYRDLKPENLLLDS------------------------NGYVKLVDFGFAKK  142 (262)
T ss_pred             CCcccCCCCHHHEEEcC------------------------CCCEEEeeCCcccc
Confidence            45899999999999975                        35678888777653


No 268
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=93.05  E-value=0.14  Score=41.72  Aligned_cols=30  Identities=27%  Similarity=0.614  Sum_probs=23.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..+                       .+.++++||..+.
T Consensus       129 ~i~H~dl~p~nil~~~~-----------------------~~~~~l~dfg~~~  158 (267)
T PHA03390        129 NIIHNDIKLENVLYDRA-----------------------KDRIYLCDYGLCK  158 (267)
T ss_pred             CeeeCCCCHHHEEEeCC-----------------------CCeEEEecCccce
Confidence            48999999999999862                       2368889987653


No 269
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=93.04  E-value=0.11  Score=41.66  Aligned_cols=16  Identities=25%  Similarity=0.495  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       123 ~i~H~~i~~~nil~~~  138 (268)
T cd06630         123 QIIHRDVKGANLLIDS  138 (268)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            5899999999999965


No 270
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=93.04  E-value=0.11  Score=41.26  Aligned_cols=17  Identities=35%  Similarity=0.483  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       120 ~~i~h~dl~~~nil~~~  136 (256)
T cd08220         120 KLILHRDLKTQNILLDK  136 (256)
T ss_pred             CCeecCCCCHHHEEEcC
Confidence            35899999999999975


No 271
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=93.02  E-value=0.099  Score=42.34  Aligned_cols=16  Identities=31%  Similarity=0.499  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       121 ~i~H~dl~p~nil~~~  136 (285)
T cd07861         121 RVLHRDLKPQNLLIDN  136 (285)
T ss_pred             CeeecCCCHHHEEEcC
Confidence            5899999999999975


No 272
>PHA03210 serine/threonine kinase US3; Provisional
Probab=93.02  E-value=0.12  Score=46.90  Aligned_cols=28  Identities=25%  Similarity=0.370  Sum_probs=23.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .++|+||++.|||++.                        ++.++|+||-.+
T Consensus       287 gIiHrDLKP~NILl~~------------------------~~~vkL~DFGla  314 (501)
T PHA03210        287 KLIHRDIKLENIFLNC------------------------DGKIVLGDFGTA  314 (501)
T ss_pred             CeecCCCCHHHEEECC------------------------CCCEEEEeCCCc
Confidence            5899999999999975                        356888888665


No 273
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=93.00  E-value=0.12  Score=41.76  Aligned_cols=17  Identities=29%  Similarity=0.427  Sum_probs=14.6

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|+++.||++..
T Consensus       119 ~~i~H~dl~p~nil~~~  135 (286)
T cd07847         119 HNCIHRDVKPENILITK  135 (286)
T ss_pred             CCceecCCChhhEEEcC
Confidence            34689999999999975


No 274
>COG3231 Aph Aminoglycoside phosphotransferase [Translation, ribosomal structure and biogenesis]
Probab=92.98  E-value=0.31  Score=40.98  Aligned_cols=66  Identities=15%  Similarity=0.072  Sum_probs=51.0

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHHHHHhhhccCCCC
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF  104 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~  104 (174)
                      ..+|+||+|--.-|+|+.+                        ..---+||+.-.|-++|.-|||--.-...++      
T Consensus       183 edLVv~HGDACLPN~i~d~------------------------~rf~GfIDlGrlGVaDRh~DLala~~s~~~n------  232 (266)
T COG3231         183 EDLVVTHGDACLPNFILDG------------------------WRFSGFIDLGRLGVADRHQDLALATWSLRFN------  232 (266)
T ss_pred             hhceeecCcccCcceEecC------------------------CceEEeeecCcccchHHHHhHHHHHHHHHhc------
Confidence            4689999999999999986                        2345699999999999999998765443321      


Q ss_pred             CcccccCCCCCCHHHHHHHHHHHHh
Q psy15664        105 PHYTVKRENYPSYSLRKSFVETYLS  129 (174)
Q Consensus       105 p~~~~~~~~~p~~~~~~~fl~~Yl~  129 (174)
                               ++...-...|+..|..
T Consensus       233 ---------l~g~~~~~~fl~~Yg~  248 (266)
T COG3231         233 ---------LGGDVWDDPFLDAYGR  248 (266)
T ss_pred             ---------cCcchhhHHHHHHhCc
Confidence                     2345556789999984


No 275
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=92.98  E-value=0.12  Score=42.02  Aligned_cols=16  Identities=38%  Similarity=0.623  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       128 ~i~H~dlkp~nili~~  143 (284)
T cd05081         128 RYVHRDLATRNILVES  143 (284)
T ss_pred             CceeccCCHhhEEECC
Confidence            5899999999999975


No 276
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=92.98  E-value=0.12  Score=41.94  Aligned_cols=29  Identities=24%  Similarity=0.429  Sum_probs=23.9

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||+++.                        ++.++|+||..+.
T Consensus       120 ~i~h~~l~p~ni~~~~------------------------~~~~~l~dfg~~~  148 (286)
T cd07846         120 NIIHRDIKPENILVSQ------------------------SGVVKLCDFGFAR  148 (286)
T ss_pred             CccccCCCHHHEEECC------------------------CCcEEEEeeeeee
Confidence            5899999999999975                        3568888887654


No 277
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=92.97  E-value=0.14  Score=41.22  Aligned_cols=17  Identities=29%  Similarity=0.540  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.|||+..
T Consensus       126 ~~~~H~dl~p~nili~~  142 (270)
T cd05056         126 KRFVHRDIAARNVLVSS  142 (270)
T ss_pred             CCeeccccChheEEEec
Confidence            35899999999999976


No 278
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=92.96  E-value=0.088  Score=43.61  Aligned_cols=16  Identities=25%  Similarity=0.470  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||+++.
T Consensus       135 ~i~H~dL~p~Nili~~  150 (296)
T cd06655         135 QVIHRDIKSDNVLLGM  150 (296)
T ss_pred             CcccCCCCHHHEEECC
Confidence            4789999999999975


No 279
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=92.93  E-value=0.13  Score=41.51  Aligned_cols=30  Identities=30%  Similarity=0.435  Sum_probs=24.8

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+|+++.||++..                        +..++|+||..+..
T Consensus       120 ~i~H~dl~~~ni~~~~------------------------~~~~kl~d~g~~~~  149 (288)
T cd07833         120 NIIHRDIKPENILVSE------------------------SGVLKLCDFGFARA  149 (288)
T ss_pred             CeecCCCCHHHeEECC------------------------CCCEEEEeeecccc
Confidence            4899999999999986                        36788899887654


No 280
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=92.91  E-value=0.16  Score=41.46  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       122 ~i~H~dl~p~nill~~  137 (294)
T PLN00009        122 RVLHRDLKPQNLLIDR  137 (294)
T ss_pred             CeeCCCCCcceEEEEC
Confidence            4899999999999975


No 281
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=92.89  E-value=0.11  Score=42.96  Aligned_cols=28  Identities=25%  Similarity=0.577  Sum_probs=22.9

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .+.|+|+++.||++.+                        ++.++|+||..+
T Consensus       138 ~ivH~dlkp~Nill~~------------------------~~~~kL~dfg~~  165 (292)
T cd06658         138 GVIHRDIKSDSILLTS------------------------DGRIKLSDFGFC  165 (292)
T ss_pred             CEeecCCCHHHEEEcC------------------------CCCEEEccCcch
Confidence            4789999999999975                        356888888765


No 282
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=92.89  E-value=0.12  Score=41.37  Aligned_cols=16  Identities=38%  Similarity=0.723  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.||++..
T Consensus       123 ~i~H~dl~p~nili~~  138 (261)
T cd05072         123 NYIHRDLRAANVLVSE  138 (261)
T ss_pred             CeeccccchhhEEecC
Confidence            4799999999999986


No 283
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=92.89  E-value=0.1  Score=44.34  Aligned_cols=16  Identities=31%  Similarity=0.555  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       138 gi~H~dlkp~Nil~~~  153 (353)
T cd07850         138 GIIHRDLKPSNIVVKS  153 (353)
T ss_pred             CeeeCCCCHHHEEECC
Confidence            5899999999999976


No 284
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=92.87  E-value=0.14  Score=41.11  Aligned_cols=16  Identities=38%  Similarity=0.617  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.||++..
T Consensus       133 ~i~H~dikp~nili~~  148 (273)
T cd05074         133 NFIHRDLAARNCMLNE  148 (273)
T ss_pred             CEeecccchhhEEEcC
Confidence            5899999999999975


No 285
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=92.85  E-value=0.12  Score=41.84  Aligned_cols=16  Identities=31%  Similarity=0.517  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       120 ~i~h~dl~p~ni~~~~  135 (284)
T cd07836         120 RVLHRDLKPQNLLINK  135 (284)
T ss_pred             CeeeCCCCHHHEEECC
Confidence            5899999999999975


No 286
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=92.85  E-value=0.11  Score=42.38  Aligned_cols=17  Identities=41%  Similarity=0.530  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       149 ~~i~H~dl~p~nil~~~  165 (288)
T cd05050         149 RKFVHRDLATRNCLVGE  165 (288)
T ss_pred             CCeecccccHhheEecC
Confidence            36999999999999975


No 287
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=92.82  E-value=0.092  Score=43.49  Aligned_cols=17  Identities=35%  Similarity=0.462  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       159 ~gi~H~dlkp~Nill~~  175 (307)
T cd05098         159 KKCIHRDLAARNVLVTE  175 (307)
T ss_pred             CCcccccccHHheEEcC
Confidence            36899999999999975


No 288
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=92.78  E-value=0.12  Score=43.37  Aligned_cols=16  Identities=31%  Similarity=0.353  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       116 ~ivHrdikp~Nil~~~  131 (316)
T cd05619         116 GIVYRDLKLDNILLDT  131 (316)
T ss_pred             CeEeCCCCHHHEEECC
Confidence            5899999999999976


No 289
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=92.78  E-value=0.19  Score=42.68  Aligned_cols=30  Identities=33%  Similarity=0.408  Sum_probs=24.2

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..+.|+|++|.|||+..                        ...++++||..+.
T Consensus       198 ~~i~H~dikp~Nil~~~------------------------~~~~kl~dfg~~~  227 (343)
T cd05103         198 RKCIHRDLAARNILLSE------------------------NNVVKICDFGLAR  227 (343)
T ss_pred             CCeecCCCccCeEEEcC------------------------CCcEEEEeccccc
Confidence            36899999999999975                        3568888887654


No 290
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=92.75  E-value=0.17  Score=41.07  Aligned_cols=29  Identities=34%  Similarity=0.604  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .+.|+||++.|||+..                        .+.++++||..+.
T Consensus       123 ~i~H~dlkp~nili~~------------------------~~~~kl~dfg~~~  151 (282)
T cd06643         123 KIIHRDLKAGNILFTL------------------------DGDIKLADFGVSA  151 (282)
T ss_pred             CeeecCCCcccEEEcc------------------------CCCEEEccccccc
Confidence            5899999999999975                        3568888887654


No 291
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=92.74  E-value=0.11  Score=41.67  Aligned_cols=16  Identities=31%  Similarity=0.501  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||++..
T Consensus       126 ~i~H~dlkp~nili~~  141 (267)
T cd06645         126 GKMHRDIKGANILLTD  141 (267)
T ss_pred             CeecCCCCHHHEEECC
Confidence            4899999999999975


No 292
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=92.73  E-value=0.17  Score=41.11  Aligned_cols=16  Identities=31%  Similarity=0.453  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       136 ~ivH~dlkp~nil~~~  151 (277)
T cd05036         136 HFIHRDIAARNCLLTC  151 (277)
T ss_pred             CEeecccchheEEEec
Confidence            4899999999999976


No 293
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=92.73  E-value=0.19  Score=40.42  Aligned_cols=16  Identities=25%  Similarity=0.534  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       128 ~i~h~dl~p~nil~~~  143 (268)
T cd06624         128 QIVHRDIKGDNVLVNT  143 (268)
T ss_pred             CEeecCCCHHHEEEcC
Confidence            5899999999999975


No 294
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=92.72  E-value=0.2  Score=40.40  Aligned_cols=16  Identities=38%  Similarity=0.511  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       120 ~i~H~dlkp~nil~~~  135 (269)
T cd05087         120 NFIHSDLALRNCLLTA  135 (269)
T ss_pred             CEeccccCcceEEEcC
Confidence            5899999999999976


No 295
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=92.71  E-value=0.11  Score=42.28  Aligned_cols=16  Identities=38%  Similarity=0.557  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       123 ~i~H~dl~p~nil~~~  138 (291)
T cd07844         123 RVLHRDLKPQNLLISE  138 (291)
T ss_pred             CeecccCCHHHEEEcC
Confidence            4899999999999976


No 296
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=92.69  E-value=0.18  Score=43.66  Aligned_cols=16  Identities=25%  Similarity=0.493  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||+++
T Consensus       232 giiHrDLkp~Nil~~~  247 (374)
T cd05106         232 NCIHRDVAARNVLLTD  247 (374)
T ss_pred             CEEeccCchheEEEeC
Confidence            4799999999999975


No 297
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=92.67  E-value=0.16  Score=40.70  Aligned_cols=17  Identities=41%  Similarity=0.665  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       121 ~~i~H~dl~p~ni~i~~  137 (260)
T cd05067         121 KNYIHRDLRAANILVSE  137 (260)
T ss_pred             CCeecccccHHhEEEcC
Confidence            35799999999999986


No 298
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=92.66  E-value=0.14  Score=41.58  Aligned_cols=16  Identities=50%  Similarity=0.683  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       144 ~i~H~dlkp~nili~~  159 (283)
T cd05090         144 FFVHKDLAARNILIGE  159 (283)
T ss_pred             CeehhccccceEEEcC
Confidence            4899999999999976


No 299
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=92.63  E-value=0.11  Score=42.28  Aligned_cols=16  Identities=25%  Similarity=0.441  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       115 ~i~H~di~p~Nil~~~  130 (277)
T cd05577         115 RIVYRDLKPENVLLDD  130 (277)
T ss_pred             CcccCCCCHHHEEECC
Confidence            5789999999999976


No 300
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=92.61  E-value=0.14  Score=41.18  Aligned_cols=16  Identities=38%  Similarity=0.638  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       127 ~i~H~dlkp~Nili~~  142 (268)
T cd05063         127 NYVHRDLAARNILVNS  142 (268)
T ss_pred             CeeccccchhhEEEcC
Confidence            4899999999999975


No 301
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=92.60  E-value=0.13  Score=41.34  Aligned_cols=16  Identities=31%  Similarity=0.501  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++++||++..
T Consensus       126 ~i~H~dl~p~nill~~  141 (267)
T cd06646         126 GKMHRDIKGANILLTD  141 (267)
T ss_pred             CccccCCCHHHEEECC
Confidence            5899999999999975


No 302
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=92.58  E-value=0.1  Score=41.99  Aligned_cols=29  Identities=28%  Similarity=0.559  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||+++.                        .+.++++||..+.
T Consensus       131 ~ivh~dl~~~nili~~------------------------~~~~~l~Dfg~~~  159 (272)
T cd06637         131 KVIHRDIKGQNVLLTE------------------------NAEVKLVDFGVSA  159 (272)
T ss_pred             CCccCCCCHHHEEECC------------------------CCCEEEccCCCce
Confidence            4899999999999986                        3567888887654


No 303
>KOG0588|consensus
Probab=92.58  E-value=0.092  Score=49.80  Aligned_cols=49  Identities=22%  Similarity=0.430  Sum_probs=35.9

Q ss_pred             HHHHHHHHHHhhc--CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         11 TEADWLKKHLLKI--KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        11 ~e~~~l~~~l~~~--~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      +.+.++++.+...  -...-+||+||++.|+|++.                        ++.|++=||-.|+.-.
T Consensus       113 eaa~ff~QIi~gv~yCH~~~icHRDLKpENlLLd~------------------------~~nIKIADFGMAsLe~  163 (786)
T KOG0588|consen  113 EAAHFFRQILDGVSYCHAFNICHRDLKPENLLLDV------------------------KNNIKIADFGMASLEV  163 (786)
T ss_pred             HHHHHHHHHHHHHHHHhhhcceeccCCchhhhhhc------------------------ccCEeeeccceeeccc
Confidence            4566677776532  24567999999999999987                        3559999997666533


No 304
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=92.57  E-value=0.11  Score=42.42  Aligned_cols=16  Identities=31%  Similarity=0.573  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       139 ~i~H~dl~p~nil~~~  154 (310)
T cd07865         139 KILHRDMKAANILITK  154 (310)
T ss_pred             CeeccCCCHHHEEECC
Confidence            5899999999999976


No 305
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=92.56  E-value=0.14  Score=41.08  Aligned_cols=17  Identities=35%  Similarity=0.589  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       121 ~~i~H~dl~p~ni~i~~  137 (260)
T cd05073         121 RNYIHRDLRAANILVSA  137 (260)
T ss_pred             CCccccccCcceEEEcC
Confidence            35799999999999976


