Query psy15665
Match_columns 107
No_of_seqs 148 out of 855
Neff 5.7
Searched_HMMs 46136
Date Fri Aug 16 18:28:04 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy15665.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15665hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG2686|consensus 100.0 1.5E-30 3.2E-35 209.7 7.1 80 4-104 206-285 (366)
2 PTZ00296 choline kinase; Provi 99.9 5.6E-27 1.2E-31 192.5 7.6 78 4-104 278-355 (442)
3 PTZ00384 choline kinase; Provi 99.9 1.3E-26 2.8E-31 187.5 7.9 76 7-105 224-299 (383)
4 PF01633 Choline_kinase: Choli 99.9 2.7E-27 5.9E-32 174.0 1.9 75 3-100 136-211 (211)
5 KOG4720|consensus 99.9 7.2E-25 1.6E-29 175.1 4.5 74 2-104 240-313 (391)
6 cd05156 ChoK_euk Choline Kinas 99.9 8.7E-24 1.9E-28 161.8 7.7 82 6-105 175-256 (302)
7 PLN02421 phosphotransferase, a 99.9 1.5E-23 3.3E-28 165.2 6.2 72 4-105 176-247 (330)
8 PLN02236 choline kinase 99.8 3.9E-21 8.4E-26 152.6 6.7 77 5-104 195-271 (344)
9 cd05157 ETNK_euk Ethanolamine 99.8 4.1E-20 9E-25 136.4 6.4 69 6-104 166-234 (235)
10 COG0510 ycfN Thiamine kinase a 99.7 1.2E-16 2.6E-21 124.0 5.2 73 3-98 145-218 (269)
11 TIGR02721 ycfN_thiK thiamine k 99.5 8.1E-15 1.8E-19 110.3 4.9 47 7-76 143-189 (256)
12 PRK10271 thiK thiamine kinase; 99.4 6.4E-13 1.4E-17 99.4 4.9 48 5-75 72-119 (188)
13 cd05151 ChoK Choline Kinase (C 99.4 2E-13 4.4E-18 95.0 2.0 47 9-78 106-152 (170)
14 cd05154 ACAD10_11_like Acyl-Co 99.3 2.9E-12 6.4E-17 91.8 5.0 49 8-76 172-220 (223)
15 TIGR02172 Fb_sc_TIGR02172 Fibr 99.2 6.8E-12 1.5E-16 94.7 4.0 72 5-104 148-219 (226)
16 PRK09550 mtnK methylthioribose 99.1 4E-11 8.7E-16 98.2 4.8 53 7-82 220-272 (401)
17 cd05153 HomoserineK_II Homoser 99.1 3.9E-11 8.4E-16 91.4 3.9 51 7-79 172-222 (296)
18 cd05150 APH Aminoglycoside 3'- 99.1 1.2E-10 2.7E-15 86.5 5.3 48 7-76 160-207 (244)
19 smart00587 CHK ZnF_C4 abd HLH 99.0 3.8E-10 8.2E-15 83.1 5.5 53 8-77 118-170 (196)
20 TIGR01767 MTRK 5-methylthiorib 99.0 4E-10 8.6E-15 91.8 4.5 52 7-81 189-240 (370)
21 PF01636 APH: Phosphotransfera 99.0 2.8E-10 6E-15 81.3 2.7 49 7-76 163-211 (239)
22 PRK05231 homoserine kinase; Pr 99.0 6.5E-10 1.4E-14 85.7 4.3 51 8-80 185-235 (319)
23 cd05155 APH_ChoK_like_1 Unchar 99.0 4.2E-10 9.1E-15 83.8 3.0 72 8-106 162-234 (235)
24 TIGR02906 spore_CotS spore coa 98.9 6.6E-10 1.4E-14 84.7 4.0 75 7-104 184-263 (313)
25 TIGR00938 thrB_alt homoserine 98.9 8.5E-10 1.8E-14 85.3 4.3 50 7-78 184-233 (307)
26 PRK12396 5-methylribose kinase 98.9 9.2E-10 2E-14 90.7 3.3 52 8-82 225-276 (409)
27 cd05120 APH_ChoK_like Aminogly 98.8 1.1E-08 2.4E-13 67.6 5.0 46 10-77 108-153 (155)
28 TIGR02904 spore_ysxE spore coa 98.8 6.3E-09 1.4E-13 80.7 3.9 50 6-77 192-241 (309)
29 PF02958 EcKinase: Ecdysteroid 98.7 1.3E-08 2.7E-13 77.8 4.3 55 6-77 211-265 (294)
30 cd05152 MPH2' Macrolide 2'-Pho 98.6 5.4E-08 1.2E-12 75.4 5.0 46 7-73 182-227 (276)
31 PRK11768 serine/threonine prot 98.6 5.4E-08 1.2E-12 76.7 3.5 44 7-74 193-236 (325)
32 PLN02756 S-methyl-5-thioribose 98.5 5.8E-08 1.3E-12 80.3 3.7 51 8-81 228-278 (418)
33 PLN02876 acyl-CoA dehydrogenas 98.3 1.2E-06 2.7E-11 76.7 6.5 76 9-104 224-304 (822)
34 COG2334 Putative homoserine ki 98.3 9.7E-07 2.1E-11 70.9 4.4 43 12-76 199-242 (331)
35 PRK10593 hypothetical protein; 98.2 6.8E-07 1.5E-11 69.8 2.7 63 7-97 190-254 (297)
36 COG3173 Predicted aminoglycosi 98.2 2E-06 4.4E-11 69.0 5.0 48 6-77 194-241 (321)
37 COG4857 Predicted kinase [Gene 98.1 1.4E-06 3.1E-11 70.4 2.8 45 10-77 228-272 (408)
38 TIGR03724 arch_bud32 Kae1-asso 97.8 1.7E-05 3.8E-10 56.7 3.6 40 10-72 109-148 (199)
39 PRK06148 hypothetical protein; 97.8 3E-05 6.5E-10 69.8 4.7 52 7-78 200-252 (1013)
40 PRK14879 serine/threonine prot 97.7 3.7E-05 8E-10 55.3 3.2 39 11-72 115-153 (211)
41 PF07914 DUF1679: Protein of u 97.6 1.1E-05 2.4E-10 66.4 -0.7 54 5-75 263-316 (414)
42 COG3178 Predicted phosphotrans 97.6 7.5E-05 1.6E-09 60.5 3.6 52 6-75 196-247 (351)
43 PRK06149 hypothetical protein; 97.4 0.00015 3.3E-09 65.0 4.2 54 8-78 206-259 (972)
44 cd05145 RIO1_like RIO kinase f 97.4 0.00018 3.9E-09 52.1 3.2 31 10-63 137-167 (190)
45 TIGR02905 spore_yutH spore coa 97.2 0.00022 4.9E-09 56.0 2.9 45 8-77 187-231 (313)
46 PRK09605 bifunctional UGMP fam 97.2 0.0002 4.4E-09 59.7 2.4 41 11-74 448-488 (535)
47 PF06293 Kdo: Lipopolysacchari 97.1 0.00035 7.6E-09 51.6 2.4 45 10-73 137-186 (206)
48 PF04655 APH_6_hur: Aminoglyco 97.1 0.00037 8E-09 54.1 2.5 50 5-77 155-204 (253)
49 cd05147 RIO1_euk RIO kinase fa 97.0 0.00054 1.2E-08 50.2 2.5 28 11-61 138-165 (190)
50 PRK12274 serine/threonine prot 97.0 0.00044 9.6E-09 53.1 2.1 33 10-64 110-143 (218)
51 PRK10359 lipopolysaccharide co 96.9 0.00093 2E-08 51.5 3.1 44 11-79 155-200 (232)
52 PRK01723 3-deoxy-D-manno-octul 96.8 0.00068 1.5E-08 51.4 2.2 32 11-64 162-193 (239)
53 cd05144 RIO2_C RIO kinase fami 96.8 0.00075 1.6E-08 48.7 2.2 30 10-61 144-173 (198)
54 smart00090 RIO RIO-like kinase 96.8 0.00088 1.9E-08 50.8 2.5 29 12-63 170-198 (237)
55 PF01163 RIO1: RIO1 family; I 96.7 0.0011 2.3E-08 49.4 2.2 37 10-69 126-164 (188)
56 cd05119 RIO RIO kinase family, 96.7 0.001 2.3E-08 46.9 2.1 29 10-61 134-162 (187)
57 PF03881 Fructosamin_kin: Fruc 96.6 0.0014 3E-08 51.7 2.4 44 6-72 184-227 (288)
58 TIGR01982 UbiB 2-polyprenylphe 96.5 0.0017 3.7E-08 53.6 2.6 33 11-65 277-309 (437)
59 cd05146 RIO3_euk RIO kinase fa 96.5 0.0016 3.5E-08 48.9 1.9 28 10-60 144-171 (197)
60 cd00180 PKc Catalytic domain o 96.3 0.0025 5.4E-08 43.3 1.9 34 11-66 112-146 (215)
61 PF06176 WaaY: Lipopolysacchar 96.3 0.0029 6.3E-08 49.0 2.4 29 10-61 154-182 (229)
62 PF00069 Pkinase: Protein kina 96.1 0.0022 4.8E-08 46.3 1.1 29 11-61 118-146 (260)
63 cd05604 STKc_SGK3 Catalytic do 96.1 0.0031 6.7E-08 48.3 1.9 30 11-62 116-145 (325)
64 cd05627 STKc_NDR2 Catalytic do 96.0 0.004 8.6E-08 48.5 2.0 29 11-61 121-149 (360)
65 PRK04750 ubiB putative ubiquin 96.0 0.0043 9.4E-08 52.9 2.3 37 11-65 280-316 (537)
66 cd05594 STKc_PKB_alpha Catalyt 95.9 0.0062 1.4E-07 46.7 2.8 30 10-61 115-144 (325)
67 cd05603 STKc_SGK2 Catalytic do 95.9 0.0038 8.2E-08 47.7 1.6 29 11-61 116-144 (321)
68 cd05621 STKc_ROCK2 Catalytic d 95.9 0.0046 1E-07 48.9 2.0 29 11-61 162-190 (370)
69 smart00219 TyrKc Tyrosine kina 95.9 0.0052 1.1E-07 44.2 2.1 29 11-61 123-151 (258)
70 cd05585 STKc_YPK1_like Catalyt 95.9 0.0046 1E-07 47.1 1.9 30 11-62 113-142 (312)
71 cd05068 PTKc_Frk_like Catalyti 95.9 0.0051 1.1E-07 45.0 2.1 17 11-27 123-139 (261)
72 cd05082 PTKc_Csk Catalytic dom 95.9 0.0051 1.1E-07 44.9 2.0 29 11-61 122-150 (256)
73 KOG0667|consensus 95.9 0.0053 1.2E-07 53.1 2.4 34 9-62 307-340 (586)
74 cd05586 STKc_Sck1_like Catalyt 95.9 0.0045 9.6E-08 47.5 1.7 30 11-62 116-145 (330)
75 cd05614 STKc_MSK2_N N-terminal 95.9 0.0043 9.3E-08 47.5 1.6 29 11-61 125-153 (332)
76 cd05069 PTKc_Yes Catalytic dom 95.9 0.0054 1.2E-07 44.9 2.1 29 11-61 122-150 (260)
77 cd07863 STKc_CDK4 Catalytic do 95.9 0.004 8.8E-08 46.1 1.4 28 11-60 128-155 (288)
78 PHA02882 putative serine/threo 95.9 0.0056 1.2E-07 46.3 2.2 28 11-60 146-173 (294)
79 cd05083 PTKc_Chk Catalytic dom 95.8 0.005 1.1E-07 44.9 1.7 29 11-61 120-148 (254)
80 cd05601 STKc_CRIK Catalytic do 95.8 0.0051 1.1E-07 47.0 1.8 29 11-61 122-150 (330)
81 cd05573 STKc_ROCK_NDR_like Cat 95.8 0.0048 1E-07 47.3 1.6 31 10-62 120-150 (350)
82 cd05039 PTKc_Csk_like Catalyti 95.8 0.0057 1.2E-07 44.5 1.9 30 11-62 122-151 (256)
83 cd05597 STKc_DMPK_like Catalyt 95.8 0.0057 1.2E-07 47.2 2.0 28 11-60 122-149 (331)
84 PTZ00267 NIMA-related protein 95.8 0.0067 1.4E-07 49.8 2.4 29 11-61 189-217 (478)
85 cd05598 STKc_LATS Catalytic do 95.8 0.0058 1.2E-07 47.8 1.9 29 11-61 121-149 (376)
86 cd05628 STKc_NDR1 Catalytic do 95.8 0.0059 1.3E-07 47.7 2.0 30 11-62 121-150 (363)
87 KOG0594|consensus 95.7 0.007 1.5E-07 49.0 2.3 27 12-60 141-167 (323)
88 cd05109 PTKc_HER2 Catalytic do 95.7 0.0059 1.3E-07 45.2 1.7 17 11-27 129-145 (279)
89 cd05587 STKc_cPKC Catalytic do 95.7 0.0062 1.3E-07 46.7 1.9 29 11-61 121-149 (324)
90 cd05584 STKc_p70S6K Catalytic 95.7 0.0058 1.3E-07 46.9 1.8 29 11-61 120-148 (323)
91 cd08223 STKc_Nek4 Catalytic do 95.7 0.0088 1.9E-07 43.3 2.6 28 11-60 122-149 (257)
92 cd05602 STKc_SGK1 Catalytic do 95.7 0.0056 1.2E-07 46.9 1.5 29 11-61 116-144 (325)
93 PTZ00263 protein kinase A cata 95.6 0.0068 1.5E-07 46.7 2.0 29 11-61 138-166 (329)
94 cd05084 PTKc_Fes Catalytic dom 95.6 0.0061 1.3E-07 44.3 1.6 17 11-27 114-130 (252)
95 cd05571 STKc_PKB Catalytic dom 95.6 0.007 1.5E-07 46.4 2.0 29 11-61 115-143 (323)
96 cd07872 STKc_PCTAIRE2 Catalyti 95.6 0.0055 1.2E-07 46.4 1.4 17 11-27 124-140 (309)
97 cd07869 STKc_PFTAIRE1 Catalyti 95.6 0.0051 1.1E-07 46.4 1.2 17 11-27 123-139 (303)
98 COG3570 StrB Streptomycin 6-ki 95.6 0.0057 1.2E-07 47.9 1.4 51 4-77 155-205 (274)
99 cd05575 STKc_SGK Catalytic dom 95.6 0.0067 1.4E-07 46.5 1.8 29 11-61 116-144 (323)
100 cd08217 STKc_Nek2 Catalytic do 95.6 0.0068 1.5E-07 43.7 1.7 32 9-62 128-159 (265)
101 COG3642 Mn2+-dependent serine/ 95.6 0.013 2.8E-07 44.8 3.3 38 10-70 111-148 (204)
102 PRK09188 serine/threonine prot 95.6 0.0091 2E-07 48.6 2.6 38 11-70 131-169 (365)
103 cd05574 STKc_phototropin_like 95.6 0.0078 1.7E-07 45.5 2.1 30 11-62 123-152 (316)
104 cd05624 STKc_MRCK_beta Catalyt 95.6 0.0076 1.7E-07 46.5 2.1 29 10-60 121-149 (331)
105 cd05616 STKc_cPKC_beta Catalyt 95.6 0.0064 1.4E-07 46.6 1.6 29 11-61 121-149 (323)
106 COG0661 AarF Predicted unusual 95.6 0.0078 1.7E-07 51.3 2.2 34 10-65 284-317 (517)
107 cd05052 PTKc_Abl Catalytic dom 95.6 0.0086 1.9E-07 43.9 2.2 17 11-27 124-140 (263)
108 TIGR02457 TreS_Cterm trehalose 95.6 0.008 1.7E-07 51.3 2.3 45 9-76 378-431 (528)
109 cd05593 STKc_PKB_gamma Catalyt 95.6 0.0069 1.5E-07 46.8 1.8 29 11-61 115-143 (328)
110 cd05108 PTKc_EGFR Catalytic do 95.6 0.0081 1.8E-07 45.7 2.1 29 11-61 129-157 (316)
111 cd05600 STKc_Sid2p_Dbf2p Catal 95.6 0.0061 1.3E-07 46.8 1.4 29 11-61 121-149 (333)
112 cd07871 STKc_PCTAIRE3 Catalyti 95.5 0.0046 1E-07 46.4 0.7 17 11-27 123-139 (288)
113 cd05612 STKc_PRKX_like Catalyt 95.5 0.008 1.7E-07 45.3 2.0 29 11-61 121-149 (291)
114 cd00192 PTKc Catalytic domain 95.5 0.0081 1.8E-07 43.1 1.9 18 10-27 124-141 (262)
115 cd05595 STKc_PKB_beta Catalyti 95.5 0.006 1.3E-07 46.9 1.3 29 11-61 115-143 (323)
116 cd07862 STKc_CDK6 Catalytic do 95.5 0.0064 1.4E-07 45.2 1.4 28 11-60 130-157 (290)
117 PLN00034 mitogen-activated pro 95.5 0.0068 1.5E-07 47.1 1.5 17 11-27 188-204 (353)
118 cd05122 PKc_STE Catalytic doma 95.5 0.0087 1.9E-07 42.5 2.0 32 10-63 117-148 (253)
119 cd05629 STKc_NDR_like_fungal C 95.5 0.0081 1.7E-07 47.1 2.0 29 11-61 121-149 (377)
120 cd05053 PTKc_FGFR Catalytic do 95.5 0.0069 1.5E-07 45.0 1.5 29 11-61 152-180 (293)
121 cd06656 STKc_PAK3 Catalytic do 95.5 0.0054 1.2E-07 46.3 0.9 29 11-61 135-163 (297)
122 cd07875 STKc_JNK1 Catalytic do 95.5 0.0079 1.7E-07 46.8 1.8 29 11-61 146-174 (364)
123 cd05591 STKc_nPKC_epsilon Cata 95.5 0.0084 1.8E-07 45.9 1.9 29 11-61 116-144 (321)
124 cd05590 STKc_nPKC_eta Catalyti 95.5 0.0083 1.8E-07 46.0 1.9 29 11-61 116-144 (320)
125 cd05623 STKc_MRCK_alpha Cataly 95.5 0.0093 2E-07 45.9 2.1 28 11-60 122-149 (332)
126 cd05617 STKc_aPKC_zeta Catalyt 95.4 0.0082 1.8E-07 46.2 1.8 28 11-60 116-143 (327)
127 cd05070 PTKc_Fyn_Yrk Catalytic 95.4 0.0084 1.8E-07 43.8 1.7 29 11-61 122-150 (260)
128 cd05620 STKc_nPKC_delta Cataly 95.4 0.0072 1.6E-07 46.3 1.4 29 11-61 116-144 (316)
129 cd06605 PKc_MAPKK Catalytic do 95.4 0.0067 1.5E-07 44.1 1.2 31 9-61 119-149 (265)
130 cd07874 STKc_JNK3 Catalytic do 95.4 0.0074 1.6E-07 46.7 1.5 29 11-61 139-167 (355)
131 PTZ00426 cAMP-dependent protei 95.4 0.0081 1.8E-07 46.9 1.7 29 11-61 151-179 (340)
132 PRK10345 hypothetical protein; 95.4 0.013 2.7E-07 44.1 2.6 32 12-61 126-157 (210)
133 PRK15123 lipopolysaccharide co 95.4 0.0085 1.8E-07 46.7 1.8 50 11-75 158-213 (268)
134 cd05625 STKc_LATS1 Catalytic d 95.4 0.0087 1.9E-07 47.0 1.8 29 11-61 121-149 (382)
135 cd05085 PTKc_Fer Catalytic dom 95.4 0.009 1.9E-07 43.2 1.8 17 11-27 113-129 (250)
136 cd05091 PTKc_Ror2 Catalytic do 95.4 0.0081 1.8E-07 44.4 1.5 29 11-61 144-172 (283)
137 cd05592 STKc_nPKC_theta_delta 95.4 0.0084 1.8E-07 45.9 1.7 29 11-61 116-144 (316)
138 cd05599 STKc_NDR_like Catalyti 95.4 0.0091 2E-07 46.3 1.8 29 11-61 121-149 (364)
139 cd07878 STKc_p38beta_MAPK11 Ca 95.4 0.0099 2.1E-07 45.7 2.0 17 11-27 138-154 (343)
140 cd05080 PTKc_Tyk2_rpt2 Catalyt 95.4 0.012 2.7E-07 43.6 2.5 29 11-61 127-155 (283)
141 cd07876 STKc_JNK2 Catalytic do 95.3 0.0073 1.6E-07 46.9 1.2 29 11-61 143-171 (359)
142 cd07868 STKc_CDK8 Catalytic do 95.3 0.011 2.4E-07 44.6 2.2 16 11-26 128-143 (317)
143 cd05113 PTKc_Btk_Bmx Catalytic 95.3 0.011 2.4E-07 43.4 2.1 17 11-27 120-136 (256)
144 cd05631 STKc_GRK4 Catalytic do 95.3 0.011 2.3E-07 44.4 2.0 17 11-27 122-138 (285)
145 cd05066 PTKc_EphR_A Catalytic 95.3 0.0092 2E-07 43.9 1.7 17 11-27 126-142 (267)
146 cd05071 PTKc_Src Catalytic dom 95.3 0.0094 2E-07 43.9 1.7 17 11-27 122-138 (262)
147 cd05102 PTKc_VEGFR3 Catalytic 95.3 0.014 3E-07 44.7 2.7 17 11-27 194-210 (338)
148 cd05618 STKc_aPKC_iota Catalyt 95.3 0.01 2.2E-07 45.8 1.9 29 11-61 116-144 (329)
149 cd07859 STKc_TDY_MAPK_plant Ca 95.3 0.0083 1.8E-07 45.5 1.4 17 11-27 123-139 (338)
150 cd05075 PTKc_Axl Catalytic dom 95.3 0.0088 1.9E-07 43.8 1.4 17 11-27 132-148 (272)
151 cd06650 PKc_MEK1 Catalytic dom 95.3 0.013 2.7E-07 45.4 2.4 29 11-61 124-152 (333)
152 cd06649 PKc_MEK2 Catalytic dom 95.3 0.012 2.6E-07 45.3 2.2 29 11-61 124-152 (331)
153 cd07873 STKc_PCTAIRE1 Catalyti 95.3 0.0078 1.7E-07 45.2 1.2 17 11-27 124-140 (301)
154 cd08528 STKc_Nek10 Catalytic d 95.3 0.011 2.3E-07 43.4 1.8 30 10-61 133-162 (269)
155 PHA03212 serine/threonine kina 95.3 0.011 2.3E-07 47.4 2.0 28 11-60 202-229 (391)
156 KOG0583|consensus 95.3 0.0063 1.4E-07 49.3 0.6 45 11-76 140-184 (370)
157 cd05622 STKc_ROCK1 Catalytic d 95.3 0.011 2.5E-07 46.6 2.1 28 11-60 162-189 (371)
158 cd05582 STKc_RSK_N N-terminal 95.2 0.011 2.4E-07 45.1 1.9 29 11-61 118-146 (318)
159 cd05042 PTKc_Aatyk Catalytic d 95.2 0.011 2.5E-07 43.3 1.9 17 11-27 120-136 (269)
160 cd06625 STKc_MEKK3_like Cataly 95.2 0.013 2.8E-07 42.6 2.1 28 11-60 124-151 (263)
161 cd08215 STKc_Nek Catalytic dom 95.2 0.011 2.3E-07 42.3 1.7 30 11-62 123-152 (258)
162 cd05613 STKc_MSK1_N N-terminal 95.2 0.011 2.5E-07 43.9 1.9 28 11-60 125-152 (290)
163 cd06622 PKc_MAPKK_PBS2_like Ca 95.2 0.012 2.7E-07 43.5 2.1 30 10-61 122-151 (286)
164 cd05060 PTKc_Syk_like Catalyti 95.2 0.015 3.2E-07 42.4 2.4 29 11-61 115-143 (257)
165 cd06627 STKc_Cdc7_like Catalyt 95.2 0.011 2.4E-07 42.4 1.6 29 11-61 119-147 (254)
166 cd05099 PTKc_FGFR4 Catalytic d 95.2 0.014 3.1E-07 44.3 2.3 29 11-61 154-182 (314)
167 cd05588 STKc_aPKC Catalytic do 95.1 0.011 2.3E-07 45.7 1.5 29 11-61 116-144 (329)
168 cd05096 PTKc_DDR1 Catalytic do 95.1 0.01 2.2E-07 44.7 1.3 17 11-27 158-174 (304)
169 cd05607 STKc_GRK7 Catalytic do 95.1 0.018 3.9E-07 43.0 2.6 28 11-60 115-142 (277)
170 cd07857 STKc_MPK1 Catalytic do 95.1 0.0082 1.8E-07 46.0 0.8 17 11-27 125-141 (332)
171 PHA03209 serine/threonine kina 95.1 0.012 2.7E-07 46.0 1.8 29 11-61 177-205 (357)
172 cd08219 STKc_Nek3 Catalytic do 95.1 0.014 3E-07 42.4 2.0 29 11-61 120-148 (255)