No 306
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=92.55  E-value=0.14  Score=40.79  Aligned_cols=30  Identities=30%  Similarity=0.455  Sum_probs=24.3

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+||++.||++++                        ++.++|+||.++.
T Consensus       121 ~~i~h~~l~p~ni~~~~------------------------~~~~~l~df~~~~  150 (267)
T cd06610         121 NGQIHRDIKAGNILLGE------------------------DGSVKIADFGVSA  150 (267)
T ss_pred             CCeecCCCCHHhEEEcC------------------------CCCEEEcccchHH
Confidence            35899999999999986                        3568888887654


No 307
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=92.55  E-value=0.18  Score=41.77  Aligned_cols=16  Identities=31%  Similarity=0.590  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.|||+..
T Consensus       129 ~ivH~dikp~Nill~~  144 (303)
T cd05110         129 RLVHRDLAARNVLVKS  144 (303)
T ss_pred             CeeccccccceeeecC
Confidence            5799999999999975


No 308
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=92.55  E-value=0.18  Score=41.65  Aligned_cols=16  Identities=25%  Similarity=0.490  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       121 ~ivH~dlk~~Nili~~  136 (314)
T cd08216         121 GFIHRSVKASHILLSG  136 (314)
T ss_pred             CeecCCCCcceEEEec
Confidence            4899999999999986


No 309
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=92.53  E-value=0.13  Score=43.09  Aligned_cols=17  Identities=24%  Similarity=0.260  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+||++.|||++.
T Consensus       115 ~~ivH~dlkp~Nill~~  131 (318)
T cd05570         115 RGIIYRDLKLDNVLLDS  131 (318)
T ss_pred             CCeEccCCCHHHeEECC
Confidence            35899999999999976


No 310
>KOG0608|consensus
Probab=92.52  E-value=0.18  Score=48.13  Aligned_cols=32  Identities=28%  Similarity=0.584  Sum_probs=28.1

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++.|.|+|+++.|||++.                        ++-|+|-||-.|.
T Consensus       746 HkmGFIHRDiKPDNILIDr------------------------dGHIKLTDFGLCT  777 (1034)
T KOG0608|consen  746 HKMGFIHRDIKPDNILIDR------------------------DGHIKLTDFGLCT  777 (1034)
T ss_pred             HhccceecccCccceEEcc------------------------CCceeeeeccccc
Confidence            3578999999999999986                        5789999998885


No 311
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=92.50  E-value=0.13  Score=42.10  Aligned_cols=17  Identities=35%  Similarity=0.595  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|++|.|||+.+
T Consensus       146 ~~ivH~dikp~nill~~  162 (290)
T cd05045         146 MKLVHRDLAARNVLVAE  162 (290)
T ss_pred             CCeehhhhhhheEEEcC
Confidence            35899999999999976


No 312
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=92.50  E-value=0.14  Score=40.91  Aligned_cols=30  Identities=27%  Similarity=0.500  Sum_probs=24.1

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||+++.                        ++.++|+||..+.
T Consensus       132 ~~i~H~~l~p~ni~~~~------------------------~~~~~l~d~~~~~  161 (275)
T cd06608         132 NKVIHRDIKGQNILLTK------------------------NAEVKLVDFGVSA  161 (275)
T ss_pred             CCcccCCCCHHHEEEcc------------------------CCeEEECCCccce
Confidence            35899999999999986                        3568888887654


No 313
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=92.44  E-value=0.19  Score=41.98  Aligned_cols=16  Identities=44%  Similarity=0.794  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       141 gi~H~dl~p~nili~~  156 (313)
T cd06633         141 NMIHRDIKAGNILLTE  156 (313)
T ss_pred             CeecCCCChhhEEECC
Confidence            4899999999999975


No 314
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=92.42  E-value=0.13  Score=42.66  Aligned_cols=29  Identities=24%  Similarity=0.560  Sum_probs=23.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||+++.                        .+.+.++||..+.
T Consensus       136 givH~dl~p~Nilv~~------------------------~~~~~l~dfg~~~  164 (292)
T cd06657         136 GVIHRDIKSDSILLTH------------------------DGRVKLSDFGFCA  164 (292)
T ss_pred             CeecCCCCHHHEEECC------------------------CCCEEEcccccce
Confidence            4899999999999975                        3568888887653


No 315
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=92.40  E-value=0.19  Score=40.01  Aligned_cols=29  Identities=24%  Similarity=0.335  Sum_probs=23.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .+.|+|+++.||++..                        ++.++|+||..+.
T Consensus       124 ~i~H~dl~p~nilv~~------------------------~~~~~l~dfg~~~  152 (263)
T cd06625         124 MIVHRDIKGANILRDS------------------------AGNVKLGDFGASK  152 (263)
T ss_pred             CeecCCCCHHHEEEcC------------------------CCCEEEeecccce
Confidence            5789999999999975                        3568888887653


No 316
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=92.39  E-value=0.15  Score=48.12  Aligned_cols=30  Identities=23%  Similarity=0.382  Sum_probs=25.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+||++.|||+..                        .+.++|+||-.+..
T Consensus       124 gIiHrDLKP~NILl~~------------------------~g~vkL~DFGls~~  153 (669)
T cd05610         124 GIIHRDLKPDNMLISN------------------------EGHIKLTDFGLSKV  153 (669)
T ss_pred             CEEeCCccHHHEEEcC------------------------CCCEEEEeCCCCcc
Confidence            5899999999999975                        36799999988764


No 317
>KOG2345|consensus
Probab=92.39  E-value=0.26  Score=41.99  Aligned_cols=16  Identities=31%  Similarity=0.735  Sum_probs=14.9

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      -+.|+|++|+|||+++
T Consensus       149 ~yAH~DiKP~NILls~  164 (302)
T KOG2345|consen  149 PYAHRDIKPANILLSD  164 (302)
T ss_pred             cccccCCCcceeEecC
Confidence            5999999999999987


No 318
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=92.35  E-value=0.16  Score=40.61  Aligned_cols=16  Identities=25%  Similarity=0.503  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||++..
T Consensus       117 ~i~H~dl~p~nil~~~  132 (260)
T cd05611         117 GIIHRDIKPENLLIDQ  132 (260)
T ss_pred             CeecCCCCHHHeEECC
Confidence            5899999999999975


No 319
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=92.31  E-value=0.17  Score=41.65  Aligned_cols=30  Identities=20%  Similarity=0.276  Sum_probs=23.8

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||+++.                        .+.+.++||..+.
T Consensus       121 ~~iiH~dikp~Nil~~~------------------------~~~~~l~Dfg~~~  150 (285)
T cd05630         121 ERIVYRDLKPENILLDD------------------------HGHIRISDLGLAV  150 (285)
T ss_pred             CCEEeCCCCHHHEEECC------------------------CCCEEEeecccee
Confidence            35789999999999975                        3568888887653


No 320
>KOG0592|consensus
Probab=92.31  E-value=0.18  Score=46.73  Aligned_cols=18  Identities=33%  Similarity=0.464  Sum_probs=16.0

Q ss_pred             eeeeeccCCCCCeeecCC
Q psy15664         27 VTFCHNDLQEGNILYRES   44 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~   44 (174)
                      ..+.|+||+|.|||++.+
T Consensus       193 ~GIIHRDlKPENILLd~d  210 (604)
T KOG0592|consen  193 NGIIHRDLKPENILLDKD  210 (604)
T ss_pred             cCceeccCChhheeEcCC
Confidence            469999999999999874


No 321
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=92.30  E-value=0.12  Score=41.41  Aligned_cols=30  Identities=27%  Similarity=0.482  Sum_probs=24.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||++..                        ++.++++||..+.
T Consensus       121 ~~~~H~dl~~~ni~i~~------------------------~~~~~l~df~~~~  150 (280)
T cd05581         121 KGIIHRDLKPENILLDK------------------------DMHIKITDFGTAK  150 (280)
T ss_pred             CCeeecCCCHHHeEECC------------------------CCCEEecCCcccc
Confidence            35899999999999975                        4678899988765


No 322
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=92.28  E-value=0.14  Score=41.93  Aligned_cols=16  Identities=38%  Similarity=0.661  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++++
T Consensus       136 ~i~H~dl~p~nili~~  151 (302)
T cd07864         136 NFLHRDIKCSNILLNN  151 (302)
T ss_pred             CeecCCCCHHHEEECC
Confidence            5899999999999976


No 323
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=92.28  E-value=0.12  Score=41.51  Aligned_cols=16  Identities=31%  Similarity=0.534  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       120 ~~~h~dl~p~nil~~~  135 (287)
T cd07840         120 GILHRDIKGSNILINN  135 (287)
T ss_pred             CceeccCcHHHeEEcC
Confidence            5899999999999986


No 324
>PRK14705 glycogen branching enzyme; Provisional
Probab=92.27  E-value=2.1  Score=43.54  Aligned_cols=83  Identities=17%  Similarity=0.209  Sum_probs=51.5

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec---------ccCccchhhHHHHHHHH
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY---------CSYNYRAFDIANHFVES   95 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY---------a~~n~~~fDlan~f~E~   95 (174)
                      .+..=||+|+|.|.+|+..+...                   .....+|||||=         -..-.|.=|+|-.+..+
T Consensus       329 ~~~~RIHGD~HLGQVL~t~~D~~-------------------~~~~~~IIDFEGEP~RpL~ERR~k~sPLRDVAGMLRSF  389 (1224)
T PRK14705        329 GQLQRIHGDLHLGQILQVPGAEG-------------------QPERWAILDFEGEPLRPIDERNSPDVPLRDVTGMLRSF  389 (1224)
T ss_pred             cceEEEecccccccEEEecCCCC-------------------ccCCEEEEecCCCCCCChhhhccCCChHHHHHHHHHHH
Confidence            46678999999999998752111                   135699999983         23445677899888874


Q ss_pred             hhhccCCCCCcccccCC-------CCCCHHHHHHHHHHHHhccCC
Q psy15664         96 VYDYSYKHFPHYTVKRE-------NYPSYSLRKSFVETYLSRMNQ  133 (174)
Q Consensus        96 ~~dy~~~~~p~~~~~~~-------~~p~~~~~~~fl~~Yl~~~~~  133 (174)
                      -  |.-..    .....       .+ ...-+..||++|.+....
T Consensus       390 d--YAa~~----~l~~~~~~~~a~~W-~~~~~~aFL~gY~~~~~g  427 (1224)
T PRK14705        390 D--YAAGA----ATRENEGAHVPESW-VDDCAAAFLAGYSEVTPG  427 (1224)
T ss_pred             H--HHHHH----HhhccchhHHHHHH-HHHHHHHHHHHHHHhccC
Confidence            4  31100    00000       00 123467899999987643


No 325
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=92.26  E-value=0.18  Score=39.95  Aligned_cols=16  Identities=44%  Similarity=0.694  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++++||+++.
T Consensus       119 ~i~H~dl~~~ni~~~~  134 (256)
T cd06612         119 KKIHRDIKAGNILLNE  134 (256)
T ss_pred             CcccCCCCcceEEECC
Confidence            4799999999999976


No 326
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=92.25  E-value=0.27  Score=39.77  Aligned_cols=16  Identities=31%  Similarity=0.465  Sum_probs=14.2

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       119 ~i~H~dikp~nil~~~  134 (268)
T cd05086         119 NFLHSDLALRNCFLTS  134 (268)
T ss_pred             CeeccCCccceEEEcC
Confidence            4789999999999975


No 327
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=92.21  E-value=0.25  Score=39.02  Aligned_cols=30  Identities=27%  Similarity=0.282  Sum_probs=24.0

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||++..                        ++.++|+||..+.
T Consensus       122 ~~i~h~~l~~~ni~~~~------------------------~~~~kl~d~g~~~  151 (256)
T cd08530         122 QKILHRDLKSANILLVA------------------------NDLVKIGDLGISK  151 (256)
T ss_pred             CCcccCCCCcceEEEec------------------------CCcEEEeeccchh
Confidence            35799999999999986                        3568888886553


No 328
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=92.21  E-value=0.15  Score=41.66  Aligned_cols=16  Identities=31%  Similarity=0.513  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       126 ~i~H~dl~p~nili~~  141 (293)
T cd07843         126 WILHRDLKTSNLLLNN  141 (293)
T ss_pred             CeeeccCCHHHEEECC
Confidence            4899999999999976


No 329
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=92.21  E-value=0.15  Score=41.71  Aligned_cols=16  Identities=38%  Similarity=0.445  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       117 ~i~H~di~p~nili~~  132 (278)
T cd05606         117 FVVYRDLKPANILLDE  132 (278)
T ss_pred             CEEcCCCCHHHEEECC
Confidence            4899999999999975


No 330
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=92.21  E-value=0.19  Score=40.00  Aligned_cols=17  Identities=18%  Similarity=0.423  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|+++.||+++.
T Consensus       125 ~~i~h~dl~p~nil~~~  141 (267)
T cd08224         125 KRIMHRDIKPANVFITA  141 (267)
T ss_pred             CCEecCCcChhhEEECC
Confidence            35899999999999975


No 331
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=92.20  E-value=0.16  Score=42.29  Aligned_cols=29  Identities=34%  Similarity=0.424  Sum_probs=23.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+||++.|||+..                        .+.++++||.++.
T Consensus       135 ~i~H~dl~p~nil~~~------------------------~~~~kl~dfg~~~  163 (308)
T cd06634         135 NMIHRDVKAGNILLSE------------------------PGLVKLGDFGSAS  163 (308)
T ss_pred             CcccCCCCHHhEEECC------------------------CCcEEECCcccce
Confidence            5899999999999975                        3567888887654


No 332
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=92.20  E-value=0.22  Score=41.51  Aligned_cols=16  Identities=44%  Similarity=0.794  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||++..
T Consensus       145 ~i~H~dL~p~Nil~~~  160 (317)
T cd06635         145 NMIHRDIKAGNILLTE  160 (317)
T ss_pred             CcccCCCCcccEEECC
Confidence            5799999999999975


No 333
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=92.19  E-value=0.15  Score=43.27  Aligned_cols=29  Identities=31%  Similarity=0.550  Sum_probs=24.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||+++.                        .+.++|+||..+.
T Consensus       138 gi~H~dlkp~Nill~~------------------------~~~~kL~dfg~~~  166 (343)
T cd07851         138 GIIHRDLKPSNIAVNE------------------------DCELKILDFGLAR  166 (343)
T ss_pred             CeecCCCCHHHeEECC------------------------CCCEEEccccccc
Confidence            4899999999999986                        3568899987665


No 334
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=92.19  E-value=0.14  Score=40.80  Aligned_cols=17  Identities=29%  Similarity=0.403  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|++|.||++..
T Consensus       104 ~~i~H~dlkp~Nil~~~  120 (237)
T cd05576         104 EGIVCRDLNPNNILLDD  120 (237)
T ss_pred             CCeeccCCCHHHEEEcC
Confidence            45899999999999986


No 335
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=92.15  E-value=0.15  Score=42.40  Aligned_cols=16  Identities=31%  Similarity=0.490  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       161 ~ivH~dlkp~Nil~~~  176 (302)
T cd05055         161 NCIHRDLAARNVLLTH  176 (302)
T ss_pred             CeehhhhccceEEEcC
Confidence            4899999999999975


No 336
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=92.14  E-value=0.2  Score=39.97  Aligned_cols=17  Identities=35%  Similarity=0.550  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.|||++.
T Consensus       117 ~~i~H~dlk~~nili~~  133 (262)
T cd05058         117 KKFVHRDLAARNCMLDE  133 (262)
T ss_pred             CCccccccCcceEEEcC
Confidence            35899999999999976


No 337
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=92.09  E-value=0.18  Score=41.80  Aligned_cols=28  Identities=25%  Similarity=0.529  Sum_probs=23.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .+.|+|+++.||+++.                        ++.++|+||..+
T Consensus       137 ~ivH~dl~p~Nill~~------------------------~~~~kL~dfg~~  164 (297)
T cd06659         137 GVIHRDIKSDSILLTL------------------------DGRVKLSDFGFC  164 (297)
T ss_pred             CeecCCCCHHHeEEcc------------------------CCcEEEeechhH
Confidence            4789999999999975                        367888888765


No 338
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=92.07  E-value=0.18  Score=42.83  Aligned_cols=30  Identities=30%  Similarity=0.588  Sum_probs=24.3

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||++..                        .+.++++||..+.
T Consensus       137 ~gi~H~dlkp~Nill~~------------------------~~~~kl~dfg~~~  166 (343)
T cd07880         137 AGIIHRDLKPGNLAVNE------------------------DCELKILDFGLAR  166 (343)
T ss_pred             CCeecCCCCHHHEEEcC------------------------CCCEEEeeccccc
Confidence            34899999999999975                        3568888887664


No 339
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=92.06  E-value=0.16  Score=40.69  Aligned_cols=17  Identities=18%  Similarity=0.399  Sum_probs=14.8

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       125 ~~i~H~dl~p~nili~~  141 (267)
T cd08229         125 RRVMHRDIKPANVFITA  141 (267)
T ss_pred             CCeecCCCCHHHEEEcC
Confidence            35899999999999975


No 340
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=92.05  E-value=0.22  Score=40.15  Aligned_cols=29  Identities=28%  Similarity=0.446  Sum_probs=23.6

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.||++..                        ++.++|+||..+.
T Consensus       127 ~i~h~~l~~~nili~~------------------------~~~~~l~dfg~~~  155 (287)
T cd07838         127 RIVHRDLKPQNILVTS------------------------DGQVKIADFGLAR  155 (287)
T ss_pred             CeeeccCChhhEEEcc------------------------CCCEEEeccCcce
Confidence            4899999999999986                        3568888887653


No 341
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=92.02  E-value=0.21  Score=40.65  Aligned_cols=17  Identities=24%  Similarity=0.491  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||++.|||++.
T Consensus       114 ~~i~H~dlkp~Nill~~  130 (279)
T cd06619         114 LKILHRDVKPSNMLVNT  130 (279)
T ss_pred             CCEeeCCCCHHHEEECC
Confidence            35899999999999976


No 342
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=92.02  E-value=0.22  Score=39.65  Aligned_cols=30  Identities=20%  Similarity=0.329  Sum_probs=25.0

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||++..                        +..+.++||.++.
T Consensus       120 ~~i~h~~l~~~nil~~~------------------------~~~~~l~d~~~~~  149 (256)
T cd08218         120 RKILHRDIKSQNIFLTK------------------------DGTIKLGDFGIAR  149 (256)
T ss_pred             CCEecCCCCHHHEEEcC------------------------CCCEEEeecccee
Confidence            35899999999999975                        3568999998775


No 343
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=91.98  E-value=0.17  Score=42.79  Aligned_cols=29  Identities=31%  Similarity=0.607  Sum_probs=23.4

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.|||++.                        .+.++|+||..+.
T Consensus       137 ~i~H~dlkp~NIll~~------------------------~~~~kL~dfg~~~  165 (342)
T cd07879         137 GIIHRDLKPGNLAVNE------------------------DCELKILDFGLAR  165 (342)
T ss_pred             CcccCCCCHHHEEECC------------------------CCCEEEeeCCCCc
Confidence            4799999999999975                        3568888887654


No 344
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=91.96  E-value=0.12  Score=40.43  Aligned_cols=17  Identities=29%  Similarity=0.458  Sum_probs=15.3

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+.+.||++..
T Consensus       120 ~~~~h~dl~p~ni~i~~  136 (260)
T cd06606         120 NGIVHRDIKGANILVDS  136 (260)
T ss_pred             CCccccCCCHHHEEEcC
Confidence            46899999999999986


No 345
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=91.91  E-value=0.15  Score=41.15  Aligned_cols=17  Identities=35%  Similarity=0.559  Sum_probs=15.3

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+.+.||++..
T Consensus       120 ~~i~H~dl~p~ni~i~~  136 (277)
T cd06917         120 VGVIHRDIKAANILVTN  136 (277)
T ss_pred             CCcccCCcCHHHEEEcC
Confidence            46899999999999986


No 346
>KOG0983|consensus
Probab=91.88  E-value=0.23  Score=43.07  Aligned_cols=25  Identities=32%  Similarity=0.434  Sum_probs=19.5

Q ss_pred             HhhcCCCeeeeeccCCCCCeeecCC
Q psy15664         20 LLKIKSPVTFCHNDLQEGNILYRES   44 (174)
Q Consensus        20 l~~~~~~~v~cHNDl~~gNiL~~~~   44 (174)
                      |...+.+-.+.|+|++|.|||++++
T Consensus       204 L~YLKeKH~viHRDvKPSNILlDe~  228 (391)
T KOG0983|consen  204 LYYLKEKHGVIHRDVKPSNILLDER  228 (391)
T ss_pred             HHHHHHhcceeecccCccceEEccC
Confidence            3444555678999999999999873


No 347
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=91.87  E-value=0.23  Score=40.16  Aligned_cols=16  Identities=38%  Similarity=0.600  Sum_probs=14.8

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||++..
T Consensus       119 ~i~H~dl~~~ni~i~~  134 (283)
T cd07830         119 GFFHRDLKPENLLVSG  134 (283)
T ss_pred             CcccCCCChhhEEEcC
Confidence            5899999999999986


No 348
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=91.81  E-value=0.17  Score=40.61  Aligned_cols=29  Identities=24%  Similarity=0.405  Sum_probs=23.1

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .+.|+||++.||++..                        .+.++++||..+.
T Consensus       122 ~i~H~dl~p~nil~~~------------------------~~~~~l~dfg~~~  150 (265)
T cd06631         122 CVVHRDIKGNNVMLMP------------------------NGIIKLIDFGCAR  150 (265)
T ss_pred             CcccCCcCHHhEEECC------------------------CCeEEeccchhhH
Confidence            3789999999999975                        3568888887654


No 349
>KOG0668|consensus
Probab=91.77  E-value=0.17  Score=42.96  Aligned_cols=51  Identities=20%  Similarity=0.232  Sum_probs=32.3

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      +++.-+-.|.+.|+-.. ...+.|+|++|.|++++.                       ...+++||||-.|-+-
T Consensus       133 dIryY~~elLkALdyCH-S~GImHRDVKPhNvmIdh-----------------------~~rkLrlIDWGLAEFY  183 (338)
T KOG0668|consen  133 DIRYYIYELLKALDYCH-SMGIMHRDVKPHNVMIDH-----------------------ELRKLRLIDWGLAEFY  183 (338)
T ss_pred             hHHHHHHHHHHHHhHHH-hcCcccccCCcceeeech-----------------------hhceeeeeecchHhhc
Confidence            33333334444443322 356899999999999986                       4567888888655443


No 350
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=91.75  E-value=0.21  Score=45.33  Aligned_cols=16  Identities=31%  Similarity=0.542  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||+..
T Consensus       163 ~IiHrDLKP~NILl~~  178 (496)
T PTZ00283        163 HMIHRDIKSANILLCS  178 (496)
T ss_pred             CEecCCCCHHHEEEeC
Confidence            4799999999999975


No 351
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=91.75  E-value=0.19  Score=40.67  Aligned_cols=16  Identities=31%  Similarity=0.490  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       120 ~i~H~~l~p~nill~~  135 (284)
T cd07860         120 RVLHRDLKPQNLLINT  135 (284)
T ss_pred             CeecCCCCHHHEEECC
Confidence            4899999999999986


No 352
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=91.73  E-value=0.32  Score=39.09  Aligned_cols=30  Identities=23%  Similarity=0.274  Sum_probs=23.9

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++|+|++++||++..                        .+.++++||..+..
T Consensus       128 ~i~H~dl~~~nil~~~------------------------~~~~~l~d~~~~~~  157 (272)
T cd06629         128 GILHRDLKADNLLVDA------------------------DGICKISDFGISKK  157 (272)
T ss_pred             CeeecCCChhhEEEcC------------------------CCeEEEeecccccc
Confidence            5899999999999975                        35677888876653


No 353
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=91.72  E-value=0.23  Score=41.71  Aligned_cols=16  Identities=38%  Similarity=0.526  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.|||+..
T Consensus       154 givH~dlkp~Nill~~  169 (334)
T cd05100         154 KCIHRDLAARNVLVTE  169 (334)
T ss_pred             CeeccccccceEEEcC
Confidence            5799999999999975


No 354
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=91.71  E-value=0.21  Score=41.03  Aligned_cols=33  Identities=21%  Similarity=0.166  Sum_probs=24.1

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.|||+..+..                    ..+.++++||..+.
T Consensus       128 ~i~h~dlkp~Nil~~~~~~--------------------~~~~~kl~Dfg~~~  160 (316)
T cd07842         128 WVLHRDLKPANILVMGEGP--------------------ERGVVKIGDLGLAR  160 (316)
T ss_pred             CEeeCCCCHHHEEEcCCCC--------------------ccceEEECCCcccc
Confidence            4889999999999976211                    23568888887544


No 355
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=91.70  E-value=0.22  Score=40.44  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||+++||+++.
T Consensus       120 ~~ivH~dl~p~Nil~~~  136 (277)
T cd06640         120 EKKIHRDIKAANVLLSE  136 (277)
T ss_pred             CCccCcCCChhhEEEcC
Confidence            35789999999999975


No 356
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=91.59  E-value=0.16  Score=40.28  Aligned_cols=17  Identities=24%  Similarity=0.450  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++.+
T Consensus       120 ~~i~H~dl~~~nil~~~  136 (257)
T cd08225         120 RKILHRDIKSQNIFLSK  136 (257)
T ss_pred             CCcccccCCHHHEEEcC
Confidence            35899999999999976


No 357
>KOG1006|consensus
Probab=91.55  E-value=0.065  Score=46.17  Aligned_cols=33  Identities=30%  Similarity=0.557  Sum_probs=27.1

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      +..+-+.|+|++|.|||++.                        .+.++|-||--||
T Consensus       184 K~~lkiIHRDvKPSNILldr------------------------~G~vKLCDFGIcG  216 (361)
T KOG1006|consen  184 KEELKIIHRDVKPSNILLDR------------------------HGDVKLCDFGICG  216 (361)
T ss_pred             HHHhhhhhccCChhheEEec------------------------CCCEeeecccchH
Confidence            34456899999999999986                        5789999997665


No 358
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=91.52  E-value=0.17  Score=42.60  Aligned_cols=16  Identities=31%  Similarity=0.549  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||++.
T Consensus       126 ~ivH~dlkp~Nill~~  141 (336)
T cd07849         126 NVLHRDLKPSNLLLNT  141 (336)
T ss_pred             CeeccCCCHHHEEECC
Confidence            4899999999999976


No 359
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=91.50  E-value=0.34  Score=40.08  Aligned_cols=16  Identities=44%  Similarity=0.681  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       135 ~i~H~dl~p~nIl~~~  150 (307)
T cd06607         135 ERIHRDIKAGNILLTE  150 (307)
T ss_pred             CceecCCCcccEEECC
Confidence            4789999999999976


No 360
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=91.49  E-value=0.19  Score=42.34  Aligned_cols=16  Identities=31%  Similarity=0.551  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||++..
T Consensus       128 ~i~H~dlkp~Nil~~~  143 (337)
T cd07858         128 NVLHRDLKPSNLLLNA  143 (337)
T ss_pred             CEecCCCCHHHEEEcC
Confidence            5899999999999975


No 361
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=91.45  E-value=0.19  Score=39.76  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       121 ~~i~H~dl~~~ni~~~~  137 (258)
T cd06632         121 RNTVHRDIKGANILVDT  137 (258)
T ss_pred             CCcccCCCCHHHEEECC
Confidence            35899999999999975


No 362
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=91.39  E-value=0.19  Score=40.47  Aligned_cols=16  Identities=31%  Similarity=0.528  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       126 ~i~H~dl~p~ni~i~~  141 (264)
T cd06653         126 MIVHRDIKGANILRDS  141 (264)
T ss_pred             CEecCCCCHHHEEEcC
Confidence            4899999999999975


No 363
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=91.39  E-value=0.3  Score=39.32  Aligned_cols=17  Identities=35%  Similarity=0.632  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       125 ~g~~H~dl~p~nili~~  141 (269)
T cd05065         125 MNYVHRDLAARNILVNS  141 (269)
T ss_pred             CCEeecccChheEEEcC
Confidence            35799999999999975


No 364
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=91.38  E-value=0.23  Score=40.03  Aligned_cols=17  Identities=29%  Similarity=0.454  Sum_probs=14.7

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||+++.
T Consensus       125 ~~i~H~~l~p~nil~~~  141 (266)
T cd06651         125 NMIVHRDIKGANILRDS  141 (266)
T ss_pred             CCeeeCCCCHHHEEECC
Confidence            35899999999999975


No 365
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=91.29  E-value=0.29  Score=41.12  Aligned_cols=16  Identities=38%  Similarity=0.588  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       127 ~i~H~dl~p~nill~~  142 (337)
T cd07852         127 NVIHRDLKPSNILLNS  142 (337)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            5899999999999976


No 366
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=91.26  E-value=0.22  Score=40.40  Aligned_cols=30  Identities=27%  Similarity=0.519  Sum_probs=24.5

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++|+|+++.||++.+                        .+.++|+||.++.
T Consensus       140 ~~ivH~dl~~~nili~~------------------------~~~~~l~dfg~~~  169 (282)
T cd06636         140 HKVIHRDIKGQNVLLTE------------------------NAEVKLVDFGVSA  169 (282)
T ss_pred             CCcccCCCCHHHEEECC------------------------CCCEEEeeCcchh
Confidence            35899999999999986                        3568899987654


No 367
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=91.23  E-value=0.31  Score=39.27  Aligned_cols=16  Identities=38%  Similarity=0.547  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||+..
T Consensus       137 ~i~H~dlkp~Nili~~  152 (275)
T cd05046         137 RFVHRDLAARNCLVSS  152 (275)
T ss_pred             CcccCcCccceEEEeC
Confidence            4899999999999976


No 368
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=91.18  E-value=0.26  Score=41.40  Aligned_cols=16  Identities=38%  Similarity=0.611  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       127 ~ivH~dlkp~Nil~~~  142 (334)
T cd07855         127 NVIHRDLKPSNLLVNE  142 (334)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            4899999999999976


No 369
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=91.16  E-value=0.22  Score=40.58  Aligned_cols=17  Identities=35%  Similarity=0.559  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|+++.|||+.+
T Consensus       141 ~~i~H~dlkp~nil~~~  157 (280)
T cd05092         141 LHFVHRDLATRNCLVGQ  157 (280)
T ss_pred             CCeecccccHhhEEEcC
Confidence            35899999999999975


No 370
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=91.16  E-value=0.23  Score=41.89  Aligned_cols=16  Identities=44%  Similarity=0.634  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       128 ~iiH~dl~p~Nili~~  143 (328)
T cd07856         128 GVVHRDLKPSNILINE  143 (328)
T ss_pred             CcccCCCCHHHEeECC
Confidence            4899999999999975


No 371
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=91.08  E-value=0.31  Score=42.16  Aligned_cols=16  Identities=38%  Similarity=0.509  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.|||++.
T Consensus       234 ~ivH~Dlkp~Nill~~  249 (375)
T cd05104         234 NCIHRDLAARNILLTH  249 (375)
T ss_pred             CeeccCCchhhEEEEC
Confidence            4799999999999976


No 372
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=90.89  E-value=0.25  Score=39.44  Aligned_cols=17  Identities=29%  Similarity=0.513  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       125 ~~i~h~~l~~~nili~~  141 (260)
T cd08222         125 RRILHRDLKAKNIFLKN  141 (260)
T ss_pred             cCccccCCChhheEeec
Confidence            46899999999999965


No 373
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=90.87  E-value=0.21  Score=39.99  Aligned_cols=16  Identities=31%  Similarity=0.524  Sum_probs=14.3

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       126 ~ivH~di~p~nil~~~  141 (267)
T cd06628         126 GIIHRDIKGANILVDN  141 (267)
T ss_pred             CcccccCCHHHEEEcC
Confidence            4789999999999975


No 374
>KOG1167|consensus
Probab=90.87  E-value=0.35  Score=43.40  Aligned_cols=54  Identities=20%  Similarity=0.249  Sum_probs=34.8

Q ss_pred             cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664          4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus         4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      +++.++..-+..|-+.++. -....+.|+|++|+|+|++.                       ..++-+||||-.|..
T Consensus       129 l~~~~i~~Yl~~ll~Al~~-~h~~GIvHRDiKpsNFL~n~-----------------------~t~rg~LvDFgLA~~  182 (418)
T KOG1167|consen  129 LSLAEIRWYLRNLLKALAH-LHKNGIVHRDIKPSNFLYNR-----------------------RTQRGVLVDFGLAQR  182 (418)
T ss_pred             CCHHHHHHHHHHHHHHhhh-hhccCccccCCCcccccccc-----------------------ccCCceEEechhHHH
Confidence            3444444333333333332 23457899999999999987                       346778999987763


No 375
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=90.85  E-value=0.46  Score=38.42  Aligned_cols=17  Identities=29%  Similarity=0.464  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|+++.||++..
T Consensus       120 ~~ivH~dl~p~ni~i~~  136 (277)
T cd06642         120 ERKIHRDIKAANVLLSE  136 (277)
T ss_pred             CCeeccCCChheEEEeC
Confidence            35889999999999975


No 376
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=90.81  E-value=0.3  Score=41.48  Aligned_cols=16  Identities=31%  Similarity=0.511  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       140 ~ivH~dlkp~NIll~~  155 (345)
T cd07877         140 DIIHRDLKPSNLAVNE  155 (345)
T ss_pred             CeeecCCChHHEEEcC
Confidence            5899999999999976


No 377
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=90.81  E-value=0.4  Score=44.14  Aligned_cols=29  Identities=24%  Similarity=0.407  Sum_probs=24.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|+++.|||+..                        +..++++||-.+.
T Consensus       329 ~ivHrDLKp~NILl~~------------------------~~~~kL~DFGla~  357 (507)
T PLN03224        329 GIVHRDIKPENLLVTV------------------------DGQVKIIDFGAAV  357 (507)
T ss_pred             CeecCCCchHhEEECC------------------------CCcEEEEeCcCcc
Confidence            4789999999999976                        3568999997763