173 cd05040 PTKc_Ack_like Catalyti 95.1 0.012 2.6E-07 42.7 1.6 17 11-27 117-133 (257)
174 cd06638 STKc_myosinIIIA Cataly 95.1 0.011 2.3E-07 43.7 1.4 28 11-60 144-171 (286)
175 cd07832 STKc_CCRK Catalytic do 95.1 0.014 3E-07 42.9 2.0 17 11-27 119-135 (286)
176 cd05596 STKc_ROCK Catalytic do 95.1 0.013 2.8E-07 46.2 1.9 28 11-60 162-189 (370)
177 cd05589 STKc_PKN Catalytic dom 95.1 0.011 2.4E-07 45.2 1.5 29 11-61 121-149 (324)
178 cd05062 PTKc_IGF-1R Catalytic 95.0 0.011 2.4E-07 43.7 1.3 17 11-27 139-155 (277)
179 cd05583 STKc_MSK_N N-terminal 95.0 0.013 2.9E-07 43.5 1.8 28 11-60 125-152 (288)
180 cd05615 STKc_cPKC_alpha Cataly 95.0 0.012 2.7E-07 45.1 1.7 29 11-61 121-149 (323)
181 cd05609 STKc_MAST Catalytic do 95.0 0.013 2.8E-07 44.2 1.8 29 11-61 121-149 (305)
182 cd05038 PTKc_Jak_rpt2 Catalyti 95.0 0.015 3.3E-07 42.6 2.0 30 11-62 129-158 (284)
183 cd05037 PTK_Jak_rpt1 Pseudokin 95.0 0.015 3.2E-07 42.1 1.9 17 11-27 121-137 (259)
184 KOG2345|consensus 95.0 0.017 3.7E-07 46.1 2.4 72 11-106 149-226 (302)
185 cd05079 PTKc_Jak1_rpt2 Catalyt 95.0 0.014 3.1E-07 43.3 1.9 17 11-27 129-145 (284)
186 PHA03207 serine/threonine kina 95.0 0.0096 2.1E-07 47.2 1.0 28 11-60 205-232 (392)
187 cd05580 STKc_PKA Catalytic dom 95.0 0.014 3.1E-07 43.6 1.9 31 10-62 120-150 (290)
188 cd07853 STKc_NLK Catalytic dom 95.0 0.013 2.8E-07 45.8 1.7 28 11-60 123-150 (372)
189 cd05041 PTKc_Fes_like Catalyti 95.0 0.018 3.8E-07 41.7 2.2 29 11-61 113-141 (251)
190 cd05626 STKc_LATS2 Catalytic d 95.0 0.014 3.1E-07 45.9 1.9 29 11-61 121-149 (381)
191 cd05608 STKc_GRK1 Catalytic do 95.0 0.012 2.6E-07 44.0 1.4 28 11-60 117-144 (280)
192 cd05057 PTKc_EGFR_like Catalyt 95.0 0.017 3.6E-07 42.8 2.2 18 10-27 128-145 (279)
193 cd05118 STKc_CMGC Catalytic do 95.0 0.017 3.7E-07 42.3 2.2 29 11-61 118-146 (283)
194 cd05633 STKc_GRK3 Catalytic do 95.0 0.01 2.2E-07 44.4 1.0 16 12-27 118-133 (279)
195 cd07867 STKc_CDC2L6 Catalytic 94.9 0.017 3.7E-07 43.4 2.1 16 11-26 128-143 (317)
196 cd06652 STKc_MEKK2 Catalytic d 94.9 0.012 2.6E-07 43.1 1.3 28 12-61 127-154 (265)
197 cd07834 STKc_MAPK Catalytic do 94.9 0.012 2.5E-07 44.8 1.2 17 11-27 123-139 (330)
198 cd05632 STKc_GRK5 Catalytic do 94.9 0.015 3.2E-07 43.6 1.8 28 11-60 122-149 (285)
199 cd05093 PTKc_TrkB Catalytic do 94.9 0.017 3.7E-07 43.1 2.1 17 11-27 140-156 (288)
200 cd05034 PTKc_Src_like Catalyti 94.9 0.014 3.1E-07 42.4 1.7 28 11-60 123-150 (261)
201 cd05112 PTKc_Itk Catalytic dom 94.9 0.013 2.9E-07 42.4 1.5 17 11-27 120-136 (256)
202 cd05054 PTKc_VEGFR Catalytic d 94.9 0.02 4.4E-07 44.5 2.6 29 11-61 193-221 (337)
203 KOG4250|consensus 94.9 0.018 4E-07 50.8 2.5 18 11-28 140-157 (732)
204 cd07848 STKc_CDKL5 Catalytic d 94.9 0.015 3.4E-07 43.0 1.8 17 11-27 120-136 (287)
205 cd07866 STKc_BUR1 Catalytic do 94.9 0.012 2.6E-07 43.8 1.2 17 11-27 135-151 (311)
206 cd06615 PKc_MEK Catalytic doma 94.9 0.018 3.9E-07 43.7 2.1 17 11-27 120-136 (308)
207 cd05033 PTKc_EphR Catalytic do 94.9 0.015 3.2E-07 42.6 1.6 17 11-27 126-142 (266)
208 cd05114 PTKc_Tec_Rlk Catalytic 94.9 0.015 3.1E-07 42.5 1.5 29 11-61 120-148 (256)
209 KOG0984|consensus 94.9 0.0063 1.4E-07 47.7 -0.4 37 4-62 162-198 (282)
210 PHA03210 serine/threonine kina 94.8 0.015 3.2E-07 48.2 1.8 28 11-60 287-314 (501)
211 cd05056 PTKc_FAK Catalytic dom 94.8 0.019 4.1E-07 42.2 2.1 17 11-27 127-143 (270)
212 cd05097 PTKc_DDR_like Catalyti 94.8 0.018 3.8E-07 43.2 2.0 17 11-27 149-165 (295)
213 cd07841 STKc_CDK7 Catalytic do 94.8 0.02 4.3E-07 42.6 2.3 17 11-27 122-138 (298)
214 cd07870 STKc_PFTAIRE2 Catalyti 94.8 0.016 3.4E-07 43.2 1.6 17 11-27 123-139 (291)
215 cd07839 STKc_CDK5 Catalytic do 94.8 0.014 3.1E-07 43.1 1.4 17 11-27 119-135 (284)
216 cd05148 PTKc_Srm_Brk Catalytic 94.8 0.019 4.2E-07 41.7 2.0 29 11-61 124-152 (261)
217 cd06654 STKc_PAK1 Catalytic do 94.8 0.012 2.5E-07 44.5 0.8 29 11-61 136-164 (296)
218 cd05059 PTKc_Tec_like Catalyti 94.8 0.015 3.2E-07 42.5 1.3 28 12-61 121-148 (256)
219 cd06617 PKc_MKK3_6 Catalytic d 94.7 0.019 4.2E-07 42.2 2.0 18 10-27 123-140 (283)
220 cd05094 PTKc_TrkC Catalytic do 94.7 0.019 4.2E-07 42.9 2.0 17 11-27 143-159 (291)
221 cd05116 PTKc_Syk Catalytic dom 94.7 0.018 3.9E-07 42.1 1.8 17 11-27 115-131 (257)
222 cd08216 PK_STRAD Pseudokinase 94.7 0.024 5.3E-07 42.6 2.5 17 11-27 121-137 (314)
223 cd06613 STKc_MAP4K3_like Catal 94.7 0.019 4.2E-07 41.5 1.9 17 11-27 121-137 (262)
224 cd05035 PTKc_Axl_like Catalyti 94.7 0.019 4E-07 41.9 1.8 29 11-61 133-161 (273)
225 cd05048 PTKc_Ror Catalytic Dom 94.7 0.019 4.1E-07 42.4 1.9 17 11-27 144-160 (283)
226 cd06637 STKc_TNIK Catalytic do 94.7 0.012 2.7E-07 43.0 0.8 29 11-61 131-159 (272)
227 cd05072 PTKc_Lyn Catalytic dom 94.7 0.017 3.8E-07 42.1 1.6 17 11-27 123-139 (261)
228 cd05578 STKc_Yank1 Catalytic d 94.7 0.019 4.1E-07 41.8 1.8 30 11-62 120-149 (258)
229 cd05111 PTK_HER3 Pseudokinase 94.7 0.023 5E-07 42.3 2.2 16 12-27 130-145 (279)
230 cd05081 PTKc_Jak2_Jak3_rpt2 Ca 94.7 0.017 3.8E-07 42.7 1.5 17 11-27 128-144 (284)
231 cd06635 STKc_TAO1 Catalytic do 94.7 0.022 4.9E-07 43.3 2.2 28 11-60 145-172 (317)
232 cd05581 STKc_PDK1 Catalytic do 94.7 0.016 3.4E-07 42.3 1.3 29 11-61 122-150 (280)
233 cd05087 PTKc_Aatyk1_Aatyk3 Cat 94.7 0.022 4.8E-07 41.9 2.1 17 11-27 120-136 (269)
234 cd06644 STKc_STK10_LOK Catalyt 94.6 0.025 5.4E-07 42.2 2.3 18 10-27 129-146 (292)
235 cd05047 PTKc_Tie Catalytic dom 94.6 0.022 4.7E-07 42.0 2.0 18 10-27 131-148 (270)
236 cd05088 PTKc_Tie2 Catalytic do 94.6 0.017 3.7E-07 43.7 1.4 29 10-60 143-171 (303)
237 cd05579 STKc_MAST_like Catalyt 94.6 0.021 4.6E-07 41.1 1.8 30 10-61 112-141 (265)
238 cd07833 STKc_CDKL Catalytic do 94.6 0.026 5.7E-07 41.5 2.3 30 11-62 120-149 (288)
239 cd06639 STKc_myosinIIIB Cataly 94.6 0.023 4.9E-07 42.3 2.0 29 11-61 148-176 (291)
240 smart00220 S_TKc Serine/Threon 94.6 0.018 3.9E-07 40.3 1.4 31 11-63 107-137 (244)
241 cd05619 STKc_nPKC_theta Cataly 94.6 0.019 4.1E-07 44.1 1.6 28 11-60 116-143 (316)
242 cd06618 PKc_MKK7 Catalytic dom 94.6 0.018 3.9E-07 43.2 1.4 29 11-61 135-163 (296)
243 cd05049 PTKc_Trk Catalytic dom 94.6 0.023 5.1E-07 41.7 2.0 17 11-27 142-158 (280)
244 cd05058 PTKc_Met_Ron Catalytic 94.6 0.02 4.3E-07 41.7 1.6 17 11-27 118-134 (262)
245 cd05123 STKc_AGC Catalytic dom 94.6 0.031 6.7E-07 40.2 2.6 30 10-61 112-141 (250)
246 cd05095 PTKc_DDR2 Catalytic do 94.5 0.024 5.3E-07 42.5 2.1 17 11-27 150-166 (296)
247 cd05605 STKc_GRK4_like Catalyt 94.5 0.021 4.5E-07 42.8 1.7 29 11-61 122-150 (285)
248 cd07844 STKc_PCTAIRE_like Cata 94.5 0.017 3.7E-07 42.9 1.2 17 11-27 123-139 (291)
249 cd07845 STKc_CDK10 Catalytic d 94.5 0.017 3.6E-07 43.6 1.2 17 11-27 128-144 (309)
250 PTZ00036 glycogen synthase kin 94.5 0.022 4.7E-07 46.3 1.9 16 11-26 190-205 (440)
251 cd05101 PTKc_FGFR2 Catalytic d 94.5 0.025 5.4E-07 42.6 2.1 17 11-27 157-173 (304)
252 cd05032 PTKc_InsR_like Catalyt 94.5 0.021 4.6E-07 41.8 1.7 17 11-27 139-155 (277)
253 cd07850 STKc_JNK Catalytic dom 94.5 0.019 4.2E-07 44.4 1.5 17 11-27 138-154 (353)
254 cd06643 STKc_SLK Catalytic dom 94.5 0.031 6.7E-07 41.4 2.5 29 11-61 123-151 (282)
255 cd05044 PTKc_c-ros Catalytic d 94.5 0.023 4.9E-07 41.5 1.7 34 11-61 126-159 (269)
256 cd08221 STKc_Nek9 Catalytic do 94.5 0.02 4.4E-07 41.5 1.5 17 11-27 121-137 (256)
257 cd08228 STKc_Nek6 Catalytic do 94.5 0.021 4.5E-07 41.7 1.5 17 11-27 126-142 (267)
258 cd05110 PTKc_HER4 Catalytic do 94.5 0.025 5.4E-07 42.7 2.0 17 11-27 129-145 (303)
259 cd05073 PTKc_Hck Catalytic dom 94.5 0.02 4.3E-07 42.0 1.4 17 11-27 122-138 (260)
260 cd05090 PTKc_Ror1 Catalytic do 94.4 0.024 5.3E-07 42.0 1.9 17 11-27 144-160 (283)
261 cd05630 STKc_GRK6 Catalytic do 94.4 0.026 5.6E-07 42.4 2.0 29 11-61 122-150 (285)
262 cd05074 PTKc_Tyro3 Catalytic d 94.4 0.027 5.8E-07 41.2 2.1 17 11-27 133-149 (273)
263 cd06614 STKc_PAK Catalytic dom 94.4 0.025 5.5E-07 42.0 1.9 30 10-61 135-164 (286)
264 cd06641 STKc_MST3 Catalytic do 94.4 0.027 5.9E-07 41.7 2.1 30 10-61 120-149 (277)
265 cd06646 STKc_MAP4K5 Catalytic 94.4 0.019 4.1E-07 42.0 1.2 17 11-27 126-142 (267)
266 cd06619 PKc_MKK5 Catalytic dom 94.4 0.026 5.6E-07 41.9 1.9 17 11-27 115-131 (279)
267 PHA03211 serine/threonine kina 94.4 0.023 5E-07 47.1 1.8 28 11-60 280-307 (461)
268 cd05050 PTKc_Musk Catalytic do 94.4 0.021 4.6E-07 42.4 1.4 18 10-27 149-166 (288)
269 cd08529 STKc_FA2-like Catalyti 94.4 0.03 6.5E-07 40.4 2.2 18 10-27 120-137 (256)
270 cd05100 PTKc_FGFR3 Catalytic d 94.3 0.028 6E-07 43.1 2.1 17 11-27 154-170 (334)
271 cd06645 STKc_MAP4K3 Catalytic 94.3 0.021 4.6E-07 41.7 1.3 17 11-27 126-142 (267)
272 cd05089 PTKc_Tie1 Catalytic do 94.3 0.024 5.3E-07 42.6 1.7 17 11-27 139-155 (297)
273 cd07846 STKc_CDKL2_3 Catalytic 94.3 0.027 5.9E-07 41.5 1.9 29 11-61 120-148 (286)
274 smart00221 STYKc Protein kinas 94.3 0.024 5.2E-07 39.7 1.5 32 11-64 118-149 (225)
275 cd05086 PTKc_Aatyk2 Catalytic 94.3 0.033 7.2E-07 41.1 2.3 17 11-27 119-135 (268)
276 cd06616 PKc_MKK4 Catalytic dom 94.3 0.025 5.4E-07 41.9 1.7 18 10-27 127-144 (288)
277 cd06629 STKc_MAPKKK_Bck1_like 94.2 0.035 7.5E-07 40.7 2.3 17 11-27 128-144 (272)
278 cd08224 STKc_Nek6_Nek7 Catalyt 94.2 0.031 6.8E-07 40.5 2.0 17 11-27 126-142 (267)
279 cd06655 STKc_PAK2 Catalytic do 94.2 0.021 4.5E-07 43.2 1.2 29 11-61 135-163 (296)
280 cd05063 PTKc_EphR_A2 Catalytic 94.2 0.027 5.9E-07 41.2 1.7 17 11-27 127-143 (268)
281 cd05103 PTKc_VEGFR2 Catalytic 94.2 0.043 9.3E-07 42.5 2.9 29 11-61 199-227 (343)
282 cd07835 STKc_CDK1_like Catalyt 94.2 0.028 6.1E-07 41.4 1.8 17 11-27 119-135 (283)
283 cd06612 STKc_MST1_2 Catalytic 94.2 0.031 6.7E-07 40.3 2.0 17 11-27 119-135 (256)
284 cd05067 PTKc_Lck_Blk Catalytic 94.2 0.027 5.9E-07 41.1 1.7 17 11-27 122-138 (260)
285 cd07879 STKc_p38delta_MAPK13 C 94.2 0.024 5.3E-07 43.8 1.5 29 11-61 137-165 (342)
286 PLN03225 Serine/threonine-prot 94.2 0.03 6.5E-07 47.6 2.1 30 11-61 275-304 (566)
287 cd05115 PTKc_Zap-70 Catalytic 94.2 0.034 7.3E-07 40.9 2.1 17 11-27 115-131 (257)
288 cd06658 STKc_PAK5 Catalytic do 94.2 0.025 5.5E-07 42.6 1.5 28 11-60 138-165 (292)
289 cd05106 PTKc_CSF-1R Catalytic 94.2 0.041 8.9E-07 43.5 2.8 28 11-60 232-259 (374)
290 cd06636 STKc_MAP4K4_6 Catalyti 94.2 0.024 5.3E-07 41.8 1.4 29 11-61 141-169 (282)
291 cd08218 STKc_Nek1 Catalytic do 94.1 0.033 7.1E-07 40.4 2.0 29 11-61 121-149 (256)
292 cd05051 PTKc_DDR Catalytic dom 94.1 0.025 5.4E-07 42.0 1.4 17 11-27 150-166 (296)
293 cd08229 STKc_Nek7 Catalytic do 94.1 0.027 5.9E-07 41.1 1.6 17 11-27 126-142 (267)
294 cd06633 STKc_TAO3 Catalytic do 94.1 0.037 8.1E-07 42.1 2.4 29 11-61 141-169 (313)
295 cd06648 STKc_PAK_II Catalytic 94.1 0.031 6.6E-07 41.9 1.9 28 11-60 135-162 (285)
296 KOG0603|consensus 94.1 0.045 9.7E-07 47.7 3.0 35 10-66 434-469 (612)
297 cd07861 STKc_CDK1_euk Catalyti 94.1 0.024 5.2E-07 41.7 1.2 17 11-27 121-137 (285)
298 cd05055 PTKc_PDGFR Catalytic d 94.1 0.027 5.9E-07 42.7 1.5 17 11-27 161-177 (302)
299 cd05570 STKc_PKC Catalytic dom 94.1 0.026 5.7E-07 43.2 1.4 29 11-61 116-144 (318)
300 cd05606 STKc_beta_ARK Catalyti 94.1 0.026 5.7E-07 42.1 1.4 17 11-27 117-133 (278)
301 cd07849 STKc_ERK1_2_like Catal 94.1 0.023 4.9E-07 43.7 1.1 17 11-27 126-142 (336)
302 cd06657 STKc_PAK4 Catalytic do 94.0 0.027 5.8E-07 42.6 1.4 28 11-60 136-163 (292)
303 cd05572 STKc_cGK_PKG Catalytic 94.0 0.028 6E-07 41.0 1.5 30 11-62 113-142 (262)
304 cd07836 STKc_Pho85 Catalytic d 94.0 0.032 6.9E-07 41.1 1.8 17 11-27 120-136 (284)
305 cd06640 STKc_MST4 Catalytic do 94.0 0.03 6.4E-07 41.5 1.6 17 11-27 121-137 (277)
306 cd07838 STKc_CDK4_6_like Catal 94.0 0.04 8.7E-07 40.4 2.3 28 11-60 127-154 (287)
307 cd07880 STKc_p38gamma_MAPK12 C 94.0 0.034 7.3E-07 43.1 2.0 29 11-61 138-166 (343)
308 cd07843 STKc_CDC2L1 Catalytic 94.0 0.031 6.7E-07 41.6 1.7 17 11-27 126-142 (293)
309 cd05098 PTKc_FGFR1 Catalytic d 94.0 0.024 5.2E-07 42.8 1.1 17 11-27 160-176 (307)
310 cd06621 PKc_MAPKK_Pek1_like Ca 93.9 0.034 7.3E-07 41.5 1.8 29 11-61 125-153 (287)
311 cd05045 PTKc_RET Catalytic dom 93.9 0.032 6.9E-07 41.6 1.6 17 11-27 147-163 (290)
312 PHA03390 pk1 serine/threonine- 93.9 0.04 8.7E-07 40.9 2.1 28 11-60 129-157 (267)
313 cd05577 STKc_GRK Catalytic dom 93.9 0.024 5.2E-07 42.0 0.9 28 11-60 115-142 (277)
314 cd07847 STKc_CDKL1_4 Catalytic 93.9 0.035 7.5E-07 40.8 1.7 17 11-27 120-136 (286)
315 cd06631 STKc_YSK4 Catalytic do 93.9 0.026 5.7E-07 41.2 1.0 28 12-61 123-150 (265)
316 cd07852 STKc_MAPK15 Catalytic 93.8 0.04 8.6E-07 42.3 2.0 17 11-27 127-143 (337)
317 cd06659 STKc_PAK6 Catalytic do 93.8 0.035 7.5E-07 42.0 1.7 28 11-60 137-164 (297)
318 cd06623 PKc_MAPKK_plant_like C 93.8 0.026 5.6E-07 40.8 1.0 30 10-61 119-148 (264)
319 cd06632 STKc_MEKK1_plant Catal 93.8 0.031 6.6E-07 40.3 1.3 17 11-27 122-138 (258)
320 cd07837 STKc_CdkB_plant Cataly 93.8 0.046 9.9E-07 40.5 2.3 16 11-26 130-145 (295)
321 cd08530 STKc_CNK2-like Catalyt 93.8 0.051 1.1E-06 39.1 2.4 28 11-60 123-150 (256)
322 PTZ00283 serine/threonine prot 93.8 0.042 9.1E-07 45.6 2.2 28 11-60 163-190 (496)
323 cd05036 PTKc_ALK_LTK Catalytic 93.7 0.051 1.1E-06 40.2 2.4 17 11-27 136-152 (277)
324 cd05610 STKc_MASTL Catalytic d 93.7 0.041 8.9E-07 47.4 2.2 30 11-62 124-153 (669)
325 cd06610 STKc_OSR1_SPAK Catalyt 93.7 0.035 7.5E-07 40.2 1.4 29 11-61 122-150 (267)
326 cd06608 STKc_myosinIII_like Ca 93.7 0.027 5.9E-07 40.8 0.9 29 11-61 133-161 (275)
327 KOG0658|consensus 93.7 0.038 8.2E-07 45.4 1.8 18 10-27 144-161 (364)
328 cd05611 STKc_Rim15_like Cataly 93.7 0.039 8.4E-07 40.2 1.7 17 11-27 117-133 (260)
329 cd05104 PTKc_Kit Catalytic dom 93.7 0.051 1.1E-06 42.9 2.5 17 11-27 234-250 (375)
330 cd06626 STKc_MEKK4 Catalytic d 93.7 0.032 6.9E-07 40.4 1.2 17 11-27 119-135 (264)
331 cd05092 PTKc_TrkA Catalytic do 93.7 0.036 7.7E-07 41.2 1.5 17 11-27 142-158 (280)
332 cd06634 STKc_TAO2 Catalytic do 93.6 0.033 7.1E-07 42.2 1.3 29 11-61 135-163 (308)
333 cd06651 STKc_MEKK3 Catalytic d 93.6 0.036 7.8E-07 40.7 1.4 17 11-27 126-142 (266)
334 cd07830 STKc_MAK_like Catalyti 93.6 0.049 1.1E-06 40.0 2.2 17 11-27 119-135 (283)
335 cd07851 STKc_p38 Catalytic dom 93.6 0.035 7.6E-07 42.9 1.4 29 11-61 138-166 (343)
336 cd07842 STKc_CDK8_like Catalyt 93.6 0.031 6.8E-07 41.7 1.1 16 11-26 128-143 (316)
337 cd05576 STKc_RPK118_like Catal 93.6 0.042 9.1E-07 40.0 1.7 18 10-27 104-121 (237)
338 cd05061 PTKc_InsR Catalytic do 93.6 0.037 8E-07 41.3 1.4 17 11-27 139-155 (288)
339 cd07865 STKc_CDK9 Catalytic do 93.5 0.035 7.5E-07 41.3 1.2 17 11-27 139-155 (310)
340 KOG0610|consensus 93.5 0.058 1.2E-06 45.4 2.6 32 10-63 198-229 (459)
341 KOG1235|consensus 93.5 0.06 1.3E-06 46.2 2.8 33 12-62 322-354 (538)
342 cd07860 STKc_CDK2_3 Catalytic 93.5 0.044 9.5E-07 40.4 1.8 17 11-27 120-136 (284)
343 cd06607 STKc_TAO Catalytic dom 93.5 0.063 1.4E-06 40.5 2.6 29 11-61 135-163 (307)
344 cd07864 STKc_CDK12 Catalytic d 93.5 0.036 7.9E-07 41.2 1.3 17 11-27 136-152 (302)
345 cd06653 STKc_MEKK3_like_1 Cata 93.5 0.035 7.6E-07 40.7 1.2 17 11-27 126-142 (264)
346 cd06917 STKc_NAK1_like Catalyt 93.5 0.034 7.3E-07 40.9 1.0 18 10-27 120-137 (277)
347 cd06628 STKc_MAPKKK_Byr2_like 93.5 0.034 7.3E-07 40.6 1.0 17 11-27 126-142 (267)
348 cd07877 STKc_p38alpha_MAPK14 C 93.4 0.054 1.2E-06 42.0 2.2 17 11-27 140-156 (345)