No 378
>KOG1235|consensus
Probab=90.80  E-value=0.18  Score=46.76  Aligned_cols=33  Identities=33%  Similarity=0.633  Sum_probs=25.2

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .|-|+|.|||||+++.++.                    .+.++++.|+=-..
T Consensus       321 GffHaDPHPGNilv~~~~~--------------------~~~~ivllDhGl~~  353 (538)
T KOG1235|consen  321 GFFHADPHPGNILVRPNPE--------------------GDEEIVLLDHGLYA  353 (538)
T ss_pred             CCccCCCCCCcEEEecCCC--------------------CCccEEEEcccccc
Confidence            4999999999999996432                    35778999975433


No 379
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=90.76  E-value=0.27  Score=39.80  Aligned_cols=17  Identities=24%  Similarity=0.317  Sum_probs=14.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       136 ~~i~H~di~p~nil~~~  152 (280)
T cd05043         136 RGVIHKDIAARNCVIDE  152 (280)
T ss_pred             CCEeecccCHhhEEEcC
Confidence            35899999999999976


No 380
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=90.74  E-value=0.3  Score=39.93  Aligned_cols=16  Identities=31%  Similarity=0.524  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|++|.|||+..
T Consensus       139 ~i~H~dikp~nili~~  154 (288)
T cd05061         139 KFVHRDLAARNCMVAH  154 (288)
T ss_pred             CCcCCCCChheEEEcC
Confidence            5899999999999976


No 381
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=90.65  E-value=0.29  Score=39.41  Aligned_cols=16  Identities=31%  Similarity=0.617  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       120 ~i~H~dl~p~ni~l~~  135 (282)
T cd07831         120 GIFHRDIKPENILIKD  135 (282)
T ss_pred             CceecccCHHHEEEcC
Confidence            4899999999999975


No 382
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=90.64  E-value=0.35  Score=42.59  Aligned_cols=16  Identities=31%  Similarity=0.532  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       257 ~ivH~dikp~Nill~~  272 (400)
T cd05105         257 NCVHRDLAARNVLLAQ  272 (400)
T ss_pred             CeeCCCCChHhEEEeC
Confidence            4899999999999976


No 383
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=90.64  E-value=0.3  Score=48.14  Aligned_cols=29  Identities=28%  Similarity=0.367  Sum_probs=23.6

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .++|+|++|.|||++.                        .+.++++||..+.
T Consensus       133 GIIHRDLKPeNILLd~------------------------dg~vKLiDFGLAk  161 (932)
T PRK13184        133 GVLHRDLKPDNILLGL------------------------FGEVVILDWGAAI  161 (932)
T ss_pred             CccccCCchheEEEcC------------------------CCCEEEEecCcce
Confidence            5899999999999975                        3567888887664


No 384
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=90.64  E-value=0.26  Score=40.59  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.||+++.
T Consensus       135 gi~H~dL~p~Nili~~  150 (293)
T cd06647         135 QVIHRDIKSDNILLGM  150 (293)
T ss_pred             CEeeccCCHHHEEEcC
Confidence            4899999999999976


No 385
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=90.62  E-value=0.35  Score=38.86  Aligned_cols=16  Identities=38%  Similarity=0.544  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++.+
T Consensus       118 ~i~H~~l~~~ni~~~~  133 (282)
T cd07829         118 RILHRDLKPQNILINR  133 (282)
T ss_pred             CcccCCCChheEEEcC
Confidence            4789999999999986


No 386
>KOG0610|consensus
Probab=90.59  E-value=0.42  Score=43.11  Aligned_cols=44  Identities=25%  Similarity=0.267  Sum_probs=32.9

Q ss_pred             HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664         11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      .|+--..++|..    +.+.=+||+|.|||+++                        ++-|.|.||+.+--.
T Consensus       186 AEvl~ALEYLHm----lGivYRDLKPENILvre------------------------dGHIMLsDFDLS~~~  229 (459)
T KOG0610|consen  186 AEVLLALEYLHM----LGIVYRDLKPENILVRE------------------------DGHIMLSDFDLSLRC  229 (459)
T ss_pred             HHHHHHHHHHHh----hceeeccCCcceeEEec------------------------CCcEEeeeccccccC
Confidence            444444555544    45888999999999997                        578999999987643


No 387
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=90.53  E-value=0.33  Score=39.70  Aligned_cols=31  Identities=23%  Similarity=0.333  Sum_probs=25.0

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ..++|+|+++.||++..                        .+.++++||.++..
T Consensus       124 ~~i~H~dl~~~nil~~~------------------------~~~~~l~dfg~~~~  154 (287)
T cd06621         124 RKIIHRDIKPSNILLTR------------------------KGQVKLCDFGVSGE  154 (287)
T ss_pred             CCcccCCCCHHHEEEec------------------------CCeEEEeecccccc
Confidence            45899999999999975                        35688999987653


No 388
>PLN00181 protein SPA1-RELATED; Provisional
Probab=90.30  E-value=0.43  Score=45.60  Aligned_cols=17  Identities=0%  Similarity=0.077  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+||+|.|||+..
T Consensus        99 ~gIvHrDlKP~NiLl~~  115 (793)
T PLN00181         99 QGIVVHNVRPSCFVMSS  115 (793)
T ss_pred             CCeeeccCCchhEEEcc
Confidence            46999999999999964


No 389
>KOG0595|consensus
Probab=90.25  E-value=0.5  Score=42.44  Aligned_cols=52  Identities=21%  Similarity=0.301  Sum_probs=35.3

Q ss_pred             HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664         11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      ++++...++|...    -+.|+||+|.|||+..+....                  ....+++=||=+|..-.+
T Consensus       116 ~QLA~alq~L~~~----~IiHRDLKPQNiLLs~~~~~~------------------~~~~LKIADFGfAR~L~~  167 (429)
T KOG0595|consen  116 QQLASALQFLHEN----NIIHRDLKPQNILLSTTARND------------------TSPVLKIADFGFARFLQP  167 (429)
T ss_pred             HHHHHHHHHHHHC----CeeeccCCcceEEeccCCCCC------------------CCceEEecccchhhhCCc
Confidence            4455555555543    489999999999998743221                  115699999998876553


No 390
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=90.21  E-value=0.38  Score=38.24  Aligned_cols=16  Identities=25%  Similarity=0.524  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+||++.||++..
T Consensus       119 ~i~H~dl~~~nil~~~  134 (264)
T cd06626         119 GIVHRDIKPANIFLDH  134 (264)
T ss_pred             CcccCCCCHHHEEECC
Confidence            4799999999999986


No 391
>KOG0598|consensus
Probab=90.08  E-value=0.25  Score=43.52  Aligned_cols=29  Identities=28%  Similarity=0.165  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664         11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      .||...-.+|.+.    .+.|+||+|.|||++.
T Consensus       132 aEi~lAL~~LH~~----gIiyRDlKPENILLd~  160 (357)
T KOG0598|consen  132 AEIVLALGYLHSK----GIIYRDLKPENILLDE  160 (357)
T ss_pred             HHHHHHHHHHHhC----CeeeccCCHHHeeecC
Confidence            5666666666654    4899999999999986


No 392
>KOG0578|consensus
Probab=90.07  E-value=0.49  Score=43.84  Aligned_cols=33  Identities=24%  Similarity=0.442  Sum_probs=27.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      ..+.|+|++..|||+..                        ++.++|.||=+|+.-.
T Consensus       388 ~gIiHrDIKSDnILL~~------------------------~g~vKltDFGFcaqi~  420 (550)
T KOG0578|consen  388 RGIIHRDIKSDNILLTM------------------------DGSVKLTDFGFCAQIS  420 (550)
T ss_pred             cceeeeccccceeEecc------------------------CCcEEEeeeeeeeccc
Confidence            46899999999999986                        4779999999987543


No 393
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=90.05  E-value=0.53  Score=41.52  Aligned_cols=16  Identities=38%  Similarity=0.524  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       259 ~ivHrdlkp~NiLl~~  274 (401)
T cd05107         259 NCVHRDLAARNVLICE  274 (401)
T ss_pred             CcCcccCCcceEEEeC
Confidence            4799999999999975


No 394
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=89.97  E-value=0.26  Score=41.71  Aligned_cols=16  Identities=25%  Similarity=0.501  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||+++.
T Consensus       134 givH~dikp~Nili~~  149 (342)
T cd07854         134 NVLHRDLKPANVFINT  149 (342)
T ss_pred             CcccCCCCHHHEEEcC
Confidence            5899999999999974


No 395
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=89.94  E-value=0.63  Score=37.60  Aligned_cols=17  Identities=24%  Similarity=0.368  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|++|.|||+..
T Consensus       124 ~~ivH~dlkp~Nill~~  140 (262)
T cd05077         124 KDLVHGNVCTKNILLAR  140 (262)
T ss_pred             CCeECCCCCcccEEEec
Confidence            35899999999999975


No 396
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=89.93  E-value=0.33  Score=39.12  Aligned_cols=16  Identities=38%  Similarity=0.532  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       118 ~i~h~dl~p~ni~i~~  133 (274)
T cd06609         118 GKIHRDIKAANILLSE  133 (274)
T ss_pred             CcccCCCCHHHEEECC
Confidence            4899999999999986


No 397
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=89.81  E-value=0.29  Score=40.98  Aligned_cols=17  Identities=35%  Similarity=0.518  Sum_probs=15.0

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..++|+|+++.||++..
T Consensus       138 ~~i~H~dl~~~nill~~  154 (335)
T PTZ00024        138 WYFMHRDLSPANIFINS  154 (335)
T ss_pred             CCeecccccHHHeEECC
Confidence            35899999999999976


No 398
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=89.74  E-value=0.33  Score=39.52  Aligned_cols=16  Identities=31%  Similarity=0.549  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.||++.+
T Consensus       124 ~i~H~dl~p~nil~~~  139 (284)
T cd06620         124 RIMHRDIKPSNILVNS  139 (284)
T ss_pred             CeeccCCCHHHEEECC
Confidence            4899999999999976


No 399
>PHA02988 hypothetical protein; Provisional
Probab=89.69  E-value=0.37  Score=39.70  Aligned_cols=15  Identities=20%  Similarity=0.080  Sum_probs=13.2

Q ss_pred             eeeccCCCCCeeecC
Q psy15664         29 FCHNDLQEGNILYRE   43 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~   43 (174)
                      ..|+|+++.|||++.
T Consensus       144 ~~Hrdlkp~nill~~  158 (283)
T PHA02988        144 KPYKNLTSVSFLVTE  158 (283)
T ss_pred             CCCCcCChhhEEECC
Confidence            449999999999986


No 400
>KOG0660|consensus
Probab=89.58  E-value=0.27  Score=43.31  Aligned_cols=33  Identities=30%  Similarity=0.540  Sum_probs=26.0

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      .-...|+||+|+|+|++.                        +..+++-||=+|...
T Consensus       143 SAnViHRDLKPsNll~n~------------------------~c~lKI~DFGLAR~~  175 (359)
T KOG0660|consen  143 SANVIHRDLKPSNLLLNA------------------------DCDLKICDFGLARYL  175 (359)
T ss_pred             cccccccccchhheeecc------------------------CCCEEeccccceeec
Confidence            446789999999999986                        356778888777655


No 401
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=89.55  E-value=0.38  Score=38.91  Aligned_cols=16  Identities=44%  Similarity=0.646  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.||++..
T Consensus       123 ~i~h~dl~p~nili~~  138 (280)
T cd06611         123 KVIHRDLKAGNILLTL  138 (280)
T ss_pred             CcccCCCChhhEEECC
Confidence            4789999999999975


No 402
>KOG0593|consensus
Probab=89.51  E-value=0.49  Score=41.49  Aligned_cols=28  Identities=29%  Similarity=0.456  Sum_probs=22.9

Q ss_pred             eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..|+|++|.|||++.                        ++.+.|-||-||.
T Consensus       122 ~IHRDIKPENILit~------------------------~gvvKLCDFGFAR  149 (396)
T KOG0593|consen  122 CIHRDIKPENILITQ------------------------NGVVKLCDFGFAR  149 (396)
T ss_pred             eecccCChhheEEec------------------------CCcEEeccchhhH
Confidence            779999999999986                        4667888887653


No 403
>KOG0607|consensus
Probab=89.30  E-value=0.59  Score=41.40  Aligned_cols=32  Identities=22%  Similarity=0.235  Sum_probs=23.5

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      .+.++|....+++...    .+.|+||+|.|||-..
T Consensus       180 ~vvkdia~aLdFlH~k----gIAHRDlKPENiLC~~  211 (463)
T KOG0607|consen  180 RVVKDIASALDFLHTK----GIAHRDLKPENILCES  211 (463)
T ss_pred             HHHHHHHHHHHHHhhc----CcccccCCccceeecC
Confidence            4456666666666554    4999999999999764


No 404
>KOG0670|consensus
Probab=89.24  E-value=0.63  Score=43.50  Aligned_cols=29  Identities=31%  Similarity=0.287  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664         11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      +++-...++|.+    +.+.|.|++|.|||+++
T Consensus       543 qQLflALklLK~----c~vlHaDIKPDNiLVNE  571 (752)
T KOG0670|consen  543 QQLFLALKLLKK----CGVLHADIKPDNILVNE  571 (752)
T ss_pred             HHHHHHHHHHHh----cCeeecccCccceEecc
Confidence            344444455555    45899999999999998


No 405
>KOG0616|consensus
Probab=89.17  E-value=0.59  Score=40.76  Aligned_cols=41  Identities=22%  Similarity=0.312  Sum_probs=30.4

Q ss_pred             HHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         11 TEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        11 ~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .|+...-+++..    .-+..+||+|.|||++.                        .+-|.++||-+|
T Consensus       151 AeivlAleylH~----~~iiYRDLKPENiLlD~------------------------~G~iKitDFGFA  191 (355)
T KOG0616|consen  151 AEIVLALEYLHS----LDIIYRDLKPENLLLDQ------------------------NGHIKITDFGFA  191 (355)
T ss_pred             HHHHHHHHHHHh----cCeeeccCChHHeeecc------------------------CCcEEEEeccce
Confidence            445444455544    34889999999999986                        477999999776


No 406
>KOG0604|consensus
Probab=89.15  E-value=0.52  Score=41.31  Aligned_cols=54  Identities=22%  Similarity=0.356  Sum_probs=34.4

Q ss_pred             HHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664          9 LNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus         9 L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      +-++|...-+++..    .-+.|+||++.|+|+.....                     +-.++|-||-||--..+-.|
T Consensus       166 I~~qI~~Av~~lH~----~nIAHRDlKpENLLyt~t~~---------------------na~lKLtDfGFAK~t~~~~~  219 (400)
T KOG0604|consen  166 IMKQIGLAVRYLHS----MNIAHRDLKPENLLYTTTSP---------------------NAPLKLTDFGFAKETQEPGD  219 (400)
T ss_pred             HHHHHHHHHHHHHh----cchhhccCChhheeeecCCC---------------------CcceEecccccccccCCCcc
Confidence            33444444444444    34899999999999987422                     24577888877765553333


No 407
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=88.82  E-value=0.53  Score=38.01  Aligned_cols=16  Identities=19%  Similarity=0.430  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.|||+..
T Consensus       127 ~iiH~dikp~nili~~  142 (266)
T cd05064         127 GYVHKGLAAHKVLVNS  142 (266)
T ss_pred             CEeeccccHhhEEEcC
Confidence            4789999999999976


No 408
>KOG0599|consensus
Probab=88.79  E-value=0.4  Score=41.66  Aligned_cols=41  Identities=22%  Similarity=0.388  Sum_probs=34.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHH
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHF   92 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f   92 (174)
                      -+.|+||++.|||+++                        +-.+++=||-+|.--.|+=-|-+.+
T Consensus       143 ~IVHRDLKpENILldd------------------------n~~i~isDFGFa~~l~~GekLrelC  183 (411)
T KOG0599|consen  143 NIVHRDLKPENILLDD------------------------NMNIKISDFGFACQLEPGEKLRELC  183 (411)
T ss_pred             hhhhcccChhheeecc------------------------ccceEEeccceeeccCCchhHHHhc
Confidence            4789999999999987                        4679999999999888877665543


No 409
>KOG0582|consensus
Probab=88.66  E-value=0.66  Score=42.34  Aligned_cols=33  Identities=24%  Similarity=0.212  Sum_probs=22.4

Q ss_pred             hhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664          7 KDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus         7 ~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.+|+-.-..+|.+.    .-.|+|+++||||++.
T Consensus       129 a~iLre~LkaL~YLH~~----G~IHRdvKAgnILi~~  161 (516)
T KOG0582|consen  129 ATILREVLKALDYLHQN----GHIHRDVKAGNILIDS  161 (516)
T ss_pred             HHHHHHHHHHHHHHHhc----CceecccccccEEEcC
Confidence            33444444444455443    4789999999999986