349 cd07856 STKc_Sty1_Hog1 Catalyt 93.4 0.037 8E-07 42.7 1.2 17 11-27 128-144 (328)
350 cd06642 STKc_STK25-YSK1 Cataly 93.4 0.065 1.4E-06 39.6 2.4 17 11-27 121-137 (277)
351 KOG0983|consensus 93.3 0.033 7.2E-07 45.4 0.9 37 3-61 204-240 (391)
352 KOG0608|consensus 93.3 0.053 1.1E-06 48.5 2.2 32 8-61 746-777 (1034)
353 cd06624 STKc_ASK Catalytic dom 93.3 0.054 1.2E-06 39.7 1.9 16 11-26 128-143 (268)
354 KOG1006|consensus 93.3 0.016 3.5E-07 46.9 -0.9 38 3-62 180-217 (361)
355 cd05046 PTK_CCK4 Pseudokinase 93.3 0.057 1.2E-06 39.6 2.0 17 11-27 137-153 (275)
356 PRK09902 hypothetical protein; 93.3 0.048 1E-06 41.9 1.6 44 10-73 147-195 (216)
357 cd07840 STKc_CDK9_like Catalyt 93.2 0.04 8.6E-07 40.3 1.1 17 11-27 120-136 (287)
358 PLN03224 probable serine/threo 93.2 0.062 1.3E-06 45.5 2.3 28 11-60 329-356 (507)
359 cd05065 PTKc_EphR_B Catalytic 93.1 0.066 1.4E-06 39.3 2.1 18 10-27 125-142 (269)
360 cd05043 PTK_Ryk Pseudokinase d 93.1 0.053 1.1E-06 40.0 1.6 17 11-27 137-153 (280)
361 PTZ00284 protein kinase; Provi 93.1 0.048 1E-06 44.3 1.5 18 10-27 251-268 (467)
362 cd07858 STKc_TEY_MAPK_plant Ca 93.0 0.047 1E-06 42.0 1.3 17 11-27 128-144 (337)
363 cd06647 STKc_PAK_I Catalytic d 93.0 0.052 1.1E-06 40.9 1.5 17 11-27 135-151 (293)
364 cd06606 STKc_MAPKKK Catalytic 93.0 0.038 8.3E-07 39.3 0.8 18 10-27 120-137 (260)
365 COG0478 RIO-like serine/threon 93.0 0.069 1.5E-06 43.0 2.3 31 9-61 220-250 (304)
366 cd07855 STKc_ERK5 Catalytic do 93.0 0.049 1.1E-06 41.8 1.4 17 11-27 127-143 (334)
367 cd05105 PTKc_PDGFR_alpha Catal 93.0 0.07 1.5E-06 43.1 2.3 16 12-27 258-273 (400)
368 COG3281 Ble Uncharacterized pr 92.9 0.059 1.3E-06 44.9 1.8 42 12-76 286-336 (438)
369 KOG0581|consensus 92.9 0.028 6E-07 46.3 -0.2 43 9-75 197-239 (364)
370 PLN00181 protein SPA1-RELATED; 92.8 0.089 1.9E-06 45.9 2.8 18 10-27 99-116 (793)
371 cd06609 STKc_MST3_like Catalyt 92.7 0.054 1.2E-06 39.8 1.2 17 11-27 118-134 (274)
372 PLN00009 cyclin-dependent kina 92.7 0.096 2.1E-06 39.0 2.5 16 11-26 122-137 (294)
373 PRK13184 pknD serine/threonine 92.6 0.078 1.7E-06 48.2 2.3 30 11-62 133-162 (932)
374 KOG1163|consensus 92.6 0.089 1.9E-06 42.3 2.3 33 10-61 130-162 (341)
375 KOG3087|consensus 92.5 0.15 3.1E-06 39.5 3.3 34 11-63 133-166 (229)
376 PTZ00024 cyclin-dependent prot 92.4 0.058 1.3E-06 41.2 1.1 17 11-27 139-155 (335)
377 cd07831 STKc_MOK Catalytic dom 92.4 0.083 1.8E-06 38.7 1.8 16 11-26 120-135 (282)
378 KOG0588|consensus 92.3 0.062 1.4E-06 47.6 1.3 34 10-65 131-164 (786)
379 cd05077 PTK_Jak1_rpt1 Pseudoki 92.2 0.1 2.2E-06 38.5 2.1 17 11-27 125-141 (262)
380 cd05107 PTKc_PDGFR_beta Cataly 92.2 0.1 2.2E-06 42.2 2.3 17 11-27 259-275 (401)
381 KOG0599|consensus 92.1 0.073 1.6E-06 43.5 1.3 39 12-72 144-182 (411)
382 KOG0596|consensus 92.1 0.11 2.4E-06 45.4 2.4 29 10-61 479-507 (677)
383 KOG0592|consensus 92.0 0.1 2.2E-06 45.2 2.2 18 10-27 193-210 (604)
384 cd07829 STKc_CDK_like Catalyti 91.9 0.11 2.4E-06 38.0 2.0 16 12-27 119-134 (282)
385 KOG0593|consensus 91.9 0.097 2.1E-06 43.1 1.8 28 12-61 122-149 (396)
386 cd08225 STKc_Nek5 Catalytic do 91.8 0.073 1.6E-06 38.4 0.9 17 11-27 121-137 (257)
387 KOG1166|consensus 91.7 0.18 3.9E-06 46.2 3.5 36 10-60 813-848 (974)
388 cd06630 STKc_MEKK1 Catalytic d 91.6 0.1 2.2E-06 38.0 1.5 16 11-26 123-138 (268)
389 cd08222 STKc_Nek11 Catalytic d 91.5 0.098 2.1E-06 38.0 1.3 16 11-26 126-141 (260)
390 KOG1164|consensus 91.4 0.11 2.5E-06 40.4 1.7 36 9-61 140-175 (322)
391 cd08220 STKc_Nek8 Catalytic do 91.3 0.1 2.3E-06 37.5 1.3 16 11-26 121-136 (256)
392 cd05064 PTKc_EphR_A10 Catalyti 91.2 0.14 3E-06 37.8 1.9 17 11-27 127-143 (266)
393 KOG1035|consensus 91.0 0.14 3E-06 48.0 2.0 30 11-62 717-746 (1351)
394 KOG0660|consensus 90.9 0.12 2.5E-06 42.6 1.3 33 10-64 144-176 (359)
395 KOG0668|consensus 90.9 0.11 2.4E-06 41.6 1.1 37 11-68 152-188 (338)
396 cd06611 STKc_SLK_like Catalyti 90.8 0.13 2.7E-06 38.0 1.4 17 11-27 123-139 (280)
397 KOG0616|consensus 90.6 0.18 4E-06 41.2 2.2 29 11-61 164-192 (355)
398 cd06620 PKc_MAPKK_Byr1_like Ca 90.5 0.14 3E-06 38.0 1.3 17 11-27 124-140 (284)
399 PRK14705 glycogen branching en 90.4 0.21 4.5E-06 46.7 2.6 35 8-59 329-363 (1224)
400 COG5072 ALK1 Serine/threonine 90.1 0.13 2.9E-06 43.4 1.1 45 4-71 335-379 (488)
401 cd05078 PTK_Jak2_Jak3_rpt1 Pse 89.9 0.25 5.3E-06 36.1 2.2 17 11-27 120-136 (258)
402 KOG0659|consensus 89.7 0.21 4.6E-06 40.3 1.9 29 12-62 122-150 (318)
403 KOG0615|consensus 89.6 0.19 4.2E-06 42.4 1.6 18 10-27 295-312 (475)
404 cd07854 STKc_MAPK4_6 Catalytic 89.6 0.13 2.9E-06 39.7 0.6 16 11-26 134-149 (342)
405 KOG0032|consensus 89.5 0.22 4.8E-06 40.7 1.9 38 10-65 154-191 (382)
406 cd08227 PK_STRAD_alpha Pseudok 89.3 0.29 6.2E-06 37.4 2.3 17 11-27 121-137 (327)
407 KOG0595|consensus 89.2 0.38 8.3E-06 40.4 3.1 41 11-67 129-169 (429)
408 KOG0598|consensus 89.1 0.15 3.2E-06 42.0 0.6 18 10-27 144-161 (357)
409 PHA02988 hypothetical protein; 89.1 0.21 4.6E-06 37.6 1.5 15 13-27 145-159 (283)
410 COG2187 Uncharacterized protei 88.9 0.28 6E-06 39.9 2.0 20 7-26 206-225 (337)
411 KOG0578|consensus 88.9 0.35 7.7E-06 41.8 2.7 31 10-62 388-418 (550)
412 KOG0605|consensus 88.8 0.19 4.1E-06 43.3 1.0 32 8-61 258-289 (550)
413 cd08226 PK_STRAD_beta Pseudoki 88.7 0.25 5.5E-06 37.7 1.6 17 11-27 121-137 (328)
414 COG3231 Aph Aminoglycoside pho 88.7 0.52 1.1E-05 37.3 3.3 44 8-73 183-226 (266)
415 KOG0198|consensus 88.7 0.33 7.1E-06 39.0 2.3 16 11-26 137-152 (313)
416 KOG0665|consensus 88.5 0.27 5.7E-06 40.5 1.7 32 9-62 136-167 (369)
417 KOG0582|consensus 88.5 0.31 6.8E-06 41.6 2.1 17 11-27 146-162 (516)
418 KOG1187|consensus 87.8 0.34 7.4E-06 39.1 1.9 19 10-28 196-214 (361)
419 KOG0579|consensus 87.7 0.32 6.9E-06 43.9 1.8 17 11-27 150-166 (1187)
420 COG1718 RIO1 Serine/threonine 87.5 0.36 7.7E-06 38.3 1.8 27 11-60 187-213 (268)
421 cd05076 PTK_Tyk2_rpt1 Pseudoki 87.3 0.47 1E-05 35.3 2.3 17 11-27 137-153 (274)
422 KOG1167|consensus 87.0 0.38 8.3E-06 40.3 1.8 32 10-62 151-182 (418)
423 KOG0586|consensus 86.5 0.35 7.7E-06 42.1 1.4 31 10-62 174-204 (596)
424 KOG0604|consensus 86.3 0.37 8E-06 39.7 1.3 36 11-65 181-216 (400)
425 KOG0577|consensus 86.2 0.32 6.9E-06 43.4 1.0 33 11-65 146-178 (948)
426 KOG2268|consensus 85.6 0.61 1.3E-05 39.1 2.2 27 11-59 222-248 (465)
427 KOG4236|consensus 85.5 0.61 1.3E-05 41.2 2.3 33 11-62 684-716 (888)
428 KOG1151|consensus 85.1 0.8 1.7E-05 39.8 2.8 30 12-60 591-620 (775)
429 COG0515 SPS1 Serine/threonine 84.9 0.53 1.1E-05 32.9 1.4 28 12-61 122-150 (384)
430 KOG0663|consensus 84.2 0.71 1.5E-05 38.5 2.0 18 10-27 196-213 (419)
431 KOG0607|consensus 84.2 0.79 1.7E-05 38.3 2.3 32 11-61 196-227 (463)
432 KOG0192|consensus 83.6 0.82 1.8E-05 37.2 2.2 16 12-27 164-179 (362)
433 KOG0661|consensus 83.5 0.6 1.3E-05 40.1 1.4 17 10-26 129-145 (538)
434 KOG0666|consensus 83.5 0.97 2.1E-05 37.6 2.6 16 12-27 153-168 (438)
435 KOG0600|consensus 83.3 0.87 1.9E-05 39.4 2.3 29 11-61 238-266 (560)
436 KOG0671|consensus 83.2 1.2 2.6E-05 37.4 3.0 48 10-60 211-259 (415)
437 COG3001 Uncharacterized protei 83.1 0.8 1.7E-05 36.5 1.9 64 3-97 180-245 (286)
438 KOG0585|consensus 82.8 0.86 1.9E-05 39.4 2.1 17 11-27 230-246 (576)
439 KOG0612|consensus 82.0 0.81 1.7E-05 43.0 1.7 20 8-27 192-211 (1317)
440 PTZ00266 NIMA-related protein 81.8 0.79 1.7E-05 42.3 1.6 17 11-27 145-161 (1021)
441 KOG0664|consensus 81.6 0.93 2E-05 37.3 1.8 17 11-27 176-192 (449)
442 PF07714 Pkinase_Tyr: Protein 81.3 1 2.2E-05 33.2 1.8 16 12-27 124-139 (259)
443 cd00142 PI3Kc_like Phosphoinos 81.2 1.3 2.9E-05 33.2 2.4 31 11-62 129-159 (219)
444 KOG1027|consensus 81.0 0.83 1.8E-05 41.5 1.4 18 10-27 625-642 (903)
445 KOG0907|consensus 80.7 3.9 8.4E-05 27.7 4.4 45 50-97 21-65 (106)
446 KOG0591|consensus 80.1 1.3 2.8E-05 36.3 2.1 17 11-27 148-164 (375)
447 smart00146 PI3Kc Phosphoinosit 79.9 1.6 3.5E-05 32.3 2.4 31 12-64 103-133 (202)
448 KOG0694|consensus 78.8 1 2.3E-05 39.9 1.3 44 11-76 488-531 (694)
449 KOG0574|consensus 78.6 0.64 1.4E-05 38.6 -0.1 15 13-27 151-165 (502)
450 KOG0590|consensus 78.1 1.7 3.8E-05 37.6 2.4 37 9-67 438-474 (601)
451 KOG1989|consensus 77.7 1.1 2.4E-05 40.0 1.2 34 12-67 167-200 (738)
452 PHA03111 Ser/Thr kinase; Provi 77.5 2.6 5.6E-05 35.4 3.2 21 7-27 299-319 (444)
453 PF10707 YrbL-PhoP_reg: PhoP r 77.5 2.4 5.3E-05 31.7 2.8 27 13-57 140-166 (199)
454 KOG0193|consensus 77.1 1.3 2.8E-05 39.2 1.3 33 11-65 508-540 (678)
455 cd00892 PIKKc_ATR ATR (Ataxia 76.0 2.2 4.8E-05 32.6 2.3 30 11-61 140-169 (237)
456 PF05445 Pox_ser-thr_kin: Poxv 76.0 2.9 6.2E-05 35.2 3.0 22 6-27 294-315 (434)
457 KOG0575|consensus 75.7 1.6 3.5E-05 38.1 1.6 18 10-27 137-154 (592)
458 cd05172 PIKKc_DNA-PK DNA-depen 75.5 2.9 6.3E-05 32.0 2.8 31 10-61 136-166 (235)
459 cd05168 PI4Kc_III_beta Phospho 74.5 2.3 5E-05 33.9 2.1 26 15-62 146-171 (293)
460 cd00893 PI4Kc_III Phosphoinosi 74.0 2.4 5.1E-05 33.8 2.0 30 15-66 144-173 (289)
461 KOG1236|consensus 73.5 1.9 4.1E-05 37.1 1.4 16 12-27 366-381 (565)
462 cd05169 PIKKc_TOR TOR (Target 73.3 2.6 5.7E-05 32.7 2.1 30 10-60 181-210 (280)
463 cd05167 PI4Kc_III_alpha Phosph 70.7 3.4 7.5E-05 33.2 2.3 29 12-62 162-190 (311)
464 KOG0670|consensus 70.7 3.1 6.8E-05 36.7 2.1 18 10-27 555-572 (752)
465 KOG0662|consensus 70.6 2.7 5.9E-05 32.8 1.6 25 14-60 124-148 (292)
466 cd05170 PIKKc_SMG1 Suppressor 70.1 3.9 8.6E-05 32.4 2.5 29 11-60 210-238 (307)
467 cd00891 PI3Kc Phosphoinositide 69.9 3 6.6E-05 34.0 1.8 26 14-61 207-232 (352)
468 cd05171 PIKKc_ATM Ataxia telan 69.4 4 8.6E-05 31.9 2.3 29 11-60 182-210 (279)
469 cd05164 PIKKc Phosphoinositide 69.2 3.8 8.2E-05 31.0 2.1 29 11-60 132-160 (222)
470 KOG0611|consensus 68.8 3.2 6.9E-05 35.8 1.8 42 12-76 174-215 (668)
471 PF00454 PI3_PI4_kinase: Phosp 68.8 3.2 7E-05 30.7 1.7 27 15-62 139-165 (235)
472 PF14531 Kinase-like: Kinase-l 68.5 3.3 7.2E-05 32.9 1.7 17 11-27 165-181 (288)
473 KOG3653|consensus 68.3 3.6 7.8E-05 35.5 2.0 20 8-27 333-352 (534)
474 cd05166 PI3Kc_II Phosphoinosit 67.1 4.7 0.0001 33.0 2.4 26 14-61 206-231 (353)
475 cd00896 PI3Kc_III Phosphoinosi 65.3 4.5 9.7E-05 33.0 1.9 27 14-62 206-232 (350)
476 COG2112 Predicted Ser/Thr prot 65.3 4.2 9.2E-05 31.1 1.7 32 11-65 125-158 (201)
477 KOG0201|consensus 65.3 4.8 0.0001 34.3 2.1 29 12-62 132-160 (467)
478 PF08207 EFP_N: Elongation fac 65.3 7.2 0.00016 23.6 2.4 26 15-62 3-28 (58)
479 cd02986 DLP Dim1 family, Dim1- 65.1 15 0.00032 25.5 4.3 53 50-104 14-66 (114)
480 KOG1165|consensus 64.7 7.6 0.00017 32.6 3.2 34 12-62 145-178 (449)
481 KOG1152|consensus 63.5 5.9 0.00013 35.4 2.4 31 10-62 689-719 (772)
482 KOG0197|consensus 62.9 3.3 7.2E-05 35.3 0.8 29 11-61 323-351 (468)
483 KOG4158|consensus 62.7 5.2 0.00011 34.4 1.9 33 11-61 361-393 (598)
484 KOG2270|consensus 62.6 4.7 0.0001 34.5 1.6 26 11-59 285-310 (520)
485 cd05173 PI3Kc_IA_beta Phosphoi 62.1 5.7 0.00012 32.7 2.0 25 15-61 213-237 (362)
486 cd05165 PI3Kc_I Phosphoinositi 61.9 5.8 0.00012 32.7 2.0 25 15-61 217-241 (366)
487 KOG1240|consensus 59.7 3.3 7.1E-05 39.3 0.2 19 8-26 137-155 (1431)
488 KOG0587|consensus 59.2 8.8 0.00019 35.4 2.8 67 9-106 141-213 (953)
489 cd05177 PI3Kc_C2_gamma Phospho 58.5 7.2 0.00016 32.0 2.0 26 15-62 208-233 (354)
490 KOG0580|consensus 58.2 3.4 7.4E-05 33.0 0.1 16 12-27 145-160 (281)
491 KOG4721|consensus 57.8 5.2 0.00011 35.9 1.1 16 12-27 233-248 (904)
492 PF13575 DUF4135: Domain of un 56.6 7.7 0.00017 31.2 1.9 26 15-63 153-178 (370)
493 KOG0914|consensus 56.5 13 0.00028 29.4 3.0 54 50-104 144-197 (265)
494 KOG0033|consensus 55.1 8.6 0.00019 31.3 1.9 17 11-27 130-146 (355)
495 cd05174 PI3Kc_IA_delta Phospho 54.7 9.1 0.0002 31.5 2.0 25 15-61 213-237 (361)
496 cd00894 PI3Kc_IB_gamma Phospho 54.6 11 0.00023 31.2 2.4 28 14-63 216-243 (365)
497 KOG0614|consensus 54.1 7.8 0.00017 34.3 1.6 28 11-60 540-567 (732)
498 KOG2464|consensus 53.6 4.6 0.0001 30.9 0.1 23 5-27 152-174 (246)
499 cd05176 PI3Kc_C2_alpha Phospho 53.4 11 0.00024 31.0 2.3 26 14-61 206-231 (353)
500 KOG0903|consensus 53.2 11 0.00024 34.2 2.4 27 17-65 702-728 (847)
No 1
>KOG2686|consensus
Probab=99.96 E-value=1.5e-30 Score=209.75 Aligned_cols=80 Identities=50% Similarity=0.757 Sum_probs=74.4
Q ss_pred ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCC
Q psy15665 4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK 83 (107)
Q Consensus 4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~ 83 (107)
+..++|+||||||||+||||+.++ + +.+++||||||+||||||||||||||||+||+.+
T Consensus 206 e~~~~~vvFcHNDlq~gNiL~~~~----t-----------------~~Lv~IDfEYasyN~r~fDlanHf~E~~~DY~~~ 264 (366)
T KOG2686|consen 206 ELTKSPVVFCHNDLQYGNILLLNS----T-----------------KELVLIDFEYASYNPRGFDLANHFCEWAADYHTP 264 (366)
T ss_pred hcCCCCeeeecccccccceeeecC----C-----------------CceeEEeeccccCCchhhhHHHHHHHhhccccCC
Confidence 347889999999999999999864 1 5799999999999999999999999999999999
Q ss_pred CCCceeecCCCCCCHHHHhhc
Q psy15665 84 HFPHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 84 ~~p~~~~~~~~~Pt~~~~~~~ 104 (107)
++|+++++.+.||++++|+.+
T Consensus 265 ~~P~~~~~~~~~p~~e~~~~F 285 (366)
T KOG2686|consen 265 TPPGLKINPDLYPGEEQRQRF 285 (366)
T ss_pred CCCeeecchhhCCCcHHHHHH
Confidence 999999999999999999876
No 2
>PTZ00296 choline kinase; Provisional
Probab=99.94 E-value=5.6e-27 Score=192.54 Aligned_cols=78 Identities=44% Similarity=0.792 Sum_probs=72.7
Q ss_pred ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCC
Q psy15665 4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK 83 (107)
Q Consensus 4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~ 83 (107)
+..+.++||||||+++||||..+ ++|.||||||||+|+|+||||||||||++||+.+
T Consensus 278 ~~~~~~~VfCHNDl~~~NiL~~~-----------------------~~l~LIDfEYAg~ndpafDIAn~f~E~~~dy~~~ 334 (442)
T PTZ00296 278 DNLANDIVFCHNDLQENNIINTN-----------------------KCLRLIDFEYSGYNFLATDIANFFIETTIDYSVS 334 (442)
T ss_pred ccccCCeeEEeCCCCccceeecC-----------------------CCEEEEeecccccccHHHHHHHHHHHHhhhcCCC
Confidence 35678999999999999999755 5699999999999999999999999999999999
Q ss_pred CCCceeecCCCCCCHHHHhhc
Q psy15665 84 HFPHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 84 ~~p~~~~~~~~~Pt~~~~~~~ 104 (107)
+.|+|.++.++|||.++|+.+
T Consensus 335 ~~p~f~~d~~~yPs~e~q~~F 355 (442)
T PTZ00296 335 HYPFFAIDKKKYISYENRKLF 355 (442)
T ss_pred CCCccccCcccCcCHHHHHHH
Confidence 999999999999999999876
No 3
>PTZ00384 choline kinase; Provisional
Probab=99.93 E-value=1.3e-26 Score=187.45 Aligned_cols=76 Identities=30% Similarity=0.450 Sum_probs=70.7
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCC
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFP 86 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p 86 (107)
..++|||||||++||||..+ +++.||||||||+|+|+||||||||||++||+.++.|
T Consensus 224 ~~~~VfCHNDL~~gNIL~~~-----------------------~~l~lID~EYA~~n~~~fDLAn~f~E~~~~y~~~~~~ 280 (383)
T PTZ00384 224 TNSVLFCHNDLFFTNILDFN-----------------------QGIYFIDFDFAGFNYVGWEIANFFVKLYIVYDPPTPP 280 (383)
T ss_pred ccceeeeeccCCcccEEecC-----------------------CCEEEEEeccccCCchHhHHHHHHHHHhcccCCCCCC
Confidence 45799999999999999755 6799999999999999999999999999999999999
Q ss_pred ceeecCCCCCCHHHHhhcc
Q psy15665 87 HYTVKRENYPSYSLRNSSW 105 (107)
Q Consensus 87 ~~~~~~~~~Pt~~~~~~~~ 105 (107)
+|+++.+.||++++|+.+.