No 410
>COG3281 Ble Uncharacterized protein, probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]
Probab=88.33  E-value=0.26  Score=43.80  Aligned_cols=45  Identities=24%  Similarity=0.230  Sum_probs=34.8

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc---------cCccchhhHHHHHHHHh
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC---------SYNYRAFDIANHFVESV   96 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa---------~~n~~~fDlan~f~E~~   96 (174)
                      +.=.|+|||.|-+|+..                         ++.+|||||=-         -.-.|.=|+|..+....
T Consensus       284 l~RvHGDLHLgQVLvt~-------------------------g~~~liDFEGEPsRpl~err~~~sPlrDvAgllRS~D  337 (438)
T COG3281         284 LQRVHGDLHLGQVLVTP-------------------------GRALLIDFEGEPSRPLDERRAPDSPLRDVAGLLRSFD  337 (438)
T ss_pred             HHHHhccceehheeeeC-------------------------CcEEEEecCCCCCCChhhccCCCCchHHHHHHHHHhH
Confidence            44579999999999976                         78999999832         23456778998887733


No 411
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=88.13  E-value=0.71  Score=37.01  Aligned_cols=18  Identities=17%  Similarity=0.274  Sum_probs=15.6

Q ss_pred             eeeeeccCCCCCeeecCC
Q psy15664         27 VTFCHNDLQEGNILYRES   44 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~   44 (174)
                      ..++|+|+++.|||+..+
T Consensus       119 ~~iiH~dlkp~nili~~~  136 (258)
T cd05078         119 KGLTHGNVCAKNVLLIRE  136 (258)
T ss_pred             CCeecCCCccceEEEecc
Confidence            358999999999999863


No 412
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=87.88  E-value=1  Score=36.75  Aligned_cols=16  Identities=25%  Similarity=0.439  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||++.|||+..
T Consensus       137 ~iiH~dlkp~Nill~~  152 (274)
T cd05076         137 NLVHGNVCAKNILLAR  152 (274)
T ss_pred             CccCCCCCcccEEEec
Confidence            4799999999999975


No 413
>KOG0615|consensus
Probab=87.60  E-value=0.73  Score=41.68  Aligned_cols=19  Identities=26%  Similarity=0.434  Sum_probs=16.6

Q ss_pred             CeeeeeccCCCCCeeecCC
Q psy15664         26 PVTFCHNDLQEGNILYRES   44 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~   44 (174)
                      ...+||+|++|.|||+...
T Consensus       294 ~~GI~HRDiKPeNILl~~~  312 (475)
T KOG0615|consen  294 SQGIIHRDIKPENILLSND  312 (475)
T ss_pred             HcCcccccCCcceEEeccC
Confidence            3579999999999999874


No 414
>KOG1187|consensus
Probab=86.94  E-value=0.77  Score=40.27  Aligned_cols=19  Identities=37%  Similarity=0.553  Sum_probs=16.5

Q ss_pred             eeeeccCCCCCeeecCCCC
Q psy15664         28 TFCHNDLQEGNILYRESPN   46 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~   46 (174)
                      .+.|+|+++.|||++.+..
T Consensus       197 ~iiHrDiKssNILLD~~~~  215 (361)
T KOG1187|consen  197 PIIHRDIKSSNILLDEDFN  215 (361)
T ss_pred             CEecCCCCHHHeeECCCCC
Confidence            6899999999999997544


No 415
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=86.80  E-value=0.78  Score=41.40  Aligned_cols=62  Identities=23%  Similarity=0.310  Sum_probs=47.4

Q ss_pred             cchhhHHHHHHHHHHHHh---hcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664          4 ILSKDLNTEADWLKKHLL---KIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus         4 ~~~~~L~~e~~~l~~~l~---~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      +..++..+++..+...+.   ......-|-|+||.-+|||+++                         +.+.||||-.|.
T Consensus       315 ik~~~~~e~lsff~s~~sil~~lekkf~fehrnlt~~niLId~-------------------------GnvtLIDfklsR  369 (488)
T COG5072         315 IKADRSEEELSFFWSCISILDILEKKFPFEHRNLTLDNILIDE-------------------------GNVTLIDFKLSR  369 (488)
T ss_pred             eecccHHHHHHHHHHHHHHHhhhhhcCCcccccccccceeeec-------------------------CceEEEEeeeee
Confidence            344566677777665543   4556778999999999999985                         789999999999


Q ss_pred             CccchhhHHH
Q psy15664         81 YNYRAFDIAN   90 (174)
Q Consensus        81 ~n~~~fDlan   90 (174)
                      .++..=+|-+
T Consensus       370 l~~~q~~isy  379 (488)
T COG5072         370 LSYSQGIISY  379 (488)
T ss_pred             cccCCceeec
Confidence            8877766543


No 416
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]
Probab=86.76  E-value=0.59  Score=39.69  Aligned_cols=26  Identities=35%  Similarity=0.473  Sum_probs=22.7

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeee
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFE   77 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfE   77 (174)
                      ..+.|.||..-|||+.+                         +..++||+=
T Consensus       186 a~LVHgDLSEyNiL~~~-------------------------~~p~iID~~  211 (268)
T COG1718         186 AGLVHGDLSEYNILVHD-------------------------GEPYIIDVS  211 (268)
T ss_pred             cCcccccchhhheEEEC-------------------------CeEEEEECc
Confidence            35899999999999986                         678999993


No 417
>KOG0198|consensus
Probab=86.61  E-value=1  Score=39.07  Aligned_cols=17  Identities=29%  Similarity=0.440  Sum_probs=15.5

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+|+++.|||+..
T Consensus       136 ~g~vH~DiK~~NiLl~~  152 (313)
T KOG0198|consen  136 KGIVHCDIKPANILLDP  152 (313)
T ss_pred             CCEeccCcccceEEEeC
Confidence            46999999999999987


No 418
>PF10707 YrbL-PhoP_reg:  PhoP regulatory network protein YrbL;  InterPro: IPR019647  This entry represents proteins that are activated by the protein PhoP. PhoP controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multi-component loop in Salmonella sp., where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner []. 
Probab=86.58  E-value=1.8  Score=35.01  Aligned_cols=45  Identities=29%  Similarity=0.375  Sum_probs=30.7

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEee
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDF   76 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDf   76 (174)
                      .+.+-++.+++.+-...    ++.+|+.++||++....++                    ..++++||-
T Consensus       122 ~~~~~L~~f~~~l~~~~----Iv~~dl~~~NIv~~~~~~~--------------------~~~lvlIDG  166 (199)
T PF10707_consen  122 ELRQALDEFKRYLLDHH----IVIRDLNPHNIVVQRRDSG--------------------EFRLVLIDG  166 (199)
T ss_pred             HHHHHHHHHHHHHHHcC----CeecCCCcccEEEEecCCC--------------------ceEEEEEeC
Confidence            45555666666665433    4555999999999874322                    247999997


No 419
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=86.42  E-value=0.98  Score=37.78  Aligned_cols=16  Identities=19%  Similarity=0.436  Sum_probs=14.4

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+||++.|||+..
T Consensus       121 ~iiH~dlkp~Nil~~~  136 (327)
T cd08227         121 GYVHRSVKASHILISV  136 (327)
T ss_pred             CEecCCCChhhEEEec
Confidence            4889999999999976


No 420
>KOG2268|consensus
Probab=86.36  E-value=1.2  Score=39.68  Aligned_cols=43  Identities=30%  Similarity=0.375  Sum_probs=30.4

Q ss_pred             hHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664          8 DLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY   78 (174)
Q Consensus         8 ~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY   78 (174)
                      .|...+.-+.--+.+.    .+.|+|.+.-|||+.+                        +..+++|||-=
T Consensus       206 ~ly~~lm~~Iv~la~~----GlIHgDFNEFNimv~d------------------------d~~i~vIDFPQ  248 (465)
T KOG2268|consen  206 TLYDDLMGLIVRLANH----GLIHGDFNEFNIMVKD------------------------DDKIVVIDFPQ  248 (465)
T ss_pred             HHHHHHHHHHHHHHHc----CceecccchheeEEec------------------------CCCEEEeechH
Confidence            3444444444444454    4899999999999986                        46799999953


No 421
>KOG1164|consensus
Probab=86.34  E-value=1  Score=38.31  Aligned_cols=36  Identities=22%  Similarity=0.395  Sum_probs=26.6

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ...+.|+|++|+|+++......                   ....+.+|||-.|.
T Consensus       140 ~~G~iHRDiKp~N~~~g~~~~~-------------------~~~~~~llDfGlar  175 (322)
T KOG1164|consen  140 SKGFIHRDIKPENFVVGQSSRS-------------------EVRTLYLLDFGLAR  175 (322)
T ss_pred             hcCcccCCcCHHHeeecCCCCc-------------------ccceEEEEecCCCc
Confidence            4679999999999999863211                   12569999996554


No 422
>KOG1035|consensus
Probab=85.74  E-value=0.94  Score=45.76  Aligned_cols=17  Identities=29%  Similarity=0.432  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      .++.|+||+|.||.++.
T Consensus       716 ~giIHRDLKP~NIFLd~  732 (1351)
T KOG1035|consen  716 QGIIHRDLKPRNIFLDS  732 (1351)
T ss_pred             CceeeccCCcceeEEcC
Confidence            34999999999999986


No 423
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=85.43  E-value=0.88  Score=38.10  Aligned_cols=16  Identities=19%  Similarity=0.493  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|+++.|||+..
T Consensus       121 ~ivHrDlkp~Nill~~  136 (328)
T cd08226         121 GYIHRNIKASHILISG  136 (328)
T ss_pred             CeecCCCCHHHEEEeC
Confidence            5899999999999975


No 424
>KOG0586|consensus
Probab=85.26  E-value=0.9  Score=42.56  Aligned_cols=31  Identities=32%  Similarity=0.701  Sum_probs=26.3

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      -.+||+||+..|||++.                        +..+.+-||+++..
T Consensus       174 k~ivHrdLk~eNilL~~------------------------~mnikIaDfgfS~~  204 (596)
T KOG0586|consen  174 KNIVHRDLKAENILLDE------------------------NMNIKIADFGFSTF  204 (596)
T ss_pred             cceeccccchhhccccc------------------------ccceeeecccccee
Confidence            46999999999999986                        34489999998874


No 425
>KOG0659|consensus
Probab=85.15  E-value=1.1  Score=38.54  Aligned_cols=16  Identities=31%  Similarity=0.466  Sum_probs=14.3

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      -+-|+|++|+|+|++.
T Consensus       121 ~IlHRDlKPnNLLis~  136 (318)
T KOG0659|consen  121 WILHRDLKPNNLLISS  136 (318)
T ss_pred             hhhcccCCccceEEcC
Confidence            4679999999999986


No 426
>KOG0032|consensus
Probab=85.01  E-value=1.1  Score=39.84  Aligned_cols=38  Identities=21%  Similarity=0.358  Sum_probs=29.4

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      ..++|.|++|.|+|+.....+                    ...+.++||--|....+
T Consensus       154 ~gvvHrDlKpEN~L~~~~~~~--------------------~~~ik~~DFGla~~~~~  191 (382)
T KOG0032|consen  154 LGVVHRDLKPENLLLASKDEG--------------------SGRIKLIDFGLAKFIKP  191 (382)
T ss_pred             CCceeccCCHHHeeeccccCC--------------------CCcEEEeeCCCceEccC
Confidence            779999999999999873221                    24799999987776555


No 427
>KOG0579|consensus
Probab=84.31  E-value=0.53  Score=45.14  Aligned_cols=16  Identities=44%  Similarity=0.673  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      -+.|+||+.||||++-
T Consensus       150 ~iIHRDLKAGNiL~Tl  165 (1187)
T KOG0579|consen  150 NIIHRDLKAGNILLTL  165 (1187)
T ss_pred             chhhhhccccceEEEe
Confidence            4789999999999986


No 428
>KOG0605|consensus
Probab=83.87  E-value=1.3  Score=40.96  Aligned_cols=31  Identities=19%  Similarity=0.424  Sum_probs=26.7

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ...+.|+|++|.|+|++.                        .+-|+|=||=.|.
T Consensus       259 ~~gyIHRDIKPdNlLiD~------------------------~GHiKLSDFGLs~  289 (550)
T KOG0605|consen  259 QLGYIHRDIKPDNLLIDA------------------------KGHIKLSDFGLST  289 (550)
T ss_pred             HcCcccccCChhheeecC------------------------CCCEeeccccccc
Confidence            467999999999999986                        4779999998874


No 429
>KOG4236|consensus
Probab=83.71  E-value=1.6  Score=41.07  Aligned_cols=33  Identities=21%  Similarity=0.383  Sum_probs=26.3

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      -+.|+||+|.|+|+...                     ..=.+++|-||-||..
T Consensus       684 nIvHCDLKPENVLLas~---------------------~~FPQvKlCDFGfARi  716 (888)
T KOG4236|consen  684 NIVHCDLKPENVLLASA---------------------SPFPQVKLCDFGFARI  716 (888)
T ss_pred             ceeeccCCchheeeccC---------------------CCCCceeeccccceee
Confidence            47899999999999762                     1236799999988764


No 430
>KOG0577|consensus
Probab=83.55  E-value=0.5  Score=44.85  Aligned_cols=35  Identities=31%  Similarity=0.298  Sum_probs=26.9

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA   85 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~   85 (174)
                      ....|+|++.||||+++                        ++-+.|-||--|++..|+
T Consensus       145 ~~~IHRDiKAGNILLse------------------------~g~VKLaDFGSAsi~~PA  179 (948)
T KOG0577|consen  145 HNRIHRDIKAGNILLSE------------------------PGLVKLADFGSASIMAPA  179 (948)
T ss_pred             hhHHhhhccccceEecC------------------------CCeeeeccccchhhcCch
Confidence            35789999999999987                        466788888776665443


No 431
>KOG0591|consensus
Probab=82.98  E-value=2.2  Score=37.26  Aligned_cols=40  Identities=28%  Similarity=0.288  Sum_probs=26.2

Q ss_pred             cchhhHHHHHHHHHHHHhhcCC--Ce-eeeeccCCCCCeeecC
Q psy15664          4 ILSKDLNTEADWLKKHLLKIKS--PV-TFCHNDLQEGNILYRE   43 (174)
Q Consensus         4 ~~~~~L~~e~~~l~~~l~~~~~--~~-v~cHNDl~~gNiL~~~   43 (174)
                      |+...+.+=+..|-..|....+  |. .+-|+|++|+||.++.
T Consensus       121 ipE~~Vwk~f~QL~~AL~~cH~~~~r~~VmHRDIKPaNIFl~~  163 (375)
T KOG0591|consen  121 IPEKTVWKYFVQLCRALYHCHSKIPRGTVMHRDIKPANIFLTA  163 (375)
T ss_pred             CchHHHHHHHHHHHHHHHHHhccccccceeeccCcchheEEcC
Confidence            3444444444555555555544  33 5789999999999986


No 432
>KOG0671|consensus
Probab=82.51  E-value=2.7  Score=37.68  Aligned_cols=50  Identities=26%  Similarity=0.319  Sum_probs=28.4

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCC-CCCCCCCCCCceEEEeeeccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNN-VNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      .+.+.|-||+|.|||+..+.-.+.     -.... +--........|++|||--|.
T Consensus       210 ~~kl~HTDLKPENILfvss~~~~~-----~~~k~~~~~~r~~ks~~I~vIDFGsAt  260 (415)
T KOG0671|consen  210 DLKLTHTDLKPENILFVSSEYFKT-----YNPKKKVCFIRPLKSTAIKVIDFGSAT  260 (415)
T ss_pred             hcceeecCCChheEEEeccceEEE-----eccCCccceeccCCCcceEEEecCCcc
Confidence            356999999999999986311100     00000 000122345679999996443


No 433
>KOG0663|consensus
Probab=82.38  E-value=2.3  Score=37.86  Aligned_cols=17  Identities=29%  Similarity=0.421  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      .-+.|+||++.|+|++.
T Consensus       196 ~wilHRDLK~SNLLm~~  212 (419)
T KOG0663|consen  196 NWILHRDLKTSNLLLSH  212 (419)
T ss_pred             ceeEecccchhheeecc
Confidence            45889999999999986


No 434
>KOG0612|consensus
Probab=81.08  E-value=2.1  Score=43.22  Aligned_cols=19  Identities=26%  Similarity=0.613  Sum_probs=16.6

Q ss_pred             CeeeeeccCCCCCeeecCC
Q psy15664         26 PVTFCHNDLQEGNILYRES   44 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~   44 (174)
                      ...+.|+|++|.|||++..
T Consensus       193 ~mgyVHRDiKPDNvLld~~  211 (1317)
T KOG0612|consen  193 SMGYVHRDIKPDNVLLDKS  211 (1317)
T ss_pred             hccceeccCCcceeEeccc
Confidence            4679999999999999864


No 435
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=80.02  E-value=2.1  Score=42.70  Aligned_cols=16  Identities=31%  Similarity=0.478  Sum_probs=14.5

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+||+|.|||+..
T Consensus       145 ~IVHRDLKPeNILL~s  160 (1021)
T PTZ00266        145 RVLHRDLKPQNIFLST  160 (1021)
T ss_pred             CceeccCcHHHeEeec
Confidence            4899999999999975


No 436
>PHA03111 Ser/Thr kinase; Provisional
Probab=79.96  E-value=3.1  Score=37.24  Aligned_cols=22  Identities=36%  Similarity=0.436  Sum_probs=18.1

Q ss_pred             cCCCeeeeeccCCCCCeeecCC
Q psy15664         23 IKSPVTFCHNDLQEGNILYRES   44 (174)
Q Consensus        23 ~~~~~v~cHNDl~~gNiL~~~~   44 (174)
                      .+..--|.|+||+|.|||+-++
T Consensus       298 lp~c~nF~H~DLKPdNILiFds  319 (444)
T PHA03111        298 LPCCDNFLHVDLKPDNILIFDS  319 (444)
T ss_pred             CCCcceeeeccCCCCcEEEecC
Confidence            3444579999999999999985


No 437
>KOG0694|consensus
Probab=79.41  E-value=2.1  Score=40.81  Aligned_cols=56  Identities=20%  Similarity=0.202  Sum_probs=42.7

Q ss_pred             HHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHH
Q psy15664         10 NTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIA   89 (174)
Q Consensus        10 ~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDla   89 (174)
                      ..|+....++|...+    +.++||+..|||++.                        ++-++|.||=.|--+--.-|-+
T Consensus       474 aAev~l~L~fLH~~~----IIYRDlKLdNiLLD~------------------------eGh~kiADFGlcKe~m~~g~~T  525 (694)
T KOG0694|consen  474 AAEVVLGLQFLHENG----IIYRDLKLDNLLLDT------------------------EGHVKIADFGLCKEGMGQGDRT  525 (694)
T ss_pred             HHHHHHHHHHHHhcC----ceeeecchhheEEcc------------------------cCcEEecccccccccCCCCCcc
Confidence            357777777776644    889999999999986                        5778999998887766555666


Q ss_pred             HHHH
Q psy15664         90 NHFV   93 (174)
Q Consensus        90 n~f~   93 (174)
                      +.||
T Consensus       526 sTfC  529 (694)
T KOG0694|consen  526 STFC  529 (694)
T ss_pred             cccc
Confidence            6665


No 438
>KOG0590|consensus
Probab=79.40  E-value=1.7  Score=40.86  Aligned_cols=20  Identities=30%  Similarity=0.499  Sum_probs=17.4

Q ss_pred             CCeeeeeccCCCCCeeecCC
Q psy15664         25 SPVTFCHNDLQEGNILYRES   44 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~   44 (174)
                      ...+++|+|+++.|+++..+
T Consensus       437 h~~GiahrdlK~enll~~~~  456 (601)
T KOG0590|consen  437 HSMGLAHRDLKLENLLVTEN  456 (601)
T ss_pred             HhcCceeccCccccEEEecC
Confidence            45789999999999999873


No 439
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=79.27  E-value=3.1  Score=33.49  Aligned_cols=15  Identities=33%  Similarity=0.541  Sum_probs=13.2

Q ss_pred             eeeccCCCCCeeecC
Q psy15664         29 FCHNDLQEGNILYRE   43 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~   43 (174)
                      ++|+||.+.||+++.
T Consensus       124 iiH~~l~~~nill~~  138 (259)
T PF07714_consen  124 IIHGNLSPSNILLDS  138 (259)
T ss_dssp             EEEST-SGGGEEEET
T ss_pred             ccccccccccccccc
Confidence            899999999999986


No 440
>KOG0665|consensus
Probab=79.20  E-value=1.2  Score=39.25  Aligned_cols=36  Identities=22%  Similarity=0.380  Sum_probs=26.5

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccch
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRA   85 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~   85 (174)
                      ...+.|+||+|.||++..                        +..+.+.||=+|.--...
T Consensus       136 s~~IihRdLkPsnivv~~------------------------~~~lKi~dfg~ar~e~~~  171 (369)
T KOG0665|consen  136 SAGIIHRDLKPSNIVVNS------------------------DCTLKILDFGLARTEDTD  171 (369)
T ss_pred             hcceeecccCcccceecc------------------------hhheeeccchhhcccCcc
Confidence            457999999999999986                        355777777776544333


No 441
>KOG0192|consensus
Probab=78.73  E-value=2.9  Score=36.82  Aligned_cols=17  Identities=35%  Similarity=0.448  Sum_probs=15.5

Q ss_pred             eeeccCCCCCeeecCCC
Q psy15664         29 FCHNDLQEGNILYRESP   45 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~   45 (174)
                      +.|+||++.|||+....
T Consensus       164 iIHrDLK~~NiLv~~~~  180 (362)
T KOG0192|consen  164 IIHRDLKSDNILVDLKG  180 (362)
T ss_pred             eeecccChhhEEEcCCC
Confidence            99999999999999853


No 442
>KOG0664|consensus
Probab=78.58  E-value=1.5  Score=38.14  Aligned_cols=30  Identities=30%  Similarity=0.511  Sum_probs=23.7

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      -.+-|+|++|||+|++.                        +--+++-||-.+.
T Consensus       175 A~ILHRDIKPGNLLVNS------------------------NCvLKICDFGLAR  204 (449)
T KOG0664|consen  175 ANILHRDIKPGNLLVNS------------------------NCILKICDFGLAR  204 (449)
T ss_pred             cchhhccCCCccEEecc------------------------CceEEeccccccc
Confidence            35789999999999986                        2458888887654


No 443
>KOG1027|consensus
Probab=78.38  E-value=2.4  Score=41.35  Aligned_cols=17  Identities=35%  Similarity=0.528  Sum_probs=15.9

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      +-+.|+||+|.|||+..
T Consensus       625 l~iVHRDLkPQNILI~~  641 (903)
T KOG1027|consen  625 LKIVHRDLKPQNILISV  641 (903)
T ss_pred             cccccccCCCceEEEEc
Confidence            78999999999999986


No 444
>KOG1151|consensus
Probab=78.32  E-value=4.1  Score=37.79  Aligned_cols=17  Identities=41%  Similarity=0.628  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecCC
Q psy15664         28 TFCHNDLQEGNILYRES   44 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~   44 (174)
                      -+.|=||+|||||+-++
T Consensus       590 PIIHYDLKPgNILLv~G  606 (775)
T KOG1151|consen  590 PIIHYDLKPGNILLVNG  606 (775)
T ss_pred             CeeeeccCCccEEEecC
Confidence            36899999999999864


No 445
>KOG0193|consensus
Probab=76.81  E-value=2.4  Score=40.08  Aligned_cols=17  Identities=35%  Similarity=0.585  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      .-+.|.||+.+||++.+
T Consensus       507 K~IIHrDLKSnNIFl~~  523 (678)
T KOG0193|consen  507 KNIIHRDLKSNNIFLHE  523 (678)
T ss_pred             hhhhhhhccccceEEcc
Confidence            35899999999999987


No 446
>KOG0600|consensus
Probab=76.25  E-value=4.4  Score=37.63  Aligned_cols=18  Identities=28%  Similarity=0.418  Sum_probs=15.7

Q ss_pred             CeeeeeccCCCCCeeecC
Q psy15664         26 PVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~   43 (174)
                      ...+-|+|++..|||+++
T Consensus       236 ~~gvlHRDIK~SNiLidn  253 (560)
T KOG0600|consen  236 SRGVLHRDIKGSNILIDN  253 (560)
T ss_pred             hcCeeeccccccceEEcC
Confidence            346889999999999987


No 447
>PF05445 Pox_ser-thr_kin:  Poxvirus serine/threonine protein kinase;  InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly. ; GO: 0004672 protein kinase activity, 0005524 ATP binding
Probab=76.19  E-value=2.7  Score=37.68  Aligned_cols=23  Identities=35%  Similarity=0.450  Sum_probs=18.5

Q ss_pred             cCCCeeeeeccCCCCCeeecCCC
Q psy15664         23 IKSPVTFCHNDLQEGNILYRESP   45 (174)
Q Consensus        23 ~~~~~v~cHNDl~~gNiL~~~~~   45 (174)
                      .+..--|.|+||+|.|||+-++.
T Consensus       294 lp~c~nF~H~DLKPdNILiFds~  316 (434)
T PF05445_consen  294 LPCCTNFLHVDLKPDNILIFDSK  316 (434)
T ss_pred             CCCcceeeecccCcCcEEEecCC
Confidence            34445799999999999998853


No 448
>KOG0661|consensus
Probab=75.86  E-value=1.5  Score=40.29  Aligned_cols=19  Identities=37%  Similarity=0.485  Sum_probs=16.4

Q ss_pred             CCeeeeeccCCCCCeeecC
Q psy15664         25 SPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~   43 (174)
                      ..-.|-|+|++|.|||+..
T Consensus       127 Hk~GfFHRDlKPENiLi~~  145 (538)
T KOG0661|consen  127 HKHGFFHRDLKPENILISG  145 (538)
T ss_pred             HhcCcccccCChhheEecc
Confidence            3457999999999999984


No 449
>KOG0575|consensus
Probab=75.52  E-value=3.5  Score=38.71  Aligned_cols=17  Identities=35%  Similarity=0.655  Sum_probs=15.4

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      ..+.|+||+.|||++++
T Consensus       137 ~~IiHRDLKLGNlfL~~  153 (592)
T KOG0575|consen  137 LGIIHRDLKLGNLFLNE  153 (592)
T ss_pred             cCceecccchhheeecC
Confidence            45899999999999987


No 450
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=75.26  E-value=4.6  Score=31.30  Aligned_cols=16  Identities=31%  Similarity=0.515  Sum_probs=14.7

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .++|+|++|.||++..
T Consensus       121 ~~~hrd~kp~nil~~~  136 (384)
T COG0515         121 GIIHRDIKPENILLDR  136 (384)
T ss_pred             CeeccCCCHHHeeecC
Confidence            3999999999999986


No 451
>KOG0585|consensus
Probab=74.27  E-value=2  Score=39.66  Aligned_cols=17  Identities=24%  Similarity=0.493  Sum_probs=15.2

Q ss_pred             eeeeccCCCCCeeecCC
Q psy15664         28 TFCHNDLQEGNILYRES   44 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~   44 (174)
                      .+.|+|++|.|+|+...
T Consensus       230 giiHRDIKPsNLLl~~~  246 (576)
T KOG0585|consen  230 GIIHRDIKPSNLLLSSD  246 (576)
T ss_pred             CeeccccchhheEEcCC
Confidence            58999999999999873


No 452
>KOG1989|consensus
Probab=73.97  E-value=3.6  Score=39.74  Aligned_cols=34  Identities=21%  Similarity=0.274  Sum_probs=25.6

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      .=+.|+||+-.|||+..                        ++..+|-||==|+-..+
T Consensus       165 pPiIHRDLKiENvLls~------------------------~g~~KLCDFGSatt~~~  198 (738)
T KOG1989|consen  165 PPIIHRDLKIENVLLSA------------------------DGNYKLCDFGSATTKIL  198 (738)
T ss_pred             CccchhhhhhhheEEcC------------------------CCCEEeCcccccccccC
Confidence            34799999999999986                        46788888865544333


No 453
>KOG0666|consensus
Probab=73.09  E-value=2.6  Score=37.25  Aligned_cols=15  Identities=40%  Similarity=0.518  Sum_probs=13.8

Q ss_pred             eeeccCCCCCeeecC
Q psy15664         29 FCHNDLQEGNILYRE   43 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~   43 (174)
                      +.|+||+|.|||+..
T Consensus       153 vlHRDLKPaNIlvmg  167 (438)
T KOG0666|consen  153 VLHRDLKPANILVMG  167 (438)
T ss_pred             eeeccCCcceEEEec
Confidence            679999999999986


No 454
>KOG3021|consensus
Probab=73.03  E-value=12  Score=31.84  Aligned_cols=40  Identities=20%  Similarity=0.272  Sum_probs=27.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhhHHHHH
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFDIANHF   92 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fDlan~f   92 (174)
                      ++.|+||+.||+-.+..                        +.-++.|- -+.|+..-||+|-..
T Consensus       211 aLlHGDLW~GNva~D~~------------------------~ePiIfDP-asfYgh~Efefgia~  250 (313)
T KOG3021|consen  211 ALLHGDLWSGNVAEDGA------------------------GEPIIFDP-ASFYGHSEFEFGIAK  250 (313)
T ss_pred             hhhccccccCcccccCC------------------------CCceEeCc-hhhcCCcHHHHHHHH
Confidence            57799999999877652                        22356564 245778888887543


No 455
>KOG1165|consensus
Probab=69.52  E-value=12  Score=33.60  Aligned_cols=34  Identities=18%  Similarity=0.301  Sum_probs=25.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      -+.-+|++|.|+|+......                   ...-|.+|||-.|-
T Consensus       144 ~LIYRDIKPdNFLIGrp~~k-------------------~~n~IhiiDFGmAK  177 (449)
T KOG1165|consen  144 DLIYRDIKPDNFLIGRPGTK-------------------DANVIHIIDFGMAK  177 (449)
T ss_pred             ceeecccCccceeecCCCCC-------------------CCceEEEEeccchh
Confidence            47789999999999763211                   34679999996554


No 456
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=67.94  E-value=8.5  Score=33.02  Aligned_cols=38  Identities=21%  Similarity=0.264  Sum_probs=23.2

Q ss_pred             HHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         14 DWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        14 ~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      -.+-+.+...+    +.|+|+++.|++++.                        ++.+.|=||...
T Consensus       155 I~lvA~Lh~~G----lVHgdi~~~nfll~~------------------------~G~v~Lg~F~~~  192 (288)
T PF14531_consen  155 IRLVANLHSYG----LVHGDIKPENFLLDQ------------------------DGGVFLGDFSSL  192 (288)
T ss_dssp             HHHHHHHHHTT----EEEST-SGGGEEE-T------------------------TS-EEE--GGGE
T ss_pred             HHHHHHHhhcc----eEecccceeeEEEcC------------------------CCCEEEcChHHH
Confidence            33444444534    999999999999986                        467888887654


No 457
>KOG1345|consensus
Probab=64.58  E-value=11  Score=32.97  Aligned_cols=31  Identities=26%  Similarity=0.420  Sum_probs=24.0

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      -+.|+||+..|||+-..                      +-.++.|-||--..
T Consensus       141 nlVHRdlK~eNiLif~~----------------------df~rvKlcDFG~t~  171 (378)
T KOG1345|consen  141 NLVHRDLKAENILIFDA----------------------DFYRVKLCDFGLTR  171 (378)
T ss_pred             chhhcccccceEEEecC----------------------CccEEEeeeccccc
Confidence            37899999999998863                      34678888885443


No 458
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st
Probab=63.44  E-value=6.5  Score=32.54  Aligned_cols=32  Identities=25%  Similarity=0.120  Sum_probs=26.9

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++.=+|-+++|||++.                       ..+.+.-|||.++-
T Consensus       135 ~YilglgDRH~~NIli~~-----------------------~tG~v~HIDfg~~f  166 (235)
T cd05172         135 HWILGIGDRHLSNFLVDL-----------------------ETGGLVGIDFGHAF  166 (235)
T ss_pred             hheeeccCCCcccEEEEC-----------------------CCCcEEEEeeHhhh
Confidence            468999999999999985                       35789999997553


No 459
>PF02604 PhdYeFM_antitox:  Antitoxin Phd_YefM, type II toxin-antitoxin system;  InterPro: IPR006442 This entry is represented by Bacteriophage P1, prevent-host-death protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family of proteins is characterised by a region of about 55 amino acids toward the N-terminal end of bacterial proteins which are themselves only 85 amino acids, or thereabouts, in length. The best-characterised member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (IPR006440 from INTERPRO) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family. ; PDB: 3DBO_A 2ODK_B 3G5O_D 2A6Q_B 3D55_C 3OEI_E 3CTO_C 3K33_D 3KH2_F 3HS2_C ....
Probab=63.09  E-value=8.3  Score=25.43  Aligned_cols=33  Identities=18%  Similarity=0.229  Sum_probs=28.4

Q ss_pred             CCccchhhHHHHHHHHHHHHhhcCCCeeeeecc
Q psy15664          1 MKKILSKDLNTEADWLKKHLLKIKSPVTFCHND   33 (174)
Q Consensus         1 ~~~~~~~~L~~e~~~l~~~l~~~~~~~v~cHND   33 (174)
                      |+.++..++++.+..+.+.+...+.|+++..|.
T Consensus         1 M~~vs~~e~r~~~~~~l~~v~~~~~pv~It~~g   33 (75)
T PF02604_consen    1 MKTVSITEFRNNFSELLDEVEEGEEPVIITKNG   33 (75)
T ss_dssp             CEEEEHHHHHHTHHHHHHHHHHCT-EEEEEETT
T ss_pred             CCEecHHHHHHHHHHHHHHHHcCCCeEEEEECC
Confidence            789999999999999999999888889887764


No 460
>KOG0584|consensus
Probab=62.60  E-value=11  Score=35.61  Aligned_cols=17  Identities=29%  Similarity=0.446  Sum_probs=14.9