T Consensus 281 ~~~~~~~~~ps~e~~~~fi 299 (383)
T PTZ00384 281 YFNSDDSLALSEEMKTIFV 299 (383)
T ss_pred ccccCCCCCCCHHHHHHHH
Confidence 9999999999999998763
No 4
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome. Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=99.93 E-value=2.7e-27 Score=174.01 Aligned_cols=75 Identities=47% Similarity=0.822 Sum_probs=59.9
Q ss_pred cccCCCCeEEEecccCCCceee-ecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665 3 LLKIKSPVTFCHNDLQEGNILY-RESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS 81 (107)
Q Consensus 3 l~~~~~~~VfcHnDl~~gNiL~-~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~ 81 (107)
+++..+|+|||||||++||||+ ... +++.||||||||+|+|+||||||||||++++.
T Consensus 136 l~~~~~~~v~cHnDl~~~Nil~~~~~----------------------~~~~lIDfEya~~n~~~fDia~~f~e~~~~~~ 193 (211)
T PF01633_consen 136 LEKSNSPLVFCHNDLNPGNILINNKD----------------------GEVKLIDFEYAGYNDRAFDIANFFCEWNFDYE 193 (211)
T ss_dssp HHTSCGGEEEE-S--SGGGEEETSSS----------------------SCEEE--GTT-EEEEHHHHHHHHHHHTTEETT
T ss_pred hhccCCCceEeeccCccccEEeccCC----------------------CeEEEecHHHHhhccchhhHHHHHHHHcCchh
Confidence 4567889999999999999999 332 78999999999999999999999999999999
Q ss_pred CCCCCceeecCCCCCCHHH
Q psy15665 82 YKHFPHYTVKRENYPSYSL 100 (107)
Q Consensus 82 ~~~~p~~~~~~~~~Pt~~~ 100 (107)
..+. +++++.++|||++|
T Consensus 194 ~~~~-~~~~~~~~yp~~~~ 211 (211)
T PF01633_consen 194 QEEF-FFKCDYSKYPTEEQ 211 (211)
T ss_dssp HSST-STEE-GGGS--HHH
T ss_pred hhhh-hhhhhHhhCCCccC
Confidence 9987 88999999999986
No 5
>KOG4720|consensus
Probab=99.90 E-value=7.2e-25 Score=175.11 Aligned_cols=74 Identities=45% Similarity=0.705 Sum_probs=64.5
Q ss_pred ccccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665 2 HLLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS 81 (107)
Q Consensus 2 ~l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~ 81 (107)
+|...++|+|||||||.+|||++++. .+.|.+||||||+|||++|||||||||++
T Consensus 240 ~l~~L~sPVVFcHNDLL~~Niiy~~~---------------------~~~v~fIDYEYa~yNY~afDIgNHFnE~a---- 294 (391)
T KOG4720|consen 240 MLSMLKSPVVFCHNDLLCGNIIYDSE---------------------KGSVEFIDYEYAGYNYQAFDIGNHFNEYA---- 294 (391)
T ss_pred HHHhhCCCeEEeecchhhcceeeccc---------------------cCcEEEEeecccccchhheehhhhHHhhc----
Confidence 46778999999999999999999884 17899999999999999999999999997
Q ss_pred CCCCCceeecCCCCCCHHHHhhc
Q psy15665 82 YKHFPHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 82 ~~~~p~~~~~~~~~Pt~~~~~~~ 104 (107)
.-+ .++.++||++++|.++
T Consensus 295 Gv~----evDYSlyp~rE~Q~qw 313 (391)
T KOG4720|consen 295 GVE----EVDYSLYPTREEQLQW 313 (391)
T ss_pred CCC----ccchhcCCCHHHHHHH
Confidence 222 3556999999999765
No 6
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=99.90 E-value=8.7e-24 Score=161.84 Aligned_cols=82 Identities=51% Similarity=0.882 Sum_probs=72.0
Q ss_pred CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCC
Q psy15665 6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF 85 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~ 85 (107)
...++||||||++++|||+.+++.+ .+.+.||||||||+|+|+||||++||||+++|+....
T Consensus 175 ~~~~~~lcH~Dl~~~Nil~~~~~~~------------------~~~i~lIDwEya~~~~p~~DlA~~~~e~~~~~~~~~~ 236 (302)
T cd05156 175 SGSPVVFCHNDLQEGNILLLNPSSE------------------TKKLVLIDFEYASYNYRGFDIANHFCEWMYDYHDPEP 236 (302)
T ss_pred CCCCceEEecCCCcCeEEecCCCCC------------------CCcEEEEeeCCCCCCCcHHHHHHHHHHHHhhcCCCCC
Confidence 3588999999999999999863111 1579999999999999999999999999999999888
Q ss_pred CceeecCCCCCCHHHHhhcc
Q psy15665 86 PHYTVKRENYPSYSLRNSSW 105 (107)
Q Consensus 86 p~~~~~~~~~Pt~~~~~~~~ 105 (107)
|++.++.+.||+.++|..+.
T Consensus 237 ~~~~~~~~~~p~~~~~~~f~ 256 (302)
T cd05156 237 PFFKIHEDKYPTEEQRLNFI 256 (302)
T ss_pred CccccChhhCcCHHHHHHHH
Confidence 89999999999998887653
No 7
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=99.89 E-value=1.5e-23 Score=165.20 Aligned_cols=72 Identities=42% Similarity=0.704 Sum_probs=60.4
Q ss_pred ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCC
Q psy15665 4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK 83 (107)
Q Consensus 4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~ 83 (107)
...+.|+|||||||++||||+.++ + +++.||||||||+|+|+||||||||||+
T Consensus 176 ~~~~~~~v~CHnDl~~~NiL~~~~--~-------------------~~l~lID~EYag~nd~~fDIa~~f~E~~------ 228 (330)
T PLN02421 176 DSLKAPVVFAHNDLLSGNLMLNED--E-------------------GKLYFIDFEYGSYSYRGYDIGNHFNEYA------ 228 (330)
T ss_pred ccCCCCeEEEECCCCcccEEEeCC--C-------------------CcEEEEcccccCCCccHHHHHHHHHHHc------
Confidence 445789999999999999999753 0 5799999999999999999999999997
Q ss_pred CCCceeecCCCCCCHHHHhhcc
Q psy15665 84 HFPHYTVKRENYPSYSLRNSSW 105 (107)
Q Consensus 84 ~~p~~~~~~~~~Pt~~~~~~~~ 105 (107)
.+.++.+.||+.++|..++
T Consensus 229 ---~~~~~~~~~p~~~~~~~fl 247 (330)
T PLN02421 229 ---GFDCDYSLYPSKEEQYHFF 247 (330)
T ss_pred ---ccccCcccCcCHHHHHHHH
Confidence 2334558889998887653
No 8
>PLN02236 choline kinase
Probab=99.84 E-value=3.9e-21 Score=152.57 Aligned_cols=77 Identities=43% Similarity=0.717 Sum_probs=66.3
Q ss_pred cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCC
Q psy15665 5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 84 (107)
Q Consensus 5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~ 84 (107)
....++||||||++++|||+.++. +.+.+||||||++|+++||||+|||||+.+|..++
T Consensus 195 ~~~~~~~~cH~Dl~~~Nil~~~~~---------------------~~~~lID~Eya~~~~~~~Dia~~~~e~~~~y~~~~ 253 (344)
T PLN02236 195 GDDQEIGFCHNDLQYGNIMIDEET---------------------RAITIIDYEYASYNPVAYDIANHFCEMAADYHSET 253 (344)
T ss_pred ccCCCceEEeCCCCcCcEEEeCCC---------------------CcEEEEeehhccccchHHHHHHHHHHHHHhhcCCC
Confidence 346789999999999999998630 56999999999999999999999999999998655
Q ss_pred CCceeecCCCCCCHHHHhhc
Q psy15665 85 FPHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 85 ~p~~~~~~~~~Pt~~~~~~~ 104 (107)
|.. ++.+.||+.++|+.+
T Consensus 254 -~~~-~~~~~~~~~~~~~~f 271 (344)
T PLN02236 254 -PHI-LDYSKYPGEEERRRF 271 (344)
T ss_pred -ccc-CchhhCcCHHHHHHH
Confidence 444 788899999988765
No 9
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=99.81 E-value=4.1e-20 Score=136.36 Aligned_cols=69 Identities=46% Similarity=0.840 Sum_probs=59.0
Q ss_pred CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCC
Q psy15665 6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF 85 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~ 85 (107)
...+.|+||||++++|||+.+. . +.+.|||||||++++++||||++|+||+
T Consensus 166 ~~~~~~l~H~Dl~~~Nil~~~~--~-------------------~~~~lIDwe~a~~~~~~~Dla~~~~e~~-------- 216 (235)
T cd05157 166 LNSPIVFCHNDLLSGNIIYNEE--K-------------------NSVKFIDYEYAGYNYRAFDIANHFNEWA-------- 216 (235)
T ss_pred cCCCEEEEcCCCCcCcEEEeCC--C-------------------CCEEEEEcccCCcCchheeHHHHHHHHc--------
Confidence 3467999999999999999862 0 5699999999999999999999999997
Q ss_pred CceeecCCCCCCHHHHhhc
Q psy15665 86 PHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 86 p~~~~~~~~~Pt~~~~~~~ 104 (107)
.+.++..+||+.++|+.+
T Consensus 217 -~~~~~~~~~~~~~~~~~~ 234 (235)
T cd05157 217 -GFDCDYYLYPPKEEQQAF 234 (235)
T ss_pred -CccCChhhCcCHHHHHhh
Confidence 244445899999999875
No 10
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=99.65 E-value=1.2e-16 Score=124.03 Aligned_cols=73 Identities=32% Similarity=0.506 Sum_probs=58.2
Q ss_pred cccCCCC-eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665 3 LLKIKSP-VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS 81 (107)
Q Consensus 3 l~~~~~~-~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~ 81 (107)
+.....+ .|+||||++++|+|.+++ ++|.||||||||+|+++||||+++.|++.++.
T Consensus 145 l~~~~~~~~v~cH~Dl~~~N~l~t~~----------------------~~l~LIDWEyAg~~D~~~DLA~~~~e~~~~~~ 202 (269)
T COG0510 145 LEEVPKDDLVPCHNDLNPGNLLLTDK----------------------GGLFLIDWEYAGLNDPAFDLAALLSEYIFNHN 202 (269)
T ss_pred hhhcCCCceeeecCCCCccceEEcCC----------------------CcEEEEecccCCCccHHHHHHHHHHHhccchh
Confidence 3445566 899999999999999985 78999999999999999999999999998775
Q ss_pred CCCCCceeecCCCCCCH
Q psy15665 82 YKHFPHYTVKRENYPSY 98 (107)
Q Consensus 82 ~~~~p~~~~~~~~~Pt~ 98 (107)
..+ -.+..+.+.++.+
T Consensus 203 ~~~-~~~~~~~~~~~~~ 218 (269)
T COG0510 203 ELE-DLYSAYLEKYGFE 218 (269)
T ss_pred HHH-HHHHHHHHhCCch
Confidence 311 1233455666665
No 11
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=99.53 E-value=8.1e-15 Score=110.32 Aligned_cols=47 Identities=26% Similarity=0.334 Sum_probs=43.0
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
..+.|+||||+++||||+.+ +++.|||||||++++++||||++++++
T Consensus 143 ~~~~~l~H~Dl~~~Nil~~~-----------------------~~~~lIDwE~a~~gdp~~DLa~~~~~~ 189 (256)
T TIGR02721 143 PLPLAPLHMDVHAYNLVVTP-----------------------QGLKLIDWEYASDGDIALELAAIIRAN 189 (256)
T ss_pred CCCCeeecCCCCcCcEEEeC-----------------------CCCEEEeccccCcCCHHHHHHHHHHhC
Confidence 35789999999999999987 448999999999999999999999996
No 12
>PRK10271 thiK thiamine kinase; Provisional
Probab=99.37 E-value=6.4e-13 Score=99.37 Aligned_cols=48 Identities=27% Similarity=0.378 Sum_probs=43.5
Q ss_pred cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665 5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE 75 (107)
Q Consensus 5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E 75 (107)
..+.++|+||||++++|||+.+ +++.+|||||||.+.+++|||..+++
T Consensus 72 ~~~l~~~p~H~D~~~~N~~~~~-----------------------~~~~lIDwe~a~~gDp~~DLa~~~~~ 119 (188)
T PRK10271 72 PRPLRLAPLHMDVHAGNLVHSA-----------------------SGLRLIDWEYAGDGDIALELAAVWVE 119 (188)
T ss_pred CCCCCeeeecCCCCCccEEEEC-----------------------CCEEEEeCCcccCCCHHHHHHHHHcC
Confidence 4566789999999999999987 55999999999999999999999986
No 13
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=99.36 E-value=2e-13 Score=95.01 Aligned_cols=47 Identities=43% Similarity=0.669 Sum_probs=43.3
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhh
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVY 78 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~ 78 (107)
+.++||+|++++|||+.+ +++.+||||+|+++.+++|||.++.+|.+
T Consensus 106 ~~~~~HgD~~~~Nil~~~-----------------------~~~~liDf~~a~~~~~~~Dla~~~~~~~~ 152 (170)
T cd05151 106 DLVPCHNDLLPGNFLLDD-----------------------GRLWLIDWEYAGMNDPLFDLANFFSEAKL 152 (170)
T ss_pred CceeecCCCCcCcEEEEC-----------------------CeEEEEecccccCCChHHHHHHHHHhcCC
Confidence 678999999999999985 67999999999999999999999999854
No 14
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=99.30 E-value=2.9e-12 Score=91.80 Aligned_cols=49 Identities=20% Similarity=0.297 Sum_probs=43.0
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
.+.++||+|++++|||+.++ .. +.+.|||||+++++++++|||.++.+|
T Consensus 172 ~~~~l~HgD~~~~Nil~~~~-~~-------------------~~~~iID~e~~~~g~~~~Dla~~~~~~ 220 (223)
T cd05154 172 SRPGLVHGDYRLGNVLFHPD-EP-------------------RVVAVLDWELATLGDPLADLGWLLMYW 220 (223)
T ss_pred CCcEEEECCCCcccEEEcCC-CC-------------------cEEEEEeccccccCChHHHHHHHHHhc
Confidence 57899999999999999872 00 457899999999999999999999887
No 15
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=99.23 E-value=6.8e-12 Score=94.65 Aligned_cols=72 Identities=19% Similarity=0.171 Sum_probs=51.8
Q ss_pred cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCC
Q psy15665 5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH 84 (107)
Q Consensus 5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~ 84 (107)
....+.++||+|+++||||+.++ + +.|||||+|+++++.+|||.++.=+.++-.
T Consensus 148 ~~~~~~~~~HgD~~~~Nii~~~~----------------------~-~~iIDwe~a~~Gdp~~Dla~~~~~~~~~~~--- 201 (226)
T TIGR02172 148 EVPDTSTCLHGDFQIGNLITSGK----------------------G-TYWIDLGDFGYGNPLFDLGLLFMFCHYLDD--- 201 (226)
T ss_pred hCCCCCceEecCCCCCcEEEcCC----------------------C-cEEEechhcCcCCHHHHHHHHHHhccCChh---
Confidence 34556778999999999999873 4 899999999999999999998765543211
Q ss_pred CCceeecCCCCCCHHHHhhc
Q psy15665 85 FPHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 85 ~p~~~~~~~~~Pt~~~~~~~ 104 (107)
.+..-...|-.++.+.|+
T Consensus 202 --~~~~~~~~y~~~~~~~~~ 219 (226)
T TIGR02172 202 --DKLQAIFHMNAEQLKAHW 219 (226)
T ss_pred --HHHHHHHhcCHHHHHHHH
Confidence 122223455555555543
No 16
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=99.14 E-value=4e-11 Score=98.24 Aligned_cols=53 Identities=28% Similarity=0.461 Sum_probs=47.1
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCC
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY 82 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~ 82 (107)
..+.+++|+|+++||||+.+ ..+.|||||+|.+++++||||+++.++...|-.
T Consensus 220 ~~~~~l~HgDl~~gni~~~~-----------------------~~~~viD~E~a~~G~~~~Dlg~~lanl~~~~~~ 272 (401)
T PRK09550 220 TKAEALLHGDLHTGSIFVTE-----------------------EETKVIDPEFAFYGPIGFDIGTFIANLLLNYCS 272 (401)
T ss_pred cCCCceeeccCCcccEEeeC-----------------------CCcEEEeccccccCChHHHHHHHHHHHHHHHhc
Confidence 34678999999999999987 568999999999999999999999999876644
No 17
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=99.13 E-value=3.9e-11 Score=91.36 Aligned_cols=51 Identities=25% Similarity=0.356 Sum_probs=44.4
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhc
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYD 79 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~d 79 (107)
..|.++||+|++++|||+.++ +.+.|||||+|+++++.+|||..+..|++.
T Consensus 172 ~~~~~l~HgD~~~~Nil~~~~----------------------~~~~iIDfe~a~~g~~~~Dla~~~~~~~~~ 222 (296)
T cd05153 172 DLPRGVIHADLFRDNVLFDGD----------------------ELSGVIDFYFACTDAFLYDLAITLNDWCFD 222 (296)
T ss_pred cCCCcCCccCcCcccEEEeCC----------------------ceEEEeehhhhcCchHHHHHHHHHHHHHhC
Confidence 457899999999999999873 345799999999999999999999888753
No 18
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=99.10 E-value=1.2e-10 Score=86.53 Aligned_cols=48 Identities=19% Similarity=0.054 Sum_probs=41.4
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
..+.||||+|+++||||+.++ +.+.|||||+|+++++.+|||..+...
T Consensus 160 ~~~~~l~HgD~~~~Nil~~~~----------------------~~~~iIDwe~a~~gdp~~Dla~~~~~~ 207 (244)
T cd05150 160 EEDLVVTHGDACLPNIIVDPG----------------------KFSGFIDLGRLGVADRYQDLALAVRSL 207 (244)
T ss_pred cCceEEECCCCCCccEEEeCC----------------------cEEEEEEccccccccHHHHHHHHHHHh
Confidence 457899999999999999873 446799999999999999999877543
No 19
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
Probab=99.03 E-value=3.8e-10 Score=83.07 Aligned_cols=53 Identities=25% Similarity=0.402 Sum_probs=43.3
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
.+.|+||+|++++|||+..+.++. ...+.+|||++|+++++++||+.+++-++
T Consensus 118 ~~~vl~HgD~~~~N~~~~~~~~~~-----------------~~~~~liDfq~~~~g~p~~Dl~~~l~~~~ 170 (196)
T smart00587 118 EFNVLNHGDLWANNIMFKYDDEGK-----------------PEDVALIDFQLSHYGSPAEDLHYFLLTSL 170 (196)
T ss_pred CceEEeeCCCCccceeeccCCCCC-----------------ccceEEEecccCCcCChHHHHHHHHHhCC
Confidence 468999999999999998632111 14799999999999999999999987543
No 20
>TIGR01767 MTRK 5-methylthioribose kinase. This enzyme is involved in the methionine salvage pathway in certain bacteria.
Probab=98.99 E-value=4e-10 Score=91.81 Aligned_cols=52 Identities=31% Similarity=0.422 Sum_probs=46.0
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS 81 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~ 81 (107)
.....++|+||++||||+.+ .++.+||||+|.+++++||||+.+.+....|-
T Consensus 189 ~~~~~llHGDl~~gNi~~~~-----------------------~~~~~iD~e~~~~G~~~~Dlg~~ianL~l~~~ 240 (370)
T TIGR01767 189 ASAETLLHGDLHSGSIFVSE-----------------------HETKVIDPEFAFYGPIGFDIGQFIANLFLNAL 240 (370)
T ss_pred cCcceeeeccCCcccEEEcC-----------------------CCCEEEcCcccccCchHhhHHHHHHHHHHHHh
Confidence 34568999999999999977 55889999999999999999999999887654
No 21
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.; InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=98.97 E-value=2.8e-10 Score=81.34 Aligned_cols=49 Identities=33% Similarity=0.478 Sum_probs=36.6
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
..+.++||+|++++|||+.++ + +.+.|||||.++++++.+|+|..+.-+
T Consensus 163 ~~~~~~~HgD~~~~Nil~~~~--~-------------------~~i~iID~e~a~~~~~~~Dla~~~~~~ 211 (239)
T PF01636_consen 163 PLPPVLIHGDLHPGNILVDPS--D-------------------GRIGIIDFEDAGWGDPAYDLARLLRHF 211 (239)
T ss_dssp CSCEEEE-SS-SGGGEEEESS--T-------------------TEEEE--GTT-EEEETHHHHHHHHHHH
T ss_pred CCCcEEEEeccccccceeeec--c-------------------ceeEEEecccceECCHHHHHHHHHHHh
Confidence 478999999999999999932 0 455699999999999999999988433
No 22
>PRK05231 homoserine kinase; Provisional
Probab=98.96 E-value=6.5e-10 Score=85.75 Aligned_cols=51 Identities=22% Similarity=0.322 Sum_probs=44.1
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhcc
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDY 80 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy 80 (107)
.|..+||+|++++|||+.++ +-..||||++|+++++.||||..+.-|+++.
T Consensus 185 lp~~liHgD~~~~Nil~~~~----------------------~~~~iIDf~~~~~~~~~~DlA~~~~~~~~~~ 235 (319)
T PRK05231 185 LPRGVIHADLFRDNVLFEGD----------------------RLSGFIDFYFACNDKLLYDVAITLNDWCFEA 235 (319)
T ss_pred CCcccCCCCCCCCcEEEECC----------------------ceEEEEecccccCCchHHHHHHHHHHHHccC
Confidence 57789999999999999862 3347999999999999999999998888653
No 23
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=98.95 E-value=4.2e-10 Score=83.85 Aligned_cols=72 Identities=24% Similarity=0.275 Sum_probs=49.5
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCe-EEEeeecCCCCchhhhHHHHHHHhhhccCCCCCC
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDL-VVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFP 86 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p 86 (107)
.+.+|||+|++++|||+.+ +++ .|||||+|+++++++|||...+.+. -...+.
T Consensus 162 ~~~~l~HGD~~~~Nvlv~~-----------------------~~i~giIDw~~a~~gDp~~Dla~~~~~~~--~~~~~~- 215 (235)
T cd05155 162 GPPVWFHGDLAPGNLLVQD-----------------------GRLSAVIDFGCLGVGDPACDLAIAWTLLD--EDSRAA- 215 (235)
T ss_pred CCceEEeCCCCCCcEEEEC-----------------------CCEEEEEeCcccCcCChHHHHHHHHhcCC--HHHHHH-
Confidence 5789999999999999986 455 5999999999999999997655332 110110
Q ss_pred ceeecCCCCCCHHHHhhccc
Q psy15665 87 HYTVKRENYPSYSLRNSSWV 106 (107)
Q Consensus 87 ~~~~~~~~~Pt~~~~~~~~~ 106 (107)
++..| ..+|-.-+|-.+|+
T Consensus 216 ~~~~y-~~~~~~~~~~~~~~ 234 (235)
T cd05155 216 FRAAL-GVDDATWARGRGWA 234 (235)
T ss_pred HHHHc-CCCHHHHHHhcccc
Confidence 12222 24554566666665
No 24
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=98.95 E-value=6.6e-10 Score=84.70 Aligned_cols=75 Identities=23% Similarity=0.382 Sum_probs=53.7
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh-h--ccCCC
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV-Y--DYSYK 83 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~-~--dy~~~ 83 (107)
..+.++||+|++++|||+.+ +.+.|||||.|+++++.+|||..+..++ - +++..
T Consensus 184 ~~~~~liHgD~~~~Nil~~~-----------------------~~i~lIDfd~~~~~~~~~Dla~~l~~~~~~~~~~d~~ 240 (313)
T TIGR02906 184 KKIRGFCHQDYAYHNILLKD-----------------------NEVYVIDFDYCTIDLPVRDLRKLIIKLMKKNGVWDLE 240 (313)
T ss_pred cCcCceEcCCCCcccEEEeC-----------------------CcEEEEECcccccCCcHHHHHHHHHHHHHhccCCCHH
Confidence 45688999999999999986 5589999999999999999999988776 1 12211
Q ss_pred C-CCceeecCCCCC-CHHHHhhc
Q psy15665 84 H-FPHYTVKRENYP-SYSLRNSS 104 (107)
Q Consensus 84 ~-~p~~~~~~~~~P-t~~~~~~~ 104 (107)
. ...+.-|.+..| |++++..+
T Consensus 241 ~~~~~l~gY~~~~~L~~~e~~~l 263 (313)
T TIGR02906 241 KAKEIIEAYSSINPLSKEEKEVL 263 (313)
T ss_pred HHHHHHHHhhccCCCCHHHHHHH
Confidence 1 113444555444 55555444
No 25
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=98.94 E-value=8.5e-10 Score=85.26 Aligned_cols=50 Identities=28% Similarity=0.385 Sum_probs=43.1
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhh
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVY 78 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~ 78 (107)
..|.++||+|++++|||+.++ +.+.|||||+|+++++.+|||..+..|+.
T Consensus 184 ~~~~~l~HgD~~~~Nvl~~~~----------------------~~~~vIDfd~~~~~~~~~DLA~~~~~~~~ 233 (307)
T TIGR00938 184 DLPRGVIHADLFPDNVLFDGD----------------------SVKGVIDFYFACTDARAYDLAITVNAWCF 233 (307)
T ss_pred cCCCccCCCCCCcCcEEEECC----------------------ceEEEeecccccCcchHHHHHHHHHHHHc
Confidence 346899999999999999873 33579999999999999999998777774
No 26
>PRK12396 5-methylribose kinase; Reviewed
Probab=98.90 E-value=9.2e-10 Score=90.69 Aligned_cols=52 Identities=23% Similarity=0.447 Sum_probs=46.7
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCC
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY 82 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~ 82 (107)
...+++|+||++||||+.+ ++++|||.|+|-|+|.|||||+.+....+.|-.
T Consensus 225 ~~~aLlHGDlHtGSI~v~~-----------------------~~~kvIDpEFAfyGP~gFDiG~~lanll~ay~~ 276 (409)
T PRK12396 225 NAQALIHGDLHTGSVFVKN-----------------------DSTKVIDPEFAFYGPMGYDIGNVMANLMFAWVN 276 (409)
T ss_pred cchhhccCcCCCCCEEecC-----------------------CceEEEcccccccCCcHHHHHHHHHHHHHHHhc
Confidence 4568999999999999998 679999999999999999999999988877643
No 27
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves
Probab=98.78 E-value=1.1e-08 Score=67.58 Aligned_cols=46 Identities=39% Similarity=0.715 Sum_probs=41.6
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
.+++|+|++++|||+.+. +.+.+|||+.|.+.++++|++..++-|.
T Consensus 108 ~~i~H~Dl~~~Nil~~~~----------------------~~~~l~Df~~~~~~~~~~d~~~~~~~~~ 153 (155)
T cd05120 108 LVLCHGDLHPGNILVDDG----------------------KILGIIDWEYAGYGPPAFDLAAALLFNL 153 (155)
T ss_pred eEEEecCCCcceEEEECC----------------------cEEEEEecccccCCChHHHHHHHHHHhc
Confidence 579999999999999873 6799999999999999999999987663
No 28
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=98.76 E-value=6.3e-09 Score=80.74 Aligned_cols=50 Identities=26% Similarity=0.323 Sum_probs=44.3
Q ss_pred CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
...+.++||+|+.++|+|+.++ +.+.+||||+|+++++.+|||+++...+
T Consensus 192 ~~~~~~lcHgD~~~~Nvl~~~~----------------------~~~~iIDfd~~~~d~~~~DLa~~~~~~~ 241 (309)
T TIGR02904 192 ESWRTVLVHGKLSLSHFLYDET----------------------RGGYFINFEKASFASPLTDLAAFFRRSF 241 (309)
T ss_pred hhcceeeeCCCCcHHhEEEcCC----------------------CCEEEEEhhhcccCCcHHHHHHHHHHHH
Confidence 4468899999999999999774 6789999999999999999998877755
No 29
>PF02958 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans.
Probab=98.72 E-value=1.3e-08 Score=77.79 Aligned_cols=55 Identities=31% Similarity=0.560 Sum_probs=44.9
Q ss_pred CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
...+.|+||+|++.+|||+..+..+. ...+++|||..++++.++.||+.++.-..
T Consensus 211 ~~~~~vl~HGD~w~nNilf~~~~~g~-----------------~~~~~liDfQ~~~~g~p~~Dl~~fl~~s~ 265 (294)
T PF02958_consen 211 KEPFNVLCHGDFWTNNILFKYDDDGK-----------------PIDVVLIDFQLARYGSPAIDLAYFLYTSL 265 (294)
T ss_pred cCCceEEEcCccCHHhEeEccccccc-----------------cccceeeccccccCCCcHhHHHHHHHHCC
Confidence 44568999999999999998752221 15799999999999999999999886543
No 30
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported
Probab=98.61 E-value=5.4e-08 Score=75.45 Aligned_cols=46 Identities=26% Similarity=0.329 Sum_probs=38.1
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHH
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHF 73 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf 73 (107)
..+.++||+|++++|||+.++ + +-.-|||||.|+.+.+++|||-.+
T Consensus 182 ~~~~~lvHGD~~~~Nilv~~~--~-------------------~~~gviDWe~a~iGDPa~Dla~~~ 227 (276)
T cd05152 182 PRHTVLVHGDLHPGHILIDED--A-------------------RVTGLIDWTEAKVGDPARDFVLHY 227 (276)
T ss_pred CCCCeeEeCCCCCCcEEEeCC--C-------------------CEEEEECcHhcccCCHHHHHHHHH
Confidence 456799999999999999863 0 224599999999999999999653
No 31
>PRK11768 serine/threonine protein kinase; Provisional
Probab=98.55 E-value=5.4e-08 Score=76.65 Aligned_cols=44 Identities=20% Similarity=0.269 Sum_probs=38.2
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHH
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFV 74 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~ 74 (107)
..+.++||+|+++||||+.+ .+.||||+.|+++++.+||+..+.
T Consensus 193 ~~~~~liHgD~h~~NvL~~d------------------------~~~iIDFDd~~~g~~i~DLa~~l~ 236 (325)
T PRK11768 193 DVRLLRLHGDCHPGNILWRD------------------------GPHFVDLDDARMGPAVQDLWMLLS 236 (325)
T ss_pred CCCccceecCCCchhccccC------------------------CcEEEeCCCCCCCCHHHHHHHHhc
Confidence 35788999999999999942 367999999999999999998764
No 32
>PLN02756 S-methyl-5-thioribose kinase
Probab=98.54 E-value=5.8e-08 Score=80.29 Aligned_cols=51 Identities=25% Similarity=0.410 Sum_probs=44.6
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS 81 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~ 81 (107)
....++|+||++||||+.+ ++..+||.|+|-|+|++||||..+......|-
T Consensus 228 ~~~~L~HGDl~~g~i~~~~-----------------------~~~~~id~ef~~~g~~~~d~g~~~~~~~~~~~ 278 (418)
T PLN02756 228 RAQALVHGDLHTGSVMVTP-----------------------DSTQVIDPEFAFYGPMGFDIGAFLGNLILAYF 278 (418)
T ss_pred cccceeecCCCCCcEEEcC-----------------------CCceEecchhhccCchHHhHHHHHhhhHHHHh
Confidence 4578999999999999998 55899999999999999999998877775553
No 33
>PLN02876 acyl-CoA dehydrogenase
Probab=98.32 E-value=1.2e-06 Score=76.70 Aligned_cols=76 Identities=14% Similarity=0.281 Sum_probs=53.2
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCC---
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF--- 85 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~--- 85 (107)
+.++||+|++++|||+.++ + .+-.-|||||+|..+.+.+|||..+.-|+.+......
T Consensus 224 ~~~LvHGD~~~~Nvl~~~~--~------------------~~v~aVLDWE~a~~GdPl~DLa~~~~~~~~~~~~~~~~~~ 283 (822)
T PLN02876 224 GTGIVHGDFRIDNLVFHPT--E------------------DRVIGILDWELSTLGNQMCDVAYSCLPYIVDINLDNQQVG 283 (822)
T ss_pred CcceEecCcccccEEEcCC--C------------------CeEEEEEeeeccccCChHHHHHHHhhhccccccCCccccc
Confidence 5789999999999999863 0 0235799999999999999999888877755322111
Q ss_pred Cceeec--CCCCCCHHHHhhc
Q psy15665 86 PHYTVK--RENYPSYSLRNSS 104 (107)
Q Consensus 86 p~~~~~--~~~~Pt~~~~~~~ 104 (107)
..+... ..-+||.++-...
T Consensus 284 ~~~~~~~~~~G~p~~~e~~~~ 304 (822)
T PLN02876 284 KGFEFTGIPEGIPSLPEYLAE 304 (822)
T ss_pred cccccCcCCCCCCCHHHHHHH
Confidence 111111 2467888876543
No 34
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=98.27 E-value=9.7e-07 Score=70.88 Aligned_cols=43 Identities=26% Similarity=0.455 Sum_probs=39.5
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCC-CeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNI-DLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
.||+|+.++||+++++ . -..+|||+.|++++..+|||..+.-|
T Consensus 199 iIH~D~~~~NVl~d~~----------------------~~~~g~iDFdDa~~~~~i~DlAi~l~~~ 242 (331)
T COG2334 199 IIHGDLHPDNVLFDDD----------------------TDVSGFIDFDDAGYGWFIYDLAIALNAW 242 (331)
T ss_pred eeecCCCccceeEcCC----------------------CCeeeEEEccccccchHHHHHHHHHHHh
Confidence 8999999999999984 3 27899999999999999999999887
No 35
>PRK10593 hypothetical protein; Provisional
Probab=98.23 E-value=6.8e-07 Score=69.81 Aligned_cols=63 Identities=8% Similarity=0.113 Sum_probs=46.0
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCC
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFP 86 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p 86 (107)
..+.++||+|+++||||+.... . .-..+||+.-+.|++|.+|||..+. ..++
T Consensus 190 ~~~psLlHGDlw~gNvl~~~~~-~-------------------~i~~liDPa~~~~g~rE~DLa~~~~--------~~f~ 241 (297)
T PRK10593 190 NDNCVLVHGNFTLRSMLKDPRS-D-------------------QLLAMLNPGLMLWAPREYELFRLMD--------NGLA 241 (297)
T ss_pred CCCCeeEeCCCCcccEEECCCC-C-------------------ceEEEECchHhCCCCHHHhHHHhhc--------CCcc
Confidence 4457999999999999997520 0 2278999988999999999986641 1122
Q ss_pred --ceeecCCCCCC
Q psy15665 87 --HYTVKRENYPS 97 (107)
Q Consensus 87 --~~~~~~~~~Pt 97 (107)
++.-|.+.+|.
T Consensus 242 ~~f~~~Y~~~~pl 254 (297)
T PRK10593 242 EQLLWRYLQKAPV 254 (297)
T ss_pred HHHHHHHHHhCCC
Confidence 56667777773
No 36
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]
Probab=98.21 E-value=2e-06 Score=69.00 Aligned_cols=48 Identities=21% Similarity=0.264 Sum_probs=43.5
Q ss_pred CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
...+.++.|+|+..||||+.++ +.+-|||||-++.+.+..||+.++ |.
T Consensus 194 ~~~~~~lvHGD~~~gNlii~~~----------------------~~~gVlDwe~~~lGDP~~Dl~~~~--W~ 241 (321)
T COG3173 194 WAGPPVLVHGDYRPGNLIIDPG----------------------RPTGVLDWELATLGDPLEDLAIIC--WT 241 (321)
T ss_pred cCCCceeeeCCcccCCEEEeCC----------------------CeeEEEeccccccCCcHHHHHHHH--hc
Confidence 4567999999999999999996 669999999999999999999987 65
No 37
>COG4857 Predicted kinase [General function prediction only]
Probab=98.14 E-value=1.4e-06 Score=70.44 Aligned_cols=45 Identities=36% Similarity=0.455 Sum_probs=40.5
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
..+||+||+.|-|++++ ....+||-|+|-|+|-+||||+.+...-
T Consensus 228 etLiHGDLHsGSIfvte-----------------------~etkvIDPEFaFYGPmafDiG~~iaNl~ 272 (408)
T COG4857 228 ETLIHGDLHSGSIFVTE-----------------------KETKVIDPEFAFYGPMAFDIGMLIANLW 272 (408)
T ss_pred HHHhccccccCcEEeec-----------------------CcceeeCccccccCcchhhHHHHHHHHH
Confidence 46899999999999998 6789999999999999999999886643
No 38
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=97.84 E-value=1.7e-05 Score=56.68 Aligned_cols=40 Identities=33% Similarity=0.430 Sum_probs=34.5
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH 72 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh 72 (107)
..++|+|++++|||+.. +.+.+|||+.|....+..|++.-
T Consensus 109 ~gi~H~Dl~~~Nil~~~-----------------------~~~~liDfg~a~~~~~~~~~~~~ 148 (199)
T TIGR03724 109 AGIVHGDLTTSNIIVRD-----------------------DKLYLIDFGLGKYSDEIEDKAVD 148 (199)
T ss_pred CCeecCCCCcceEEEEC-----------------------CcEEEEECCCCcCCCcHHhhhch
Confidence 35799999999999983 67999999999999888887643
No 39
>PRK06148 hypothetical protein; Provisional
Probab=97.77 E-value=3e-05 Score=69.84 Aligned_cols=52 Identities=23% Similarity=0.265 Sum_probs=41.9
Q ss_pred CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeE-EEeeecCCCCchhhhHHHHHHHhhh
Q psy15665 7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLV-VIDFEYCSYNYRAFDIANHFVESVY 78 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-lIDfEYa~~n~r~fDlanhf~E~~~ 78 (107)
..|..+||||++..|||+..+.. +++. ||||+.|++.++.+|||-.+.-++.
T Consensus 200 ~Lp~~vIHgDln~~NiLv~~~~~--------------------~~isGiIDFgDa~~~~~v~DLAialay~~~ 252 (1013)
T PRK06148 200 ALPAQVIHNDANDYNILVDADDG--------------------ERISGLIDFGDAVHAPRICEVAIAAAYAIL 252 (1013)
T ss_pred cCCcceECCCCCcccEEEcCCCC--------------------cceEEEEECcccccccHHHHHHHHHHHHhc
Confidence 34667999999999999987410 1455 9999999999999999998765554
No 40
>PRK14879 serine/threonine protein kinase; Provisional
Probab=97.68 E-value=3.7e-05 Score=55.34 Aligned_cols=39 Identities=23% Similarity=0.333 Sum_probs=33.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH 72 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh 72 (107)
.++|+|++++|||+.. +.+.||||+.|....+..|.+.-
T Consensus 115 ~i~H~Dl~p~Nil~~~-----------------------~~~~liDf~~a~~~~~~~~~~~~ 153 (211)
T PRK14879 115 GIIHGDLTTSNMILSG-----------------------GKIYLIDFGLAEFSKDLEDRAVD 153 (211)
T ss_pred CcccCCCCcccEEEEC-----------------------CCEEEEECCcccCCCcHHhhhcc
Confidence 4789999999999984 67999999999998888877643
No 41
>PF07914 DUF1679: Protein of unknown function (DUF1679); InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in zinc finger-C4 and HLH domain-containing kinases. In fact, one member of this family (Q9GUC1 from SWISSPROT) is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (IPR000536 from INTERPRO, IPR008946 from INTERPRO, and IPR001628 from INTERPRO).