Q ss_pred             eeeeccCCCCCeeecCC
Q psy15664         28 TFCHNDLQEGNILYRES   44 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~   44 (174)
                      -+.|+||++.||+++.+
T Consensus       165 PIIHRDLKCDNIFinG~  181 (632)
T KOG0584|consen  165 PIIHRDLKCDNIFVNGN  181 (632)
T ss_pred             CccccccccceEEEcCC
Confidence            36899999999999874


No 461
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the 
Probab=61.82  E-value=5.5  Score=32.35  Aligned_cols=35  Identities=20%  Similarity=0.163  Sum_probs=28.3

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCcc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNY   83 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   83 (174)
                      ..++.=+|-+++|||++.                       .++.+.-|||.++--..
T Consensus       127 ~YilglgDRh~~NIli~~-----------------------~~G~~~hIDfg~~~~~~  161 (219)
T cd00142         127 GYILGIGDRHPDNIMIDL-----------------------DTGKLFHIDFGFIFGKR  161 (219)
T ss_pred             HHHhccCCCCCccEEEEC-----------------------CCCeEEEEeeHHhhCcC
Confidence            457888999999999997                       35889999998764333


No 462
>KOG2270|consensus
Probab=61.41  E-value=7.5  Score=35.39  Aligned_cols=18  Identities=39%  Similarity=0.665  Sum_probs=16.0

Q ss_pred             CeeeeeccCCCCCeeecC
Q psy15664         26 PVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~   43 (174)
                      ...+.|-||-.-|+|+.+
T Consensus       283 ~c~LVHADLSEfN~Lyhd  300 (520)
T KOG2270|consen  283 KCRLVHADLSEFNLLYHD  300 (520)
T ss_pred             HhceeccchhhhhheEEC
Confidence            356999999999999997


No 463
>KOG0574|consensus
Probab=61.11  E-value=2.7  Score=37.15  Aligned_cols=15  Identities=40%  Similarity=0.656  Sum_probs=13.5

Q ss_pred             eeeccCCCCCeeecC
Q psy15664         29 FCHNDLQEGNILYRE   43 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~   43 (174)
                      =.|+|++.||||++.
T Consensus       150 KIHRDIKAGNILLNT  164 (502)
T KOG0574|consen  150 KIHRDIKAGNILLNT  164 (502)
T ss_pred             HHHhhcccccEEEcc
Confidence            479999999999986


No 464
>KOG2269|consensus
Probab=60.51  E-value=8.6  Score=34.61  Aligned_cols=50  Identities=20%  Similarity=0.294  Sum_probs=37.1

Q ss_pred             cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeec
Q psy15664          4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEY   78 (174)
Q Consensus         4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY   78 (174)
                      |+-+++..-+..+...+.+.-....+.|-||..-|||...                         +++.|||---
T Consensus       380 l~d~E~~~aY~q~~~~M~~lY~Ec~LVHADlSEyN~Lw~~-------------------------gKvw~IDVsQ  429 (531)
T KOG2269|consen  380 LTDDERRNAYDQVQSIMCRLYKECLLVHADLSEYNLLWTP-------------------------GKVWVIDVSQ  429 (531)
T ss_pred             cChHHHHHHHHHHHHHHHHHHHhhheeecchhhhhheecC-------------------------CceEEEechh
Confidence            4455555555555555555556678999999999999987                         6899999643


No 465
>KOG0662|consensus
Probab=60.33  E-value=5.2  Score=32.97  Aligned_cols=13  Identities=38%  Similarity=0.657  Sum_probs=11.6

Q ss_pred             eccCCCCCeeecC
Q psy15664         31 HNDLQEGNILYRE   43 (174)
Q Consensus        31 HNDl~~gNiL~~~   43 (174)
                      |+||+|.|+|++.
T Consensus       124 hrdlkpqnllin~  136 (292)
T KOG0662|consen  124 HRDLKPQNLLINR  136 (292)
T ss_pred             hccCCcceEEecc
Confidence            4799999999986


No 466
>KOG1240|consensus
Probab=59.55  E-value=4.4  Score=41.12  Aligned_cols=19  Identities=32%  Similarity=0.656  Sum_probs=16.4

Q ss_pred             CCeeeeeccCCCCCeeecC
Q psy15664         25 SPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~   43 (174)
                      .+..+||+|++..|||++.
T Consensus       137 H~~gVcHGDIKsENILiTS  155 (1431)
T KOG1240|consen  137 HKLGVCHGDIKSENILITS  155 (1431)
T ss_pred             HHcCccccccccceEEEee
Confidence            4567999999999999874


No 467
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno
Probab=57.97  E-value=7.1  Score=33.55  Aligned_cols=30  Identities=23%  Similarity=0.360  Sum_probs=25.8

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .|+.=+|-+++|||++.                       ..+.++-|||.++
T Consensus       209 yilglgDRh~~NIli~~-----------------------~tG~v~hiDf~~~  238 (307)
T cd05170         209 YVIGLGDRHLDNVLIDL-----------------------KTGEVVHIDYNVC  238 (307)
T ss_pred             HHccCCCCCCccEEEEc-----------------------CCCcEEEEeeHhh
Confidence            57888999999999996                       3578999999764


No 468
>KOG1290|consensus
Probab=57.77  E-value=9.2  Score=35.58  Aligned_cols=43  Identities=14%  Similarity=0.140  Sum_probs=30.9

Q ss_pred             CccchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecCC
Q psy15664          2 KKILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRES   44 (174)
Q Consensus         2 ~~~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~~   44 (174)
                      +.|++..+++=...+..-|......+.+.|-||+|.|||+.-+
T Consensus       182 rGlpl~~VK~I~~qvL~GLdYLH~ecgIIHTDlKPENvLl~~~  224 (590)
T KOG1290|consen  182 RGLPLSCVKEICRQVLTGLDYLHRECGIIHTDLKPENVLLCST  224 (590)
T ss_pred             CCCcHHHHHHHHHHHHHHHHHHHHhcCccccCCCcceeeeecc
Confidence            3456666665555555555666777899999999999997643


No 469
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transi
Probab=57.66  E-value=7  Score=33.07  Aligned_cols=31  Identities=26%  Similarity=0.322  Sum_probs=26.4

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      ..++.=+|-+++|||++.                       ..+.+.-|||.++
T Consensus       180 ~yilglgDRh~~NIll~~-----------------------~tG~v~hiDf~~~  210 (279)
T cd05171         180 GYILGLGDRHANNILIDE-----------------------KTAEVVHIDLGIA  210 (279)
T ss_pred             HHhhccCCCCcccEEEEc-----------------------CcCcEEEEechhh
Confidence            357888999999999986                       3578999999875


No 470
>KOG4717|consensus
Probab=57.13  E-value=11  Score=35.59  Aligned_cols=18  Identities=28%  Similarity=0.571  Sum_probs=15.5

Q ss_pred             CeeeeeccCCCCCeeecC
Q psy15664         26 PVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~   43 (174)
                      .+-..|+||+|.|+.+-+
T Consensus       136 qLHVVHRDLKPENVVFFE  153 (864)
T KOG4717|consen  136 QLHVVHRDLKPENVVFFE  153 (864)
T ss_pred             hhhhhcccCCcceeEEee
Confidence            455779999999999987


No 471
>PF10009 DUF2252:  Uncharacterized protein conserved in bacteria (DUF2252);  InterPro: IPR018721 This domain has no known function.
Probab=56.94  E-value=18  Score=32.26  Aligned_cols=76  Identities=16%  Similarity=0.189  Sum_probs=51.0

Q ss_pred             CCCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCce--EEEeeecccCccchhhHHHHHHHHhhhccC
Q psy15664         24 KSPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDL--VVIDFEYCSYNYRAFDIANHFVESVYDYSY  101 (174)
Q Consensus        24 ~~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l--~lIDfEYa~~n~~~fDlan~f~E~~~dy~~  101 (174)
                      ..+.|.+++|+|.+|+=.-.+++                      +.+  -+=||+=+.++|..|||--.......    
T Consensus        40 ~~~~v~icGD~Hl~NFG~~~~~~----------------------~~~vFdiNDFDEa~~gp~~wDl~Rla~Si~l----   93 (385)
T PF10009_consen   40 SGPPVWICGDAHLENFGAFASPE----------------------GRVVFDINDFDEALPGPFEWDLKRLATSIVL----   93 (385)
T ss_pred             CCCceEEeccchhhccCcccCCC----------------------CCEEecCCCCCcCCcCChHHHHHHHHHHHHH----
Confidence            35789999999999998776432                      233  24589999999999999666554331    


Q ss_pred             CCCCcccccCCCCCCH---HHHHHHHHHHHhcc
Q psy15664        102 KHFPHYTVKRENYPSY---SLRKSFVETYLSRM  131 (174)
Q Consensus       102 ~~~p~~~~~~~~~p~~---~~~~~fl~~Yl~~~  131 (174)
                            ......++..   +....|+++|...+
T Consensus        94 ------aa~~~gl~~~~~~~~~~~~~~~Y~~~l  120 (385)
T PF10009_consen   94 ------AARENGLSDKDARKAVRAFLEGYREAL  120 (385)
T ss_pred             ------HHHHcCCCHHHHHHHHHHHHHHHHHHH
Confidence                  1122334332   33568888888765


No 472
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with 
Probab=56.77  E-value=8.1  Score=32.52  Aligned_cols=31  Identities=23%  Similarity=0.311  Sum_probs=26.1

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      ..++.=+|-|++|||++.                       ..+.++-|||.++
T Consensus       180 ~YilglgDRH~~NIll~~-----------------------~tG~v~HIDfg~~  210 (280)
T cd05169         180 GYILGLGDRHPSNIMIDR-----------------------LTGKVIHIDFGDC  210 (280)
T ss_pred             HhheeccCCCcceEEEEc-----------------------CCCCEEEEecHHH
Confidence            467899999999999997                       4588999999644


No 473
>KOG0597|consensus
Probab=56.63  E-value=13  Score=35.52  Aligned_cols=39  Identities=21%  Similarity=0.248  Sum_probs=23.6

Q ss_pred             cchhhHHHHHHHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664          4 ILSKDLNTEADWLKKHLLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus         4 ~~~~~L~~e~~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      ++.+.+++=..-|-..+.... ...+.|+|++|-|||+..
T Consensus        97 lpEe~v~~~a~~LVsaL~yLh-s~rilhrd~kPqniLl~~  135 (808)
T KOG0597|consen   97 LPEEQVRAIAYDLVSALYYLH-SNRILHRDMKPQNILLEK  135 (808)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH-hcCcccccCCcceeeecC
Confidence            444444433333333343332 245889999999999986


No 474
>KOG4158|consensus
Probab=56.14  E-value=17  Score=33.45  Aligned_cols=21  Identities=29%  Similarity=0.423  Sum_probs=16.8

Q ss_pred             eeeeeccCCCCCeeecCCCCC
Q psy15664         27 VTFCHNDLQEGNILYRESPNN   47 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~   47 (174)
                      -.+.|+||++.|||+.-.++.
T Consensus       360 hgvAhRDlKSDNiL~ElddD~  380 (598)
T KOG4158|consen  360 HGVAHRDLKSDNILLELDDDE  380 (598)
T ss_pred             ccchhhcccccceEEEecCCC
Confidence            468999999999998765443


No 475
>KOG0587|consensus
Probab=55.88  E-value=18  Score=35.80  Aligned_cols=17  Identities=29%  Similarity=0.485  Sum_probs=15.2

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      .-..|+|++-.|||++.
T Consensus       142 nkviHRDikG~NiLLT~  158 (953)
T KOG0587|consen  142 NKVIHRDIKGQNVLLTE  158 (953)
T ss_pred             cceeeecccCceEEEec
Confidence            45789999999999987


No 476
>KOG2052|consensus
Probab=53.05  E-value=17  Score=33.50  Aligned_cols=25  Identities=24%  Similarity=0.391  Sum_probs=20.2

Q ss_pred             cCCCeeeeeccCCCCCeeecCCCCC
Q psy15664         23 IKSPVTFCHNDLQEGNILYRESPNN   47 (174)
Q Consensus        23 ~~~~~v~cHNDl~~gNiL~~~~~~~   47 (174)
                      .+.+-.+.|+||++.|||+..+...
T Consensus       331 TqgKPaIAHRDlKSKNILVKkn~~C  355 (513)
T KOG2052|consen  331 TQGKPAIAHRDLKSKNILVKKNGTC  355 (513)
T ss_pred             CCCCchhhccccccccEEEccCCcE
Confidence            3466789999999999999876443


No 477
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central 
Probab=53.04  E-value=9  Score=31.68  Aligned_cols=32  Identities=28%  Similarity=0.342  Sum_probs=26.5

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..++.=+|-+++|||++.                       ..+.+.-|||.++-
T Consensus       138 ~YilgigDRh~~NIli~~-----------------------~tG~~~HIDfg~~~  169 (237)
T cd00892         138 GYILGLGDRHGENILFDS-----------------------NTGDVVHVDFNCLF  169 (237)
T ss_pred             HHHhccCCCCcccEEEEc-----------------------CCCcEEEEehHhhh
Confidence            357888999999999987                       35789999997654


No 478
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members include ATM (Ataxia telangiectasia mutated), ATR (Ataxia telangiectasia and Rad3-related), TOR (Target of rapamycin), SMG-1 (Suppressor of morphogenetic effect on genitalia-1), and DNA-PK (DNA-dependent protein kinase). PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). They show strong preference for phosphorylating serine/threonine residues followed by a glutamine and are also referred to as (S/T)-Q-directed kinases. They all contain a FATC (FRAP, ATM and TRRAP, C-terminal) d
Probab=52.88  E-value=8.3  Score=31.55  Aligned_cols=32  Identities=25%  Similarity=0.217  Sum_probs=26.5

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeeccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCS   80 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   80 (174)
                      ..|+.=+|-+++|||++.                       ..+.+.-|||-++-
T Consensus       130 ~YvlglgDRh~~NIli~~-----------------------~tG~v~hIDf~~~~  161 (222)
T cd05164         130 GYILGLGDRHLDNILIDR-----------------------ETGEVVHIDFGCIF  161 (222)
T ss_pred             HHHhccCCCCCceEEEEC-----------------------CCCcEEEEccHHhh
Confidence            357888999999999997                       45789999997653


No 479
>KOG0201|consensus
Probab=52.68  E-value=16  Score=33.38  Aligned_cols=29  Identities=31%  Similarity=0.435  Sum_probs=23.6

Q ss_pred             eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      -.|+|++..|||+..                        ++.++|-||-+++.
T Consensus       132 kiHrDIKaanil~s~------------------------~g~vkl~DfgVa~q  160 (467)
T KOG0201|consen  132 KIHRDIKAANILLSE------------------------SGDVKLADFGVAGQ  160 (467)
T ss_pred             eecccccccceeEec------------------------cCcEEEEecceeee
Confidence            579999999999987                        35678888877764


No 480
>KOG0611|consensus
Probab=52.51  E-value=7.4  Score=35.74  Aligned_cols=17  Identities=35%  Similarity=0.468  Sum_probs=14.7

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      -...|+||+..|||++.
T Consensus       172 nrVvHRDLKLENILLD~  188 (668)
T KOG0611|consen  172 NRVVHRDLKLENILLDQ  188 (668)
T ss_pred             ccceecccchhheeecC
Confidence            34679999999999987


No 481
>KOG1152|consensus
Probab=52.00  E-value=20  Score=34.21  Aligned_cols=33  Identities=24%  Similarity=0.428  Sum_probs=27.6

Q ss_pred             CCeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      ....+.|+|++-.|+++..                        ++-++||||--|++
T Consensus       687 h~~~ivhrdikdenvivd~------------------------~g~~klidfgsaa~  719 (772)
T KOG1152|consen  687 HDQGIVHRDIKDENVIVDS------------------------NGFVKLIDFGSAAY  719 (772)
T ss_pred             cccCceecccccccEEEec------------------------CCeEEEeeccchhh
Confidence            3467999999999999986                        57899999976665


No 482
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=51.02  E-value=9.7  Score=31.06  Aligned_cols=36  Identities=22%  Similarity=0.505  Sum_probs=26.3

Q ss_pred             eeeeeccCCC--CCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccchhh
Q psy15664         27 VTFCHNDLQE--GNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYRAFD   87 (174)
Q Consensus        27 ~v~cHNDl~~--gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~~fD   87 (174)
                      ..+-|+.++-  .|||+.+                         +++++||||-|+++-..=-
T Consensus       124 ~GI~H~El~~~~k~vlv~~-------------------------~~~~iIDFd~At~k~~p~N  161 (201)
T COG2112         124 LGIEHGELSRPWKNVLVND-------------------------RDVYIIDFDSATFKKKPRN  161 (201)
T ss_pred             hccchhhhcCCceeEEecC-------------------------CcEEEEEccchhhccCCch
Confidence            4678888875  4777754                         5899999999986544433


No 483
>KOG0580|consensus
Probab=50.99  E-value=15  Score=31.38  Aligned_cols=23  Identities=26%  Similarity=0.342  Sum_probs=16.6

Q ss_pred             HhhcCCCeeeeeccCCCCCeeecC
Q psy15664         20 LLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        20 l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      +.....+. +.|+|++|.|+|+.-
T Consensus       137 l~y~h~k~-VIhRdiKpenlLlg~  159 (281)
T KOG0580|consen  137 LLYCHLKR-VIHRDIKPENLLLGS  159 (281)
T ss_pred             HHHhccCC-cccCCCCHHHhccCC
Confidence            33444444 579999999999875


No 484
>KOG0907|consensus
Probab=50.09  E-value=34  Score=24.72  Aligned_cols=43  Identities=26%  Similarity=0.344  Sum_probs=33.5

Q ss_pred             CCceEEEeeecccCccchhhHHHHHHHHhhhccCCCCCcccccCCC
Q psy15664         68 NIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKREN  113 (174)
Q Consensus        68 ~~~l~lIDfEYa~~n~~~fDlan~f~E~~~dy~~~~~p~~~~~~~~  113 (174)
                      .+++++||| ||.+..|+==|+-.|++.+-.|..  .-.++++-+.
T Consensus        20 ~~kliVvdF-~a~wCgPCk~i~P~~~~La~~y~~--v~Flkvdvde   62 (106)
T KOG0907|consen   20 GDKLVVVDF-YATWCGPCKAIAPKFEKLAEKYPD--VVFLKVDVDE   62 (106)
T ss_pred             CCCeEEEEE-ECCCCcchhhhhhHHHHHHHHCCC--CEEEEEeccc
Confidence            368999999 999999999999999998877654  3344444443


No 485
>KOG1236|consensus
Probab=49.69  E-value=8.2  Score=35.55  Aligned_cols=18  Identities=44%  Similarity=0.750  Sum_probs=15.6

Q ss_pred             eeeccCCCCCeeecCCCC
Q psy15664         29 FCHNDLQEGNILYRESPN   46 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~~   46 (174)
                      |.|-|++||||++.-.+.
T Consensus       366 FvHaDlHPGNVlirf~~t  383 (565)
T KOG1236|consen  366 FVHADLHPGNVLIRFNKT  383 (565)
T ss_pred             ceecccCCCcEEEEecCC
Confidence            899999999999987543


No 486
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phosphoinositide 3-kinase isoforms participate in a variety of processes,  including cell motility, the Ras pathway, vesicle trafficking and  secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
Probab=49.52  E-value=13  Score=29.66  Aligned_cols=35  Identities=23%  Similarity=0.224  Sum_probs=27.5

Q ss_pred             CeeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664         26 PVTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      ..++.=+|-+++|||++.                        .+.+.=|||.++--..+
T Consensus       100 ~YilglgDRh~~NIli~~------------------------~G~v~hIDfg~~~~~~~  134 (202)
T smart00146      100 TYILGLGDRHNDNIMLDK------------------------TGHLFHIDFGFILGNGP  134 (202)
T ss_pred             HHHhcCCCCCCCcEEEeC------------------------CCCEEEEechhhhCccc
Confidence            357788999999999984                        47899999987664443


No 487
>KOG2464|consensus
Probab=49.15  E-value=18  Score=29.83  Aligned_cols=30  Identities=33%  Similarity=0.372  Sum_probs=22.7

Q ss_pred             HHHHHHHhhcCCCeeeeeccCCCCCeeecC
Q psy15664         14 DWLKKHLLKIKSPVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        14 ~~l~~~l~~~~~~~v~cHNDl~~gNiL~~~   43 (174)
                      ..+...+...+....+-|+|++.||||+..
T Consensus       144 ~q~~~~l~i~~~~~~~~hrdl~~gnili~k  173 (246)
T KOG2464|consen  144 WQLVLSLAIAEKSLGFEHRDLHLGNILIKK  173 (246)
T ss_pred             HHHHHHHHHhhhhhcccccccCcCcEEEec
Confidence            333344445567788999999999999987


No 488
>KOG3653|consensus
Probab=49.11  E-value=34  Score=31.74  Aligned_cols=23  Identities=22%  Similarity=0.362  Sum_probs=18.5

Q ss_pred             CCeeeeeccCCCCCeeecCCCCC
Q psy15664         25 SPVTFCHNDLQEGNILYRESPNN   47 (174)
Q Consensus        25 ~~~v~cHNDl~~gNiL~~~~~~~   47 (174)
                      .+-.+.|+|+++.|||+.++...
T Consensus       333 ~Kp~IaHRDlkSkNVLvK~DlTc  355 (534)
T KOG3653|consen  333 HKPPIAHRDLKSKNVLVKNDLTC  355 (534)
T ss_pred             CCCccccccccccceEEccCCcE
Confidence            45679999999999999875433


No 489
>KOG0589|consensus
Probab=44.68  E-value=15  Score=33.32  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=15.6

Q ss_pred             CeeeeeccCCCCCeeecC
Q psy15664         26 PVTFCHNDLQEGNILYRE   43 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~   43 (174)
                      ..-+-|+||++.||+++.
T Consensus       124 ~~~iLHRDlK~~Nifltk  141 (426)
T KOG0589|consen  124 ENRVLHRDLKCANIFLTK  141 (426)
T ss_pred             hhhhhcccchhhhhhccc
Confidence            456789999999999987


No 490
>PF00454 PI3_PI4_kinase:  Phosphatidylinositol 3- and 4-kinase;  InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Phosphatidylinositol 3-kinase (PI3-kinase) (2.7.1.137 from EC) [] is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. The three products of PI3-kinase - PI-3-P, PI-3,4-P(2) and PI-3,4,5-P(3) function as secondary messengers in cell signalling. Phosphatidylinositol 4-kinase (PI4-kinase) (2.7.1.67 from EC) [] is an enzyme that acts on phosphatidylinositol (PI) in the first committed step in the production of the secondary messenger inositol-1'4'5'-trisphosphate. This domain is also present in a wide range of protein kinases, involved in diverse cellular functions, such as control of cell growth, regulation of cell cycle progression, a DNA damage checkpoint, recombination, and maintenance of telomere length. Despite significant homology to lipid kinases, no lipid kinase activity has been demonstrated for any of the PIK-related kinases []. The PI3- and PI4-kinases share a well conserved domain at their C-terminal section; this domain seems to be distantly related to the catalytic domain of protein kinases [, ]. The catalytic domain of PI3K has the typical bilobal structure that is seen in other ATP-dependent kinases, with a small N-terminal lobe and a large C-terminal lobe. The core of this domain is the most conserved region of the PI3Ks. The ATP cofactor binds in the crevice formed by the N-and C-terminal lobes, a loop between two strands provides a hydrophobic pocket for binding of the adenine moiety, and a lysine residue interacts with the alpha-phosphate. In contrast to protein kinases, the PI3K loop which interacts with the phosphates of the ATP and is known as the glycine-rich or P-loop, contains no glycine residues. Instead, contact with the ATP -phosphate is maintained through the side chain of a conserved serine residue.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 2WXL_A 4AJW_B 2WXQ_A 2WXP_A 2WXM_A 2WXH_A 2WXK_A 2WXG_A 2X38_A 2WXF_A ....
Probab=43.80  E-value=14  Score=29.70  Aligned_cols=32  Identities=28%  Similarity=0.369  Sum_probs=19.6

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccC
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSY   81 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   81 (174)
                      .++.=+|=+++|||+..                       ..+.++-|||.++-.
T Consensus       134 yilg~gDRh~~Nili~~-----------------------~~g~~~hIDfg~~f~  165 (235)
T PF00454_consen  134 YILGLGDRHPGNILIDK-----------------------KTGELIHIDFGFIFG  165 (235)
T ss_dssp             HHHT-CS--TTTEEE-E-----------------------TTSEEEE--HSSCTT
T ss_pred             EEEeecCCCchhheecc-----------------------ccceeeeEEeHHhhh
Confidence            45666799999999954                       357899999976653


No 491
>KOG0906|consensus
Probab=43.77  E-value=3.2e+02  Score=26.69  Aligned_cols=71  Identities=18%  Similarity=0.117  Sum_probs=48.5

Q ss_pred             ccchhhHHHHHHHHHHHHhhcC--------------------------CCeeeeeccCCCCCeeecCCCCCCCCCCCCCC
Q psy15664          3 KILSKDLNTEADWLKKHLLKIK--------------------------SPVTFCHNDLQEGNILYRESPNNNNNNNNNNN   56 (174)
Q Consensus         3 ~~~~~~L~~e~~~l~~~l~~~~--------------------------~~~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~   56 (174)
                      +.++..+..+...+..+++...                          ...++.-+|=+.+|+|++.             
T Consensus       644 s~~la~Ils~~~~I~~ylke~~p~e~ap~gi~~~v~dnfVkScaGYsVitYILGvGDRhldNLllT~-------------  710 (843)
T KOG0906|consen  644 SKPLARILSEYHSILMYLKEDRPDENAPFGISPEVMDNFVKSCAGYSVITYILGVGDRHLDNLLLTK-------------  710 (843)
T ss_pred             CCcHHHHHHHHHHHHHHHHhhCCCcCCCCCCChhHHHHHHHhhccceeeeeeecccCCCcCceEEcc-------------
Confidence            4556666666666666664221                          1235667899999999986             


Q ss_pred             CCCCCCCCCCCCCceEEEeeeccc-----CccchhhHHHHHHHHhh
Q psy15664         57 NNNVNNSSNNNNIDLVVIDFEYCS-----YNYRAFDIANHFVESVY   97 (174)
Q Consensus        57 ~~~~~~~~~~~~~~l~lIDfEYa~-----~n~~~fDlan~f~E~~~   97 (174)
                                 ++++.=|||-|.-     +-++..-|+--+.|-|.
T Consensus       711 -----------dGk~FHiDFgyIlGRDPKP~pp~MkL~kemve~mg  745 (843)
T KOG0906|consen  711 -----------DGKLFHIDFGYILGRDPKPFPPPMKLAKEMVEGMG  745 (843)
T ss_pred             -----------CCcEEEEeeeeeccCCCCCCCCccccCHHHHHHhc
Confidence                       5889999998852     34556667777777663


No 492
>KOG4721|consensus
Probab=43.17  E-value=20  Score=34.35  Aligned_cols=16  Identities=38%  Similarity=0.486  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+||+.-|||+..
T Consensus       232 KIIHRDLKSPNiLIs~  247 (904)
T KOG4721|consen  232 KIIHRDLKSPNILISY  247 (904)
T ss_pred             hHhhhccCCCceEeec
Confidence            4789999999999986


No 493
>PF12377 DuffyBP_N:  Duffy binding protein N terminal ;  InterPro: IPR021032 This entry represents the N terminus of the Duffy-antigen binding protein and is thought to bind to the human erythrocytes Duffy blood group determinant. These domains are found in eukaryotic proteins and are approximately 70 amino acids in length []. 
Probab=40.44  E-value=46  Score=21.97  Aligned_cols=27  Identities=26%  Similarity=0.300  Sum_probs=23.1

Q ss_pred             CCCCceEEEeeecccCccchhhHHHHH
Q psy15664         66 NNNIDLVVIDFEYCSYNYRAFDIANHF   92 (174)
Q Consensus        66 ~~~~~l~lIDfEYa~~n~~~fDlan~f   92 (174)
                      .....++.+|||.++-+.|+.=|-|.+
T Consensus        18 eg~~nlvmldyd~s~nghp~g~~dnvl   44 (66)
T PF12377_consen   18 EGCNNLVMLDYDTSSNGHPAGTIDNVL   44 (66)
T ss_pred             ccccceEEEEeeccCCCCcCchhhhHH
Confidence            345679999999999999999888865


No 494
>PF13575 DUF4135:  Domain of unknown function (DUF4135)
Probab=39.10  E-value=19  Score=31.52  Aligned_cols=29  Identities=28%  Similarity=0.166  Sum_probs=21.7

Q ss_pred             eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCc
Q psy15664         29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYN   82 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   82 (174)
                      +-=+|+|..||+...                         ..-++||.|...-+
T Consensus       150 L~~~DlH~ENIIa~g-------------------------~~PvlIDlETlf~~  178 (370)
T PF13575_consen  150 LNGTDLHFENIIASG-------------------------EYPVLIDLETLFHP  178 (370)
T ss_pred             hCCCcccccceEEeC-------------------------CCcEEEehhhhCCc
Confidence            444799999999875                         45678888876655


No 495
>KOG0669|consensus
Probab=38.73  E-value=16  Score=31.68  Aligned_cols=17  Identities=24%  Similarity=0.479  Sum_probs=15.1

Q ss_pred             eeeeeccCCCCCeeecC
Q psy15664         27 VTFCHNDLQEGNILYRE   43 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~   43 (174)
                      .-+.|+|.++.|+|++.
T Consensus       143 ~kilHRDmKaaNvLIt~  159 (376)
T KOG0669|consen  143 NKILHRDMKAANVLITK  159 (376)
T ss_pred             hhHHhhcccHhhEEEcC
Confidence            45789999999999986


No 496
>cd05163 TRRAP TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TRRAP shows some similarity to members of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily in that it contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain and has a large molecular weight. Unlike PIKK proteins, however, it contains an inactive PI3K-like pseudokinase domain, which lacks the conserved residues necessary for ATP binding and catalytic activity. TRRAP also contains many motifs that may be critical for protein-protein interactions. TRRAP is a common component of many histone acetyltransferase (HAT) complexes, and is responsible for the recruitment of these complexes to chromatin during transcription, replicat
Probab=38.57  E-value=22  Score=29.67  Aligned_cols=30  Identities=10%  Similarity=0.083  Sum_probs=25.4

Q ss_pred             eeeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         27 VTFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        27 ~v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .++.=+|-+++|||++.                       ..+.++-|||-.+
T Consensus       154 YilglgdRh~~nili~~-----------------------~tG~v~hiDf~~~  183 (253)
T cd05163         154 YILSINNRNPDKIFISR-----------------------DTGNVYQSDLLPS  183 (253)
T ss_pred             HHhcCCCCCchhEEEEc-----------------------CCCcEEEEeeeee
Confidence            57888999999999987                       4578999999743


No 497
>KOG0033|consensus
Probab=38.46  E-value=22  Score=30.75  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=15.6

Q ss_pred             CeeeeeccCCCCCeeecCC
Q psy15664         26 PVTFCHNDLQEGNILYRES   44 (174)
Q Consensus        26 ~~v~cHNDl~~gNiL~~~~   44 (174)
                      ...+.|+|++|.|+|+-..
T Consensus       128 ~n~IvHRDvkP~nllLASK  146 (355)
T KOG0033|consen  128 SNGIVHRDLKPENLLLASK  146 (355)
T ss_pred             hcCceeccCChhheeeeec
Confidence            3458899999999998753


No 498
>KOG0614|consensus
Probab=37.03  E-value=19  Score=33.93  Aligned_cols=28  Identities=25%  Similarity=0.402  Sum_probs=22.7

Q ss_pred             eeeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecc
Q psy15664         28 TFCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYC   79 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   79 (174)
                      .+.-+||+|.|+|+..                        .+=++|+||-+|
T Consensus       540 ~iIYRDLKPENllLd~------------------------~Gy~KLVDFGFA  567 (732)
T KOG0614|consen  540 GIIYRDLKPENLLLDN------------------------RGYLKLVDFGFA  567 (732)
T ss_pred             CceeccCChhheeecc------------------------CCceEEeehhhH
Confidence            4778999999999986                        356889998654


No 499
>PF12260 PIP49_C:  Protein-kinase domain of FAM69;  InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C). Proteins in this uncharacterised family are described as transmembrane proteins.
Probab=36.82  E-value=76  Score=25.03  Aligned_cols=32  Identities=19%  Similarity=0.214  Sum_probs=25.6

Q ss_pred             eeeccCCCCCeeecCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEeeecccCccc
Q psy15664         29 FCHNDLQEGNILYRESPNNNNNNNNNNNNNNVNNSSNNNNIDLVVIDFEYCSYNYR   84 (174)
Q Consensus        29 ~cHNDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~~   84 (174)
                      |--.|++++|+-+++                        ++++++||-+....-++
T Consensus        83 ~~lcDv~~~nfgv~~------------------------~~~lk~iDld~v~~~~~  114 (188)
T PF12260_consen   83 FYLCDVSPDNFGVND------------------------DGRLKLIDLDDVFVEDK  114 (188)
T ss_pred             EEEeecchHHeEEeC------------------------CCcEEEEechhcchhHH
Confidence            666699999999986                        46799999998776544


No 500
>KOG4645|consensus
Probab=36.71  E-value=51  Score=34.29  Aligned_cols=16  Identities=31%  Similarity=0.476  Sum_probs=14.6

Q ss_pred             eeeeccCCCCCeeecC
Q psy15664         28 TFCHNDLQEGNILYRE   43 (174)
Q Consensus        28 v~cHNDl~~gNiL~~~   43 (174)
                      .+.|+|+++.||++..
T Consensus      1354 gIVHRDIK~aNI~Ld~ 1369 (1509)
T KOG4645|consen 1354 GIVHRDIKPANILLDF 1369 (1509)
T ss_pred             CceecCCCccceeeec
Confidence            4789999999999987


Done!