Probab=97.59 E-value=1.1e-05 Score=66.41 Aligned_cols=54 Identities=22% Similarity=0.302 Sum_probs=43.1
Q ss_pred cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665 5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE 75 (107)
Q Consensus 5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E 75 (107)
..+.+.|+||+||+..|||...+.+++. .=.-||||.-+..+.++.||+-.|+-
T Consensus 263 ~lG~~~VL~HGDLw~~NiLw~k~~~g~~-----------------~l~AIIDwQ~vh~G~~~eDl~Rll~~ 316 (414)
T PF07914_consen 263 QLGIKPVLVHGDLWSSNILWDKDSDGKL-----------------KLKAIIDWQCVHRGSPAEDLARLLVS 316 (414)
T ss_pred hcCCCcceecCCccHHheeeecCCchhH-----------------HHHHHHHHHHhhcCchHHHHHHHHHh
Confidence 4566899999999999999988532211 23469999999999999999988753
No 42
>COG3178 Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only]
Probab=97.56 E-value=7.5e-05 Score=60.47 Aligned_cols=52 Identities=19% Similarity=0.385 Sum_probs=44.3
Q ss_pred CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665 6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE 75 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E 75 (107)
...|.||||+|.++.|||...+-.+. +++-+|||.-|-++|.+||++..+-.
T Consensus 196 ~~~~~vlvhRDfh~~NLmw~~~~~g~------------------~rvGvlDFQDA~iGP~aYDvasL~~D 247 (351)
T COG3178 196 LAQPKVLVHRDFHSRNLMWTADRAGA------------------DRVGVLDFQDALIGPIAYDVASLLRD 247 (351)
T ss_pred hcCCceeeeccccCccceecCCccCC------------------CCCceeehhhhhcCcchhhHHHHHhh
Confidence 46789999999999999998853322 57999999999999999999987743
No 43
>PRK06149 hypothetical protein; Provisional
Probab=97.41 E-value=0.00015 Score=64.96 Aligned_cols=54 Identities=20% Similarity=0.225 Sum_probs=43.0
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhh
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVY 78 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~ 78 (107)
.|.-++|||++..|||+..+..+. ..-.-||||..++++++.+|||-.+..|+.
T Consensus 206 L~~g~IH~Dl~~~Nilv~~~~~~~-----------------~~v~giIDFgD~~~~~~i~DLAial~~~~~ 259 (972)
T PRK06149 206 LPLQAVHLDITDDNVVGSRDADGR-----------------WQPDGVIDFGDLVRTWRVADLAVTCASLLH 259 (972)
T ss_pred CcccccCCCCCcccEEEcCCCCCC-----------------cceeEEEEcccchhhhHHHHHHHHHHHHhc
Confidence 467899999999999998641110 022479999999999999999998887764
No 44
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=97.35 E-value=0.00018 Score=52.09 Aligned_cols=31 Identities=32% Similarity=0.384 Sum_probs=26.8
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
..+.|+|++|+|||+.+ +.++||||..|..-
T Consensus 137 ~givHrDlkP~NIll~~-----------------------~~~~liDFG~a~~~ 167 (190)
T cd05145 137 AGLVHGDLSEYNILYHD-----------------------GKPYIIDVSQAVEL 167 (190)
T ss_pred CCEecCCCChhhEEEEC-----------------------CCEEEEEcccceec
Confidence 46899999999999983 67999999988763
No 45
>TIGR02905 spore_yutH spore coat protein YutH. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria.
Probab=97.25 E-value=0.00022 Score=55.97 Aligned_cols=45 Identities=27% Similarity=0.348 Sum_probs=38.2
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
...+|||+|+..+|+| .+ +.+.+|+||++ +.++..||++++...+
T Consensus 187 ~~~~lCH~d~~~hn~l-~~-----------------------~~~~~i~~d~~-~D~~~~DL~~firk~~ 231 (313)
T TIGR02905 187 DSGTICHERFGETTWL-ER-----------------------GGLIKPPTEWV-YDHPARDLAEWIRERY 231 (313)
T ss_pred ccCccccCccCccccc-cC-----------------------CCeEecccccc-cccchhHHHHHHHHHH
Confidence 4679999999999987 33 67899999954 9999999999988844
No 46
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=97.21 E-value=0.0002 Score=59.74 Aligned_cols=41 Identities=29% Similarity=0.367 Sum_probs=35.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHH
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFV 74 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~ 74 (107)
.++|+|++|+|||+.+ +.++||||+.|.......|++..+.
T Consensus 448 giiHrDlkp~NILl~~-----------------------~~~~liDFGla~~~~~~~d~a~~l~ 488 (535)
T PRK09605 448 GIVHGDLTTSNFIVRD-----------------------DRLYLIDFGLGKYSDLIEDKAVDLH 488 (535)
T ss_pred CCccCCCChHHEEEEC-----------------------CcEEEEeCcccccCCchHhhhhhHH
Confidence 4799999999999943 6799999999999999999887553
No 47
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=97.09 E-value=0.00035 Score=51.59 Aligned_cols=45 Identities=27% Similarity=0.405 Sum_probs=33.8
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc-----hhhhHHHHH
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY-----RAFDIANHF 73 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----r~fDlanhf 73 (107)
..++|+||.++|||+..+.. ...+.+||||-+.... +.-||+-..
T Consensus 137 ~gi~H~Dl~~~NILv~~~~~-------------------~~~~~lIDld~~~~~~~~~~~~~~dL~~L~ 186 (206)
T PF06293_consen 137 AGIYHGDLNPSNILVDPDDG-------------------QYRFYLIDLDRMRFRPSSRRWRAKDLARLL 186 (206)
T ss_pred CcCCCCCCCcccEEEeCCCC-------------------ceeEEEEcchhceeCCCChHHHHHhHHHHH
Confidence 35899999999999998521 1479999999888766 355655443
No 48
>PF04655 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic resistance kinase; InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties []. Aminoglycoside phosphotransferases achieve inactivation of these enzymes by phosphorylation, utilising ATP. Likewise, hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0006468 protein phosphorylation, 0019748 secondary metabolic process
Probab=97.07 E-value=0.00037 Score=54.15 Aligned_cols=50 Identities=24% Similarity=0.268 Sum_probs=41.1
Q ss_pred cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
....+.|+.|+|||.+|||-... ...+.||-.-.- +.++||+++.|+...
T Consensus 155 ~~~~~~~lLHGDLH~~NIL~~~~----------------------~~WlaIDPkgl~-Gdp~yd~a~~l~n~~ 204 (253)
T PF04655_consen 155 ASPGEEVLLHGDLHHGNILAAGR----------------------RGWLAIDPKGLV-GDPAYDLAPLLRNPL 204 (253)
T ss_pred cCCCcceeeccccchHhhhccCC----------------------CCceEeCCcccc-cccccCHHHHHhCcc
Confidence 34556789999999999997663 678999987544 699999999998775
No 49
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=96.98 E-value=0.00054 Score=50.17 Aligned_cols=28 Identities=36% Similarity=0.549 Sum_probs=24.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-+.|+|++|+|||+.+ +.+.||||--|.
T Consensus 138 giiHrDlkP~NIli~~-----------------------~~v~LiDFG~a~ 165 (190)
T cd05147 138 RLVHADLSEYNLLYHD-----------------------GKLYIIDVSQSV 165 (190)
T ss_pred CcccCCCCHHHEEEEC-----------------------CcEEEEEccccc
Confidence 5899999999999985 669999999876
No 50
>PRK12274 serine/threonine protein kinase; Provisional
Probab=96.98 E-value=0.00044 Score=53.07 Aligned_cols=33 Identities=36% Similarity=0.460 Sum_probs=27.0
Q ss_pred eEEEeccc-CCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665 10 VTFCHNDL-QEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY 64 (107)
Q Consensus 10 ~VfcHnDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 64 (107)
..++|+|| +++|||+..+ +.+.||||.-|....
T Consensus 110 ~GIvHrDL~kp~NILv~~~----------------------g~i~LIDFG~A~~~~ 143 (218)
T PRK12274 110 CGVAHNDLAKEANWLVQED----------------------GSPAVIDFQLAVRGN 143 (218)
T ss_pred CcCccCCCCCcceEEEcCC----------------------CCEEEEECCCceecC
Confidence 35899999 7999999763 679999999887544
No 51
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=96.87 E-value=0.00093 Score=51.48 Aligned_cols=44 Identities=23% Similarity=0.242 Sum_probs=33.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC--chhhhHHHHHHHhhhc
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN--YRAFDIANHFVESVYD 79 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n--~r~fDlanhf~E~~~d 79 (107)
-+.|+|++|||||+++. + +.||||-.+... ..+.|+ ++.|-.|+
T Consensus 155 gi~H~Dikp~Nili~~~----------------------g-i~liDfg~~~~~~e~~a~d~--~vler~y~ 200 (232)
T PRK10359 155 GMVSGDPHKGNFIVSKN----------------------G-LRIIDLSGKRCTAQRKAKDR--IDLERHYG 200 (232)
T ss_pred CCccCCCChHHEEEeCC----------------------C-EEEEECCCcccccchhhHHH--HHHHhHhc
Confidence 57899999999999873 5 999998655443 446676 67777666
No 52
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=96.85 E-value=0.00068 Score=51.44 Aligned_cols=32 Identities=28% Similarity=0.357 Sum_probs=26.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY 64 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 64 (107)
.+.|+||+|+|||+..+ +.+.||||+-+....
T Consensus 162 GI~HrDlkp~NILv~~~----------------------~~v~LIDfg~~~~~~ 193 (239)
T PRK01723 162 GVYHADLNAHNILLDPD----------------------GKFWLIDFDRGELRT 193 (239)
T ss_pred CCCCCCCCchhEEEcCC----------------------CCEEEEECCCcccCC
Confidence 47899999999999874 579999999776653
No 53
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=96.83 E-value=0.00075 Score=48.73 Aligned_cols=30 Identities=30% Similarity=0.389 Sum_probs=25.8
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+|++|+|||+..+ +.+.||||-.|.
T Consensus 144 ~gi~H~Dl~p~Nill~~~----------------------~~~~liDfg~~~ 173 (198)
T cd05144 144 HGIIHGDLSEFNILVDDD----------------------EKIYIIDWPQMV 173 (198)
T ss_pred CCCCcCCCCcccEEEcCC----------------------CcEEEEECCccc
Confidence 358999999999999864 779999999873
No 54
>smart00090 RIO RIO-like kinase.
Probab=96.81 E-value=0.00088 Score=50.84 Aligned_cols=29 Identities=34% Similarity=0.414 Sum_probs=25.4
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
++|+|++|+|||+.. +.+.||||..|..-
T Consensus 170 iiH~Dikp~NIli~~-----------------------~~i~LiDFg~a~~~ 198 (237)
T smart00090 170 LVHGDLSEYNILVHD-----------------------GKVVIIDVSQSVEL 198 (237)
T ss_pred EEeCCCChhhEEEEC-----------------------CCEEEEEChhhhcc
Confidence 899999999999983 67999999988843
No 55
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date. Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=96.70 E-value=0.0011 Score=49.38 Aligned_cols=37 Identities=30% Similarity=0.371 Sum_probs=25.8
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC--CCchhhhH
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS--YNYRAFDI 69 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~--~n~r~fDl 69 (107)
..+.|+||.+.|||+.+ +++++|||+-|- -+|++.++
T Consensus 126 ~givHGDLs~~NIlv~~-----------------------~~~~iIDf~qav~~~~p~a~~~ 164 (188)
T PF01163_consen 126 AGIVHGDLSEYNILVDD-----------------------GKVYIIDFGQAVDSSHPNAEEL 164 (188)
T ss_dssp TTEEESS-STTSEEEET-----------------------TCEEE--GTTEEETTSTTHHHH
T ss_pred cCceecCCChhhEEeec-----------------------ceEEEEecCcceecCCccHHHH
Confidence 45899999999999998 679999998442 25555544
No 56
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=96.69 E-value=0.001 Score=46.86 Aligned_cols=29 Identities=31% Similarity=0.402 Sum_probs=25.0
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+|++|+|||+.+ +.+.+|||.-|.
T Consensus 134 ~~ivH~Dl~p~Nili~~-----------------------~~~~liDfg~a~ 162 (187)
T cd05119 134 AGLVHGDLSEYNILVDD-----------------------GKVYIIDVPQAV 162 (187)
T ss_pred cCcCcCCCChhhEEEEC-----------------------CcEEEEECcccc
Confidence 45789999999999993 679999998775
No 57
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []. Ketosamine-3-kinases (KT3K), of which fructosamine-3-kinase (FN3K) is the best-known example, catalyse the phosphorylation of the ketosamine moiety of glycated proteins. The instability of a phosphorylated ketosamine leads to its degradation, and KT3K is thus thought to be involved in protein repair []. The function of the prokaryotic members of this group has not been established. However, several lines of evidence indicate that they may function as fructosamine-3-kinases (FN3K). First, they are similar to characterised FN3K from mouse and human. Second, the Escherichia coli members are found in close proximity on the genome to fructose-6-phosphate kinase (PfkB). Last, FN3K activity has been found in a Anacystis montana (Gloeocapsa montana Kutzing 1843) [], indicating such activity-directly demonstrated in eukaryotes-is nonetheless not confined to eukaryotes. This family includes eukaryotic fructosamine-3-kinase enzymes [] which may initiate a process leading to the deglycation of fructoselysine and of glycated proteins and in the phosphorylation of 1-deoxy-1-morpholinofructose, fructoselysine, fructoseglycine, fructose and glycated lysozyme. The family also includes bacterial members that have not been characterised but probably have a similar or identical function. For additional information please see [].; PDB: 3JR1_B 3F7W_A.
Probab=96.59 E-value=0.0014 Score=51.68 Aligned_cols=44 Identities=27% Similarity=0.430 Sum_probs=28.2
Q ss_pred CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665 6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH 72 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh 72 (107)
...+-+++|+||+.||++...+ ++.+|||== +-|+.|.+|||..
T Consensus 184 ~~~~PsLlHGDLW~GN~~~~~~----------------------g~p~l~DPa-~yygh~E~DLam~ 227 (288)
T PF03881_consen 184 REPKPSLLHGDLWSGNVGFDAD----------------------GEPVLFDPA-CYYGHREVDLAMT 227 (288)
T ss_dssp S----EEE-SS-SGGGEEEETT----------------------E-EEE-S----EEE-CHHHHHHH
T ss_pred CCCCceeeEcCccccceeecCC----------------------CCceeeccc-cccCchHhhhhhh
Confidence 3445699999999999999984 568999986 7789999999963
No 58
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=96.53 E-value=0.0017 Score=53.57 Aligned_cols=33 Identities=27% Similarity=0.446 Sum_probs=27.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
.++|+|++||||++.++ +.+.+|||-.++.-.+
T Consensus 277 g~~H~D~hPgNilv~~~----------------------g~i~liDfG~~~~l~~ 309 (437)
T TIGR01982 277 GFFHADLHPGNIFVLKD----------------------GKIIALDFGIVGRLSE 309 (437)
T ss_pred CceeCCCCcccEEECCC----------------------CcEEEEeCCCeeECCH
Confidence 47999999999999774 6799999998876543
No 59
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=96.48 E-value=0.0016 Score=48.94 Aligned_cols=28 Identities=29% Similarity=0.443 Sum_probs=24.4
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.-++|+||.+-|||+.+ ++++||||.-|
T Consensus 144 ~glVHGDLs~~NIL~~~-----------------------~~v~iIDF~qa 171 (197)
T cd05146 144 CNLVHADLSEYNMLWHD-----------------------GKVWFIDVSQS 171 (197)
T ss_pred CCeecCCCCHHHEEEEC-----------------------CcEEEEECCCc
Confidence 46899999999999986 67999999854
No 60
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=96.30 E-value=0.0025 Score=43.26 Aligned_cols=34 Identities=24% Similarity=0.290 Sum_probs=28.7
Q ss_pred EEEecccCCCceeeec-CCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchh
Q psy15665 11 TFCHNDLQEGNILYRE-SPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRA 66 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~-~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~ 66 (107)
.++|+|++++||++.. . +.+.+|||+++......
T Consensus 112 ~~~H~dl~~~ni~~~~~~----------------------~~~~l~d~~~~~~~~~~ 146 (215)
T cd00180 112 GIIHRDLKPENILLDSDN----------------------GKVKLADFGLSKLLTSD 146 (215)
T ss_pred CeeccCCCHhhEEEeCCC----------------------CcEEEecCCceEEccCC
Confidence 6899999999999987 3 67999999988765443
No 61
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system [].; GO: 0009244 lipopolysaccharide core region biosynthetic process
Probab=96.28 E-value=0.0029 Score=48.99 Aligned_cols=29 Identities=28% Similarity=0.350 Sum_probs=24.8
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..+-|+|+||||+|+.+ +++.+||+.-.+
T Consensus 154 ~G~~HGD~hpgNFlv~~-----------------------~~i~iID~~~k~ 182 (229)
T PF06176_consen 154 HGFYHGDPHPGNFLVSN-----------------------NGIRIIDTQGKR 182 (229)
T ss_pred cCCccCCCCcCcEEEEC-----------------------CcEEEEECcccc
Confidence 46889999999999997 679999997543
No 62
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain; InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=96.14 E-value=0.0022 Score=46.31 Aligned_cols=29 Identities=31% Similarity=0.485 Sum_probs=25.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+... +.+.||||..+.
T Consensus 118 ~i~H~dikp~NIl~~~~----------------------~~~~l~Dfg~~~ 146 (260)
T PF00069_consen 118 GIVHRDIKPENILLDEN----------------------GEVKLIDFGSSV 146 (260)
T ss_dssp TEEESSBSGGGEEESTT----------------------SEEEESSGTTTE
T ss_pred ccccccccccccccccc----------------------cccccccccccc
Confidence 47999999999999964 678999998875
No 63
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=96.12 E-value=0.0031 Score=48.34 Aligned_cols=30 Identities=30% Similarity=0.473 Sum_probs=25.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||++.|||+..+ +.+.|+||..|..
T Consensus 116 givH~Dlkp~NIll~~~----------------------~~~kL~DfG~~~~ 145 (325)
T cd05604 116 NIVYRDLKPENILLDSQ----------------------GHVVLTDFGLCKE 145 (325)
T ss_pred CeeecCCCHHHeEECCC----------------------CCEEEeecCCccc
Confidence 48999999999999874 6799999987653
No 64
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=96.00 E-value=0.004 Score=48.51 Aligned_cols=29 Identities=28% Similarity=0.575 Sum_probs=25.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..|.
T Consensus 121 givHrDLkp~NIli~~~----------------------~~vkL~DfG~~~ 149 (360)
T cd05627 121 GFIHRDIKPDNLLLDAK----------------------GHVKLSDFGLCT 149 (360)
T ss_pred CeEccCCCHHHEEECCC----------------------CCEEEeeccCCc
Confidence 47899999999999764 779999998775
No 65
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=95.99 E-value=0.0043 Score=52.94 Aligned_cols=37 Identities=27% Similarity=0.482 Sum_probs=28.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
.|.|.|+|||||++..+... .+++++|||=-+|.-.+
T Consensus 280 GffHaDpHPGNIlv~~~g~~------------------~~~i~llDFGivg~l~~ 316 (537)
T PRK04750 280 GFFHADMHPGNIFVSYDPPE------------------NPRYIALDFGIVGSLNK 316 (537)
T ss_pred CeeeCCCChHHeEEecCCCC------------------CCeEEEEecceEEECCH
Confidence 58999999999999874111 14899999987775444
No 66
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=95.95 E-value=0.0062 Score=46.65 Aligned_cols=30 Identities=20% Similarity=0.406 Sum_probs=25.1
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+||++.|||+..+ +.++|+||..|.
T Consensus 115 ~~ivHrDikp~NIll~~~----------------------~~~kL~Dfg~~~ 144 (325)
T cd05594 115 KNVVYRDLKLENLMLDKD----------------------GHIKITDFGLCK 144 (325)
T ss_pred CCEEecCCCCCeEEECCC----------------------CCEEEecCCCCe
Confidence 458999999999999874 678999997654
No 67
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=95.93 E-value=0.0038 Score=47.69 Aligned_cols=29 Identities=31% Similarity=0.508 Sum_probs=24.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 116 ~ivH~Dlkp~NIll~~~----------------------~~~kl~Dfg~~~ 144 (321)
T cd05603 116 NIIYRDLKPENILLDSQ----------------------GHVVLTDFGLCK 144 (321)
T ss_pred CeEeccCCHHHeEECCC----------------------CCEEEccCCCCc
Confidence 47999999999999874 678999998664
No 68
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found
Probab=95.91 E-value=0.0046 Score=48.94 Aligned_cols=29 Identities=28% Similarity=0.495 Sum_probs=24.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..|.
T Consensus 162 ~IvHrDLKp~NILl~~~----------------------~~~kL~DFG~a~ 190 (370)
T cd05621 162 GLIHRDVKPDNMLLDKH----------------------GHLKLADFGTCM 190 (370)
T ss_pred CeEecCCCHHHEEECCC----------------------CCEEEEecccce
Confidence 58999999999999764 679999998664
No 69
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=95.91 E-value=0.0052 Score=44.22 Aligned_cols=29 Identities=31% Similarity=0.477 Sum_probs=23.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|++++||++..+ +.+.++||.++.
T Consensus 123 ~~~h~dl~~~nil~~~~----------------------~~~~l~dfg~~~ 151 (258)
T smart00219 123 NFIHRDLAARNCLVGEN----------------------LVVKISDFGLSR 151 (258)
T ss_pred CeeecccccceEEEccC----------------------CeEEEcccCCce
Confidence 57999999999999874 568888887764
No 70
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=95.90 E-value=0.0046 Score=47.11 Aligned_cols=30 Identities=27% Similarity=0.418 Sum_probs=25.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
-++|+||++.|||+..+ +.+.|+||..|..
T Consensus 113 ~i~HrDlkp~Nili~~~----------------------~~~kl~Dfg~~~~ 142 (312)
T cd05585 113 NVIYRDLKPENILLDYQ----------------------GHIALCDFGLCKL 142 (312)
T ss_pred CeEeCCCCHHHeEECCC----------------------CcEEEEECccccc
Confidence 47999999999999764 6789999987654
No 71
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=95.89 E-value=0.0051 Score=44.99 Aligned_cols=17 Identities=35% Similarity=0.620 Sum_probs=15.2
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++...
T Consensus 123 ~i~H~dl~p~Nil~~~~ 139 (261)
T cd05068 123 NYIHRDLAARNVLVGEN 139 (261)
T ss_pred CeeeccCCcceEEEcCC
Confidence 48999999999999874
No 72
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=95.89 E-value=0.0051 Score=44.88 Aligned_cols=29 Identities=34% Similarity=0.444 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++.++ +.+.++||..+.
T Consensus 122 ~i~H~dlkp~nil~~~~----------------------~~~kl~dfg~~~ 150 (256)
T cd05082 122 NFVHRDLAARNVLVSED----------------------NVAKVSDFGLTK 150 (256)
T ss_pred CEeccccchheEEEcCC----------------------CcEEecCCccce
Confidence 48999999999999874 667888886544
No 73
>KOG0667|consensus
Probab=95.89 E-value=0.0053 Score=53.08 Aligned_cols=34 Identities=29% Similarity=0.503 Sum_probs=27.0
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.+.+.|+||+|.|||+.+.. +..|.||||-=|++
T Consensus 307 ~l~IIHcDLKPENILL~~~~--------------------r~~vKVIDFGSSc~ 340 (586)
T KOG0667|consen 307 ELGIIHCDLKPENILLKDPK--------------------RSRIKVIDFGSSCF 340 (586)
T ss_pred hCCeeeccCChhheeeccCC--------------------cCceeEEecccccc
Confidence 45689999999999998741 15799999976654
No 74
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=95.87 E-value=0.0045 Score=47.47 Aligned_cols=30 Identities=23% Similarity=0.328 Sum_probs=25.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
-++|+||++.|||+... +.+.|+||..+..
T Consensus 116 ~ivHrDlkp~Nili~~~----------------------~~~kl~Dfg~a~~ 145 (330)
T cd05586 116 DIVYRDLKPENILLDAT----------------------GHIALCDFGLSKA 145 (330)
T ss_pred CeEeccCCHHHeEECCC----------------------CCEEEecCCcCcC
Confidence 48999999999999874 6789999987754
No 75
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=95.86 E-value=0.0043 Score=47.49 Aligned_cols=29 Identities=24% Similarity=0.331 Sum_probs=24.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.++|+||..+.
T Consensus 125 ~ivHrDlkp~Nili~~~----------------------~~~kl~DfG~~~ 153 (332)
T cd05614 125 GIVYRDIKLENILLDSE----------------------GHVVLTDFGLSK 153 (332)
T ss_pred CcEecCCCHHHeEECCC----------------------CCEEEeeCcCCc
Confidence 47999999999999874 678899997654
No 76
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=95.86 E-value=0.0054 Score=44.94 Aligned_cols=29 Identities=28% Similarity=0.518 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||+++||++.++ ..+.++||..+.
T Consensus 122 ~i~H~dl~~~Nill~~~----------------------~~~~l~dfg~~~ 150 (260)
T cd05069 122 NYIHRDLRAANILVGDN----------------------LVCKIADFGLAR 150 (260)
T ss_pred CEeecccCcceEEEcCC----------------------CeEEECCCccce
Confidence 48999999999999874 567777877664
No 77
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=95.85 E-value=0.004 Score=46.08 Aligned_cols=28 Identities=29% Similarity=0.426 Sum_probs=22.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+|+++.|||+..+ +.+.|+||..+
T Consensus 128 ~ivH~dikp~Nili~~~----------------------~~~kl~dfg~~ 155 (288)
T cd07863 128 CIVHRDLKPENILVTSG----------------------GQVKLADFGLA 155 (288)
T ss_pred CeecCCCCHHHEEECCC----------------------CCEEECccCcc
Confidence 47899999999999874 56788888655
No 78
>PHA02882 putative serine/threonine kinase; Provisional
Probab=95.85 E-value=0.0056 Score=46.28 Aligned_cols=28 Identities=21% Similarity=0.367 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-+.|+||+|.|||+... ..++|+||-.|
T Consensus 146 ~iiHrDiKp~Nill~~~----------------------~~~~l~DFGla 173 (294)
T PHA02882 146 GISHGDIKPENIMVDGN----------------------NRGYIIDYGIA 173 (294)
T ss_pred CeecCCCCHHHEEEcCC----------------------CcEEEEEcCCc
Confidence 47899999999999764 56788888765
No 79
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=95.81 E-value=0.005 Score=44.88 Aligned_cols=29 Identities=34% Similarity=0.381 Sum_probs=23.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|++++|||+... +.+.|+||..+.
T Consensus 120 ~~~H~dl~p~nili~~~----------------------~~~kl~Dfg~~~ 148 (254)
T cd05083 120 KLVHRDLAARNILVSED----------------------GVAKVSDFGLAR 148 (254)
T ss_pred CeeccccCcceEEEcCC----------------------CcEEECCCccce
Confidence 57999999999999774 567888887554
No 80
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=95.79 E-value=0.0051 Score=47.04 Aligned_cols=29 Identities=21% Similarity=0.442 Sum_probs=24.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..|.
T Consensus 122 ~i~H~Dlkp~NIll~~~----------------------~~~kL~Dfg~a~ 150 (330)
T cd05601 122 GYVHRDIKPENVLIDRT----------------------GHIKLADFGSAA 150 (330)
T ss_pred CeEcccCchHheEECCC----------------------CCEEeccCCCCe
Confidence 47999999999999874 678999998664
No 81
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the
Probab=95.79 E-value=0.0048 Score=47.26 Aligned_cols=31 Identities=29% Similarity=0.551 Sum_probs=26.2
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
..++|+||++.|||+... +.+.|+||..|..
T Consensus 120 ~giiH~Dlkp~NIll~~~----------------------~~~kL~Dfg~~~~ 150 (350)
T cd05573 120 LGFIHRDIKPDNILIDAD----------------------GHIKLADFGLCKK 150 (350)
T ss_pred CCeeccCCCHHHeEECCC----------------------CCEEeecCCCCcc
Confidence 358999999999999874 6799999987753
No 82
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk
Probab=95.77 E-value=0.0057 Score=44.51 Aligned_cols=30 Identities=33% Similarity=0.472 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||++.||++..+ +.+.++||..+..
T Consensus 122 ~i~H~di~p~Nili~~~----------------------~~~~l~d~g~~~~ 151 (256)
T cd05039 122 NFVHRDLAARNVLVSED----------------------LVAKVSDFGLAKE 151 (256)
T ss_pred CccchhcccceEEEeCC----------------------CCEEEcccccccc
Confidence 57999999999999874 5677888875543
No 83
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=95.77 E-value=0.0057 Score=47.17 Aligned_cols=28 Identities=25% Similarity=0.593 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+||++.|||+..+ +.+.|+||..|
T Consensus 122 ~ivH~dlkp~Nill~~~----------------------~~~kl~Dfg~~ 149 (331)
T cd05597 122 GYVHRDIKPDNVLLDKN----------------------GHIRLADFGSC 149 (331)
T ss_pred CeEECCCCHHHEEECCC----------------------CCEEEEECCce
Confidence 37899999999999764 67899999764
No 84
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=95.76 E-value=0.0067 Score=49.76 Aligned_cols=29 Identities=24% Similarity=0.385 Sum_probs=24.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+... +.+.|+||..|.
T Consensus 189 ~ivHrDlkp~NIll~~~----------------------~~~kL~DFgla~ 217 (478)
T PTZ00267 189 KMMHRDLKSANIFLMPT----------------------GIIKLGDFGFSK 217 (478)
T ss_pred CEEECCcCHHhEEECCC----------------------CcEEEEeCcCce
Confidence 47999999999999874 678999998664
No 85
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=95.75 E-value=0.0058 Score=47.77 Aligned_cols=29 Identities=31% Similarity=0.615 Sum_probs=25.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||-.|.
T Consensus 121 ~ivHrDlkp~Nill~~~----------------------~~ikL~DFG~a~ 149 (376)
T cd05598 121 GFIHRDIKPDNILIDRD----------------------GHIKLTDFGLCT 149 (376)
T ss_pred CeEeCCCCHHHEEECCC----------------------CCEEEEeCCCCc
Confidence 47899999999999874 679999998764
No 86
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=95.75 E-value=0.0059 Score=47.68 Aligned_cols=30 Identities=27% Similarity=0.514 Sum_probs=25.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||++.|||+... +.+.|+||..|..
T Consensus 121 givHrDlKp~NILi~~~----------------------~~vkL~DFGla~~ 150 (363)
T cd05628 121 GFIHRDIKPDNLLLDSK----------------------GHVKLSDFGLCTG 150 (363)
T ss_pred CeEecCCCHHHeEECCC----------------------CCEEEeeccCccc
Confidence 57899999999999774 6799999987753
No 87
>KOG0594|consensus
Probab=95.72 E-value=0.007 Score=49.01 Aligned_cols=27 Identities=33% Similarity=0.420 Sum_probs=22.5
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
+.|+||+|.|||++++ +.+.++||--|
T Consensus 141 IlHRDLKPQNlLi~~~----------------------G~lKlaDFGlA 167 (323)
T KOG0594|consen 141 ILHRDLKPQNLLISSS----------------------GVLKLADFGLA 167 (323)
T ss_pred eecccCCcceEEECCC----------------------CcEeeeccchH
Confidence 5799999999999985 77888888544
No 88
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=95.70 E-value=0.0059 Score=45.20 Aligned_cols=17 Identities=29% Similarity=0.563 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+.+.
T Consensus 129 ~iiH~dlkp~Nil~~~~ 145 (279)
T cd05109 129 RLVHRDLAARNVLVKSP 145 (279)
T ss_pred CeeccccccceEEEcCC
Confidence 47899999999999764
No 89
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=95.70 E-value=0.0062 Score=46.67 Aligned_cols=29 Identities=21% Similarity=0.410 Sum_probs=24.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+..+ +.+.|+||..|.
T Consensus 121 ~ivH~dlkp~Nill~~~----------------------~~~kL~Dfg~~~ 149 (324)
T cd05587 121 GIIYRDLKLDNVMLDAE----------------------GHIKIADFGMCK 149 (324)
T ss_pred CeEecCCCHHHeEEcCC----------------------CCEEEeecCcce
Confidence 48999999999999874 668889987653
No 90
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=95.70 E-value=0.0058 Score=46.88 Aligned_cols=29 Identities=28% Similarity=0.429 Sum_probs=24.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+... +.++|+||..+.
T Consensus 120 ~ivH~dlkp~Nil~~~~----------------------~~~kl~Dfg~~~ 148 (323)
T cd05584 120 GIIYRDLKPENILLDAQ----------------------GHVKLTDFGLCK 148 (323)
T ss_pred CeecCCCCHHHeEECCC----------------------CCEEEeeCcCCe
Confidence 47999999999999774 678899987653
No 91
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=95.68 E-value=0.0088 Score=43.31 Aligned_cols=28 Identities=21% Similarity=0.291 Sum_probs=22.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+|+++.||++..+ +.+.++||..+
T Consensus 122 ~i~H~di~p~nil~~~~----------------------~~~~l~df~~~ 149 (257)
T cd08223 122 HILHRDLKTQNVFLTRT----------------------NIIKVGDLGIA 149 (257)
T ss_pred CeeccCCCchhEEEecC----------------------CcEEEecccce
Confidence 47999999999999874 56778887755
No 92
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt
Probab=95.66 E-value=0.0056 Score=46.91 Aligned_cols=29 Identities=31% Similarity=0.532 Sum_probs=24.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 116 giiHrDlkp~Nili~~~----------------------~~~kl~DfG~a~ 144 (325)
T cd05602 116 NIVYRDLKPENILLDSQ----------------------GHIVLTDFGLCK 144 (325)
T ss_pred CeEecCCCHHHeEECCC----------------------CCEEEccCCCCc
Confidence 58999999999999764 678899987654
No 93
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=95.65 E-value=0.0068 Score=46.71 Aligned_cols=29 Identities=24% Similarity=0.387 Sum_probs=24.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..+.
T Consensus 138 ~ivH~dlkp~NIll~~~----------------------~~~kl~Dfg~~~ 166 (329)
T PTZ00263 138 DIIYRDLKPENLLLDNK----------------------GHVKVTDFGFAK 166 (329)
T ss_pred CeeecCCCHHHEEECCC----------------------CCEEEeeccCce
Confidence 47999999999999874 678999998664
No 94
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular
Probab=95.64 E-value=0.0061 Score=44.26 Aligned_cols=17 Identities=35% Similarity=0.407 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+..+
T Consensus 114 ~i~H~dl~p~nil~~~~ 130 (252)
T cd05084 114 HCIHRDLAARNCLVTEK 130 (252)
T ss_pred CccccccchheEEEcCC
Confidence 37899999999999764
No 95
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=95.63 E-value=0.007 Score=46.43 Aligned_cols=29 Identities=21% Similarity=0.433 Sum_probs=24.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 115 ~ivHrDlkp~NIll~~~----------------------~~~kl~DfG~a~ 143 (323)
T cd05571 115 DVVYRDLKLENLMLDKD----------------------GHIKITDFGLCK 143 (323)
T ss_pred CeEeCCCCHHHEEECCC----------------------CCEEEeeCCCCc
Confidence 48999999999999774 678899997654
No 96
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=95.63 E-value=0.0055 Score=46.36 Aligned_cols=17 Identities=35% Similarity=0.536 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 124 ~ivH~dlkp~Nill~~~ 140 (309)
T cd07872 124 KVLHRDLKPQNLLINER 140 (309)
T ss_pred CeecCCCCHHHEEECCC
Confidence 47999999999999874
No 97
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=95.63 E-value=0.0051 Score=46.40 Aligned_cols=17 Identities=29% Similarity=0.520 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 123 ~ivH~dlkp~Nill~~~ 139 (303)
T cd07869 123 YILHRDLKPQNLLISDT 139 (303)
T ss_pred CeecCCCCHHHEEECCC
Confidence 47999999999999764
No 98
>COG3570 StrB Streptomycin 6-kinase [Defense mechanisms]
Probab=95.63 E-value=0.0057 Score=47.93 Aligned_cols=51 Identities=33% Similarity=0.420 Sum_probs=39.8
Q ss_pred ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665 4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV 77 (107)
Q Consensus 4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~ 77 (107)
-.....++.-|+||+-||||-.+. ..-++||=-=. .+.||||.||.||.-.
T Consensus 155 L~~p~di~pLHGDlHH~Nild~~~----------------------rGWlvIDPkgl-~Gdrg~D~ANlf~Np~ 205 (274)
T COG3570 155 LDTPRDIRPLHGDLHHGNILDGDR----------------------RGWLVIDPKGL-IGDRGFDYANLFCNPL 205 (274)
T ss_pred hcCccccccCcccccccccccCCc----------------------CceEEEccccc-cCccccchHhhhcCCc
Confidence 345566888999999999996553 57889997533 3689999999999754
No 99
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=95.62 E-value=0.0067 Score=46.45 Aligned_cols=29 Identities=31% Similarity=0.508 Sum_probs=24.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..+.
T Consensus 116 givH~dikp~NIll~~~----------------------~~~kl~Dfg~~~ 144 (323)
T cd05575 116 NIIYRDLKPENILLDSQ----------------------GHVVLTDFGLCK 144 (323)
T ss_pred CeEeCCCCHHHeEECCC----------------------CcEEEeccCCCc
Confidence 47899999999999774 678899997664
No 100
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=95.60 E-value=0.0068 Score=43.66 Aligned_cols=32 Identities=25% Similarity=0.333 Sum_probs=25.6
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
...++|+|+++.||++.++ +.+.++||..+..
T Consensus 128 ~~~i~h~dl~p~nili~~~----------------------~~~kl~d~g~~~~ 159 (265)
T cd08217 128 GNTVLHRDLKPANIFLDAN----------------------NNVKLGDFGLAKI 159 (265)
T ss_pred cCcceecCCCHHHEEEecC----------------------CCEEEeccccccc
Confidence 4568999999999999874 6678888876553
No 101
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=95.60 E-value=0.013 Score=44.75 Aligned_cols=38 Identities=26% Similarity=0.351 Sum_probs=30.8
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHH
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIA 70 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDla 70 (107)
-.++|+||...||++.. +++.+|||-.+-++--.=|.|
T Consensus 111 ~givHGDLTtsNiIl~~-----------------------~~i~~IDfGLg~~s~~~Ed~a 148 (204)
T COG3642 111 AGIVHGDLTTSNIILSG-----------------------GRIYFIDFGLGEFSDEVEDKA 148 (204)
T ss_pred cCeecCCCccceEEEeC-----------------------CcEEEEECCcccccccHHhhh
Confidence 45899999999999998 669999998888776544443
No 102
>PRK09188 serine/threonine protein kinase; Provisional
Probab=95.60 E-value=0.0091 Score=48.60 Aligned_cols=38 Identities=32% Similarity=0.322 Sum_probs=29.4
Q ss_pred EEEeccc-CCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHH
Q psy15665 11 TFCHNDL-QEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIA 70 (107)
Q Consensus 11 VfcHnDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDla 70 (107)
.++|+|| +|+|||+..+ +.+.||||.-|..-.+.-.++
T Consensus 131 gIiHrDL~KP~NILv~~~----------------------~~ikLiDFGlA~~~~~~~~~~ 169 (365)
T PRK09188 131 GITHNDLAKPQNWLMGPD----------------------GEAAVIDFQLASVFRRRGALY 169 (365)
T ss_pred CCeeCCCCCcceEEEcCC----------------------CCEEEEECccceecccCcchh
Confidence 5799999 8999999653 679999999888655543333
No 103
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=95.60 E-value=0.0078 Score=45.45 Aligned_cols=30 Identities=30% Similarity=0.427 Sum_probs=25.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
-++|+||++.||++..+ +.++|+||+.+..
T Consensus 123 ~i~H~dlkp~Nili~~~----------------------~~~~l~dfg~~~~ 152 (316)
T cd05574 123 GIVYRDLKPENILLHES----------------------GHIMLSDFDLSKQ 152 (316)
T ss_pred CeeccCCChHHeEEcCC----------------------CCEEEeecchhhc
Confidence 47999999999999874 6799999998764
No 104
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=95.59 E-value=0.0076 Score=46.47 Aligned_cols=29 Identities=24% Similarity=0.566 Sum_probs=23.9
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.-++|+||++.|||+... +.+.|+||..|
T Consensus 121 ~~iiHrDlkp~Nill~~~----------------------~~~kl~DfG~a 149 (331)
T cd05624 121 LHYVHRDIKPDNVLLDMN----------------------GHIRLADFGSC 149 (331)
T ss_pred CCeeeccCchHHEEEcCC----------------------CCEEEEeccce
Confidence 347899999999999764 67899999654
No 105
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=95.58 E-value=0.0064 Score=46.57 Aligned_cols=29 Identities=21% Similarity=0.413 Sum_probs=24.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 121 ~ivHrDlkp~Nill~~~----------------------~~~kL~DfG~~~ 149 (323)
T cd05616 121 GIIYRDLKLDNVMLDSE----------------------GHIKIADFGMCK 149 (323)
T ss_pred CEEecCCCHHHeEECCC----------------------CcEEEccCCCce
Confidence 48999999999999874 678888887653
No 106
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=95.57 E-value=0.0078 Score=51.26 Aligned_cols=34 Identities=32% Similarity=0.411 Sum_probs=28.4
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
-.|-|.|+|||||++..+ +.++++||--.|.=..
T Consensus 284 dgffHaDpHpGNi~v~~~----------------------g~i~~lDfGi~g~l~~ 317 (517)
T COG0661 284 DGFFHADPHPGNILVRSD----------------------GRIVLLDFGIVGRLDP 317 (517)
T ss_pred cCccccCCCccceEEecC----------------------CcEEEEcCcceecCCH
Confidence 358899999999999985 7899999987775444
No 107
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=95.57 E-value=0.0086 Score=43.95 Aligned_cols=17 Identities=41% Similarity=0.575 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+.+.
T Consensus 124 ~i~H~dlkp~nil~~~~ 140 (263)
T cd05052 124 NFIHRDLAARNCLVGEN 140 (263)
T ss_pred CEeecccCcceEEEcCC
Confidence 47999999999999764
No 108
>TIGR02457 TreS_Cterm trehalose synthase-fused probable maltokinase. Three pathways for the biosynthesis of trehalose, an osmoprotectant that in some species is also a precursor of certain cell wall glycolipids. Trehalose synthase, TreS, can interconvert maltose and trehalose, but while the equilibrium may favor trehalose, physiological concentrations of trehalose may be much greater than that of maltose and TreS may act largely in its degradation. This model describes a domain found only as a C-terminal fusion to TreS proteins. The most closely related proteins outside this family, Pep2 of Streptomyces coelicolor and Mak1 of Actinoplanes missouriensis, have known maltokinase activity. We suggest this domain acts as a maltokinase and helps drive conversion of trehalose to maltose.
Probab=95.57 E-value=0.008 Score=51.33 Aligned_cols=45 Identities=27% Similarity=0.230 Sum_probs=30.9
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC---------CchhhhHHHHHHHh
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY---------NYRAFDIANHFVES 76 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~---------n~r~fDlanhf~E~ 76 (107)
..+=||+|+|.||+|+.. +..+|||||==-. ..+.=|+|--+..+
T Consensus 378 ~k~RiHGD~HLgqvL~t~-----------------------~d~~IiDFEGEP~Rpl~ERR~k~sPLRDVAGMLRSf 431 (528)
T TIGR02457 378 LKIRIHGDFHLGQVLVVQ-----------------------DDAVLIDFEGEPARPLAERRAKRSPLRDVAGMLRSF 431 (528)
T ss_pred ceEeEecCcchhcEEEeC-----------------------CCeEEEcCCCCCCCChHHhccCCChHHHHHHHHHHH
Confidence 345599999999999987 5678999984221 22345666555544
No 109
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=95.57 E-value=0.0069 Score=46.75 Aligned_cols=29 Identities=21% Similarity=0.445 Sum_probs=24.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.++|+||..|.
T Consensus 115 ~ivHrDikp~NIll~~~----------------------~~~kL~DfG~~~ 143 (328)
T cd05593 115 KIVYRDLKLENLMLDKD----------------------GHIKITDFGLCK 143 (328)
T ss_pred CeEecccCHHHeEECCC----------------------CcEEEecCcCCc
Confidence 47999999999999874 678888887654
No 110
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=95.55 E-value=0.0081 Score=45.65 Aligned_cols=29 Identities=24% Similarity=0.472 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+..+ +.+.|+||..+.
T Consensus 129 ~iiH~dlkp~Nill~~~----------------------~~~kl~DfG~a~ 157 (316)
T cd05108 129 RLVHRDLAARNVLVKTP----------------------QHVKITDFGLAK 157 (316)
T ss_pred CeeccccchhheEecCC----------------------CcEEEccccccc
Confidence 37999999999999774 557777776654
No 111
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis.
Probab=95.55 E-value=0.0061 Score=46.78 Aligned_cols=29 Identities=28% Similarity=0.431 Sum_probs=24.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+..+ +.+.|+||..|.
T Consensus 121 ~ivH~dlkp~Nil~~~~----------------------~~~kL~Dfg~a~ 149 (333)
T cd05600 121 GYIHRDLKPENFLIDAS----------------------GHIKLTDFGLSK 149 (333)
T ss_pred CccccCCCHHHEEECCC----------------------CCEEEEeCcCCc
Confidence 37899999999999764 679999998665
No 112
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=95.54 E-value=0.0046 Score=46.39 Aligned_cols=17 Identities=35% Similarity=0.559 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+|.|||+..+
T Consensus 123 ~ivH~dlkp~Nil~~~~ 139 (288)
T cd07871 123 KILHRDLKPQNLLINEK 139 (288)
T ss_pred CcccCCCCHHHEEECCC
Confidence 47899999999999774
No 113
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=95.54 E-value=0.008 Score=45.26 Aligned_cols=29 Identities=24% Similarity=0.410 Sum_probs=24.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..+.
T Consensus 121 ~i~H~dlkp~NIli~~~----------------------~~~kl~Dfg~~~ 149 (291)
T cd05612 121 EIVYRDLKPENILLDKE----------------------GHIKLTDFGFAK 149 (291)
T ss_pred CeeecCCCHHHeEECCC----------------------CCEEEEecCcch
Confidence 47899999999999764 678999997654
No 114
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=95.53 E-value=0.0081 Score=43.07 Aligned_cols=18 Identities=39% Similarity=0.517 Sum_probs=15.7
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+|+++.||++...
T Consensus 124 ~~i~H~di~p~nili~~~ 141 (262)
T cd00192 124 KKFVHRDLAARNCLVGED 141 (262)
T ss_pred CCcccCccCcceEEECCC
Confidence 357999999999999885
No 115
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=95.53 E-value=0.006 Score=46.90 Aligned_cols=29 Identities=17% Similarity=0.419 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+..+ +.++|+||..|.
T Consensus 115 ~ivH~Dlkp~NIll~~~----------------------~~~kL~Dfg~~~ 143 (323)
T cd05595 115 DVVYRDIKLENLMLDKD----------------------GHIKITDFGLCK 143 (323)
T ss_pred CeEecCCCHHHEEEcCC----------------------CCEEecccHHhc
Confidence 48999999999999874 567788886543
No 116
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=95.53 E-value=0.0064 Score=45.15 Aligned_cols=28 Identities=32% Similarity=0.450 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+||++.|||+..+ +.+.|+||..|
T Consensus 130 ~iiH~dlkp~Nil~~~~----------------------~~~kl~Dfg~~ 157 (290)
T cd07862 130 RVVHRDLKPQNILVTSS----------------------GQIKLADFGLA 157 (290)
T ss_pred CeeeCCCCHHHEEEcCC----------------------CCEEEccccce
Confidence 47999999999999874 66888888654
No 117
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=95.52 E-value=0.0068 Score=47.08 Aligned_cols=17 Identities=24% Similarity=0.538 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 188 ~ivHrDlkp~NIll~~~ 204 (353)
T PLN00034 188 HIVHRDIKPSNLLINSA 204 (353)
T ss_pred CEeecCCCHHHEEEcCC
Confidence 47999999999999874
No 118
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core
Probab=95.51 E-value=0.0087 Score=42.46 Aligned_cols=32 Identities=25% Similarity=0.378 Sum_probs=25.5
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
..++|+|+++.||++.++ +.+.|+||..+...
T Consensus 117 ~~i~h~dl~p~ni~i~~~----------------------~~~~l~d~~~~~~~ 148 (253)
T cd05122 117 NGIIHRDIKAANILLTSD----------------------GEVKLIDFGLSAQL 148 (253)
T ss_pred CCEecCCCCHHHEEEccC----------------------CeEEEeeccccccc
Confidence 347999999999999874 67888888766543
No 119
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of
Probab=95.51 E-value=0.0081 Score=47.06 Aligned_cols=29 Identities=28% Similarity=0.470 Sum_probs=25.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+... +.+.++||..|.
T Consensus 121 givHrDlkp~NIll~~~----------------------~~~kl~DfGla~ 149 (377)
T cd05629 121 GFIHRDIKPDNILIDRG----------------------GHIKLSDFGLST 149 (377)
T ss_pred CeeccCCCHHHEEECCC----------------------CCEEEeeccccc
Confidence 48999999999999764 679999998774
No 120
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation,
Probab=95.49 E-value=0.0069 Score=45.04 Aligned_cols=29 Identities=28% Similarity=0.406 Sum_probs=23.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+.++ +.+.++||..+.
T Consensus 152 ~ivH~dlkp~Nil~~~~----------------------~~~kL~Dfg~~~ 180 (293)
T cd05053 152 KCIHRDLAARNVLVTED----------------------HVMKIADFGLAR 180 (293)
T ss_pred CccccccceeeEEEcCC----------------------CeEEeCcccccc
Confidence 47999999999999874 667888887653
No 121
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding
Probab=95.48 E-value=0.0054 Score=46.33 Aligned_cols=29 Identities=28% Similarity=0.573 Sum_probs=23.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.++||..+.
T Consensus 135 ~i~H~dL~p~Nili~~~----------------------~~~~l~Dfg~~~ 163 (297)
T cd06656 135 QVIHRDIKSDNILLGMD----------------------GSVKLTDFGFCA 163 (297)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEECcCccce
Confidence 47999999999999764 668888887553
No 122
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=95.47 E-value=0.0079 Score=46.80 Aligned_cols=29 Identities=28% Similarity=0.523 Sum_probs=24.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 146 ~ivH~Dlkp~NIll~~~----------------------~~~kL~DfG~a~ 174 (364)
T cd07875 146 GIIHRDLKPSNIVVKSD----------------------CTLKILDFGLAR 174 (364)
T ss_pred CeecCCCCHHHEEECCC----------------------CcEEEEeCCCcc
Confidence 57999999999999874 678899987664
No 123
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=95.46 E-value=0.0084 Score=45.87 Aligned_cols=29 Identities=28% Similarity=0.360 Sum_probs=24.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..|.
T Consensus 116 ~ivHrDikp~Nill~~~----------------------~~~kL~Dfg~~~ 144 (321)
T cd05591 116 GVIYRDLKLDNILLDAE----------------------GHCKLADFGMCK 144 (321)
T ss_pred CeeccCCCHHHeEECCC----------------------CCEEEeecccce
Confidence 47999999999999774 678999997553
No 124
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=95.46 E-value=0.0083 Score=46.05 Aligned_cols=29 Identities=24% Similarity=0.364 Sum_probs=23.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..+.
T Consensus 116 ~ivH~dlkp~NIli~~~----------------------~~~kL~DfG~~~ 144 (320)
T cd05590 116 GIIYRDLKLDNVLLDHE----------------------GHCKLADFGMCK 144 (320)
T ss_pred CeEeCCCCHHHeEECCC----------------------CcEEEeeCCCCe
Confidence 47999999999999874 678888987544
No 125
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=95.46 E-value=0.0093 Score=45.93 Aligned_cols=28 Identities=29% Similarity=0.573 Sum_probs=23.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+..+ +.+.|+||..|
T Consensus 122 ~iiHrDlkp~Nili~~~----------------------~~~kL~DfG~a 149 (332)
T cd05623 122 HYVHRDIKPDNILMDMN----------------------GHIRLADFGSC 149 (332)
T ss_pred CeEecCCCHHHEEECCC----------------------CCEEEeecchh
Confidence 47899999999999764 67889999765
No 126
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=95.45 E-value=0.0082 Score=46.23 Aligned_cols=28 Identities=21% Similarity=0.406 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+..+ +.+.|+||..|
T Consensus 116 ~ivHrDlkp~Nili~~~----------------------~~~kl~Dfg~~ 143 (327)
T cd05617 116 GIIYRDLKLDNVLLDAD----------------------GHIKLTDYGMC 143 (327)
T ss_pred CeeccCCCHHHEEEeCC----------------------CCEEEeccccc
Confidence 47999999999999874 66888888655
No 127
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=95.44 E-value=0.0084 Score=43.82 Aligned_cols=29 Identities=28% Similarity=0.515 Sum_probs=23.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|+++.|||+.++ +.+.++||..+.
T Consensus 122 ~i~H~di~p~Nili~~~----------------------~~~~l~dfg~~~ 150 (260)
T cd05070 122 NYIHRDLRSANILVGDG----------------------LVCKIADFGLAR 150 (260)
T ss_pred CcccCCCccceEEEeCC----------------------ceEEeCCceeee
Confidence 47999999999999874 567788887764
No 128
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=95.43 E-value=0.0072 Score=46.32 Aligned_cols=29 Identities=21% Similarity=0.418 Sum_probs=23.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..+.
T Consensus 116 ~ivHrDlkp~Nil~~~~----------------------~~~kl~Dfg~~~ 144 (316)
T cd05620 116 GIIYRDLKLDNVMLDRD----------------------GHIKIADFGMCK 144 (316)
T ss_pred CeEecCCCHHHeEECCC----------------------CCEEeCccCCCe
Confidence 58999999999999874 568888887553
No 129
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=95.43 E-value=0.0067 Score=44.14 Aligned_cols=31 Identities=23% Similarity=0.336 Sum_probs=26.0
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
+..++|+||+++||++..+ +.+.|+||..+.
T Consensus 119 ~~~i~H~dl~~~ni~~~~~----------------------~~~~l~d~g~~~ 149 (265)
T cd06605 119 KHKIIHRDVKPSNILVNSR----------------------GQIKLCDFGVSG 149 (265)
T ss_pred CCCeecCCCCHHHEEECCC----------------------CCEEEeecccch
Confidence 3578999999999999874 679999997653
No 130
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=95.43 E-value=0.0074 Score=46.70 Aligned_cols=29 Identities=28% Similarity=0.523 Sum_probs=23.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||+++|||+..+ +.+.|+||..|.
T Consensus 139 givHrDikp~Nill~~~----------------------~~~kl~Dfg~~~ 167 (355)
T cd07874 139 GIIHRDLKPSNIVVKSD----------------------CTLKILDFGLAR 167 (355)
T ss_pred CcccCCCChHHEEECCC----------------------CCEEEeeCcccc
Confidence 47899999999999874 568888887654
No 131
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=95.42 E-value=0.0081 Score=46.94 Aligned_cols=29 Identities=21% Similarity=0.348 Sum_probs=24.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 151 ~ivHrDLkp~NILl~~~----------------------~~ikL~DFG~a~ 179 (340)
T PTZ00426 151 NIVYRDLKPENLLLDKD----------------------GFIKMTDFGFAK 179 (340)
T ss_pred CeEccCCCHHHEEECCC----------------------CCEEEecCCCCe
Confidence 47999999999999764 678899998764
No 132
>PRK10345 hypothetical protein; Provisional
Probab=95.42 E-value=0.013 Score=44.11 Aligned_cols=32 Identities=25% Similarity=0.174 Sum_probs=23.0
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
++|+||+|.|||+.....+ ...++|||+=-+.
T Consensus 126 IvhrDlKp~NILl~~~~~~------------------~~~~~LiDg~G~~ 157 (210)
T PRK10345 126 IVTMELKPQNILCQRISES------------------EVIPVVCDNIGES 157 (210)
T ss_pred EeecCCCHHHEEEeccCCC------------------CCcEEEEECCCCc
Confidence 6799999999999753111 1579999964443
No 133
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=95.41 E-value=0.0085 Score=46.69 Aligned_cols=50 Identities=20% Similarity=0.294 Sum_probs=34.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC------CchhhhHHHHHHH
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY------NYRAFDIANHFVE 75 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~------n~r~fDlanhf~E 75 (107)
.+.|+||.++|||+..++..+ .....+.|||||=+.. ..+.-||+-....
T Consensus 158 Gi~HgDL~~~NiLl~~~~~~~---------------~~~~~~~LIDl~r~~~~~~~~~~~r~~dL~~L~~s 213 (268)
T PRK15123 158 GINHRDCYICHFLLHLPFPGR---------------EEDLKLSVIDLHRAQIRARVPRRWRDKDLAGLYFS 213 (268)
T ss_pred cCccCCCChhhEEEeccccCC---------------CCCceEEEEECCcccccCCCChHHHHHHHHHHHHH
Confidence 479999999999998621000 0115799999997732 3556788876544
No 134
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=95.41 E-value=0.0087 Score=46.97 Aligned_cols=29 Identities=31% Similarity=0.615 Sum_probs=25.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 121 ~ivHrDlKp~NILl~~~----------------------g~~kL~DFGla~ 149 (382)
T cd05625 121 GFIHRDIKPDNILIDRD----------------------GHIKLTDFGLCT 149 (382)
T ss_pred CeecCCCCHHHEEECCC----------------------CCEEEeECCCCc
Confidence 47999999999999774 679999998764
No 135
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=95.39 E-value=0.009 Score=43.21 Aligned_cols=17 Identities=35% Similarity=0.423 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++..+
T Consensus 113 ~~~H~dl~p~nili~~~ 129 (250)
T cd05085 113 NCIHRDLAARNCLVGEN 129 (250)
T ss_pred CeeecccChheEEEcCC
Confidence 47999999999999764
No 136
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=95.39 E-value=0.0081 Score=44.44 Aligned_cols=29 Identities=21% Similarity=0.400 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|++|.|||+.+. ..+.|+||..+.
T Consensus 144 gi~H~dlkp~Nil~~~~----------------------~~~kl~Dfg~~~ 172 (283)
T cd05091 144 HVVHKDLATRNVLVFDK----------------------LNVKISDLGLFR 172 (283)
T ss_pred CccccccchhheEecCC----------------------CceEeccccccc
Confidence 36899999999999874 567888887543
No 137
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=95.38 E-value=0.0084 Score=45.94 Aligned_cols=29 Identities=24% Similarity=0.441 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 116 ~ivH~dlkp~Nill~~~----------------------~~~kL~Dfg~a~ 144 (316)
T cd05592 116 GIIYRDLKLDNVLLDKD----------------------GHIKIADFGMCK 144 (316)
T ss_pred CEEeCCCCHHHeEECCC----------------------CCEEEccCcCCe
Confidence 47999999999999774 668888887654
No 138
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=95.38 E-value=0.0091 Score=46.27 Aligned_cols=29 Identities=24% Similarity=0.565 Sum_probs=24.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+... +.+.|+||..+.
T Consensus 121 ~ivH~Dlkp~NIl~~~~----------------------~~~kl~Dfg~~~ 149 (364)
T cd05599 121 GYIHRDIKPDNLLLDAK----------------------GHIKLSDFGLCT 149 (364)
T ss_pred CeEeccCCHHHeEECCC----------------------CCEEEeecccce
Confidence 47899999999999874 679999998774
No 139
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is
Probab=95.37 E-value=0.0099 Score=45.69 Aligned_cols=17 Identities=29% Similarity=0.475 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 138 ~ivHrdikp~Nil~~~~ 154 (343)
T cd07878 138 GIIHRDLKPSNVAVNED 154 (343)
T ss_pred CeecccCChhhEEECCC
Confidence 47999999999999874
No 140
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=95.36 E-value=0.012 Score=43.56 Aligned_cols=29 Identities=24% Similarity=0.384 Sum_probs=23.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+..+ +.+.++||..+.
T Consensus 127 ~i~H~dlkp~Nili~~~----------------------~~~~l~dfg~~~ 155 (283)
T cd05080 127 HYIHRDLAARNVLLDND----------------------RLVKIGDFGLAK 155 (283)
T ss_pred CeeccccChheEEEcCC----------------------CcEEEeeccccc
Confidence 47999999999999764 567778887654
No 141
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=95.34 E-value=0.0073 Score=46.91 Aligned_cols=29 Identities=28% Similarity=0.523 Sum_probs=23.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 143 ~ivHrDlkp~NIl~~~~----------------------~~~kl~Dfg~a~ 171 (359)
T cd07876 143 GIIHRDLKPSNIVVKSD----------------------CTLKILDFGLAR 171 (359)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEEecCCCcc
Confidence 47899999999999874 668888887653
No 142
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=95.34 E-value=0.011 Score=44.62 Aligned_cols=16 Identities=38% Similarity=0.414 Sum_probs=14.2
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||++.|||+..
T Consensus 128 ~ivHrDlkp~Nil~~~ 143 (317)
T cd07868 128 WVLHRDLKPANILVMG 143 (317)
T ss_pred CEEcCCCCHHHEEEec
Confidence 4899999999999965
No 143
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds
Probab=95.34 E-value=0.011 Score=43.42 Aligned_cols=17 Identities=35% Similarity=0.548 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||+++||++..+
T Consensus 120 ~i~H~dl~p~nili~~~ 136 (256)
T cd05113 120 QFIHRDLAARNCLVDDQ 136 (256)
T ss_pred CeeccccCcceEEEcCC
Confidence 47999999999999764
No 144
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=95.34 E-value=0.011 Score=44.38 Aligned_cols=17 Identities=29% Similarity=0.428 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 122 ~iiH~dikp~Nill~~~ 138 (285)
T cd05631 122 RIVYRDLKPENILLDDR 138 (285)
T ss_pred CEEeCCCCHHHEEECCC
Confidence 47999999999999764
No 145
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=95.34 E-value=0.0092 Score=43.88 Aligned_cols=17 Identities=35% Similarity=0.587 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 126 ~i~h~dlkp~nili~~~ 142 (267)
T cd05066 126 GYVHRDLAARNILVNSN 142 (267)
T ss_pred CEeehhhchhcEEECCC
Confidence 47899999999999764
No 146
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=95.34 E-value=0.0094 Score=43.93 Aligned_cols=17 Identities=41% Similarity=0.722 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++.+.
T Consensus 122 ~i~H~dl~p~Nill~~~ 138 (262)
T cd05071 122 NYVHRDLRAANILVGEN 138 (262)
T ss_pred CccccccCcccEEEcCC
Confidence 46899999999999874
No 147
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=95.32 E-value=0.014 Score=44.68 Aligned_cols=17 Identities=41% Similarity=0.552 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 194 ~ivHrDiKp~Nil~~~~ 210 (338)
T cd05102 194 KCIHRDLAARNILLSEN 210 (338)
T ss_pred CEECCCCccceEEEcCC
Confidence 48999999999999764
No 148
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=95.30 E-value=0.01 Score=45.79 Aligned_cols=29 Identities=21% Similarity=0.392 Sum_probs=23.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..|.
T Consensus 116 ~ivH~Dikp~Nili~~~----------------------~~~kL~DfG~~~ 144 (329)
T cd05618 116 GIIYRDLKLDNVLLDSE----------------------GHIKLTDYGMCK 144 (329)
T ss_pred CeeeCCCCHHHEEECCC----------------------CCEEEeeCCccc
Confidence 47899999999999874 678888987653
No 149
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=95.29 E-value=0.0083 Score=45.52 Aligned_cols=17 Identities=35% Similarity=0.493 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+..+
T Consensus 123 ~ivH~dlkp~NIll~~~ 139 (338)
T cd07859 123 NVFHRDLKPKNILANAD 139 (338)
T ss_pred CeecCCCCHHHeEECCC
Confidence 47999999999999774
No 150
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=95.29 E-value=0.0088 Score=43.80 Aligned_cols=17 Identities=35% Similarity=0.618 Sum_probs=14.7
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 132 ~i~H~dlkp~Nil~~~~ 148 (272)
T cd05075 132 SFIHRDLAARNCMLNEN 148 (272)
T ss_pred CeeccccchhheEEcCC
Confidence 37899999999999764
No 151
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.29 E-value=0.013 Score=45.39 Aligned_cols=29 Identities=24% Similarity=0.411 Sum_probs=23.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..+.
T Consensus 124 ~ivH~dlkp~Nili~~~----------------------~~~kL~Dfg~~~ 152 (333)
T cd06650 124 KIMHRDVKPSNILVNSR----------------------GEIKLCDFGVSG 152 (333)
T ss_pred CEEecCCChhhEEEcCC----------------------CCEEEeeCCcch
Confidence 47899999999999764 568888987653
No 152
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.28 E-value=0.012 Score=45.29 Aligned_cols=29 Identities=24% Similarity=0.410 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+... +.+.|+||..+.
T Consensus 124 ~ivH~dlkp~Nil~~~~----------------------~~~kl~Dfg~~~ 152 (331)
T cd06649 124 QIMHRDVKPSNILVNSR----------------------GEIKLCDFGVSG 152 (331)
T ss_pred CEEcCCCChhhEEEcCC----------------------CcEEEccCcccc
Confidence 47999999999999874 568888887653
No 153
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=95.28 E-value=0.0078 Score=45.23 Aligned_cols=17 Identities=35% Similarity=0.536 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++|||+..+
T Consensus 124 ~i~H~dlkp~Nil~~~~ 140 (301)
T cd07873 124 KVLHRDLKPQNLLINER 140 (301)
T ss_pred CeeCCCCCHHHEEECCC
Confidence 47999999999999874
No 154
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=95.27 E-value=0.011 Score=43.38 Aligned_cols=30 Identities=27% Similarity=0.448 Sum_probs=24.5
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+|+++.||++..+ +.+.++||..+.
T Consensus 133 ~~i~H~dl~~~nil~~~~----------------------~~~~l~dfg~~~ 162 (269)
T cd08528 133 KRIVHRDLTPNNIMLGED----------------------DKVTITDFGLAK 162 (269)
T ss_pred CceeecCCCHHHEEECCC----------------------CcEEEeccccee
Confidence 357999999999999774 668888888664
No 155
>PHA03212 serine/threonine kinase US3; Provisional
Probab=95.27 E-value=0.011 Score=47.44 Aligned_cols=28 Identities=25% Similarity=0.393 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-+.|+||+|.|||+... +.+.|+||..|
T Consensus 202 ~IvHrDiKP~NIll~~~----------------------~~vkL~DFG~a 229 (391)
T PHA03212 202 RIIHRDIKAENIFINHP----------------------GDVCLGDFGAA 229 (391)
T ss_pred CcccCCCChHhEEEcCC----------------------CCEEEEeCCcc
Confidence 47899999999999874 66889998765
No 156
>KOG0583|consensus
Probab=95.27 E-value=0.0063 Score=49.35 Aligned_cols=45 Identities=24% Similarity=0.301 Sum_probs=33.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
.++|+||+++|||+.... ..+.|+||..+....+.-++-..+|-.
T Consensus 140 gi~HRDLK~ENilld~~~---------------------~~~Kl~DFG~s~~~~~~~~~l~t~cGs 184 (370)
T KOG0583|consen 140 GIVHRDLKPENILLDGNE---------------------GNLKLSDFGLSAISPGEDGLLKTFCGS 184 (370)
T ss_pred CEeeCCCCHHHEEecCCC---------------------CCEEEeccccccccCCCCCcccCCCCC
Confidence 579999999999998831 569999999998765444454445443
No 157
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=95.27 E-value=0.011 Score=46.62 Aligned_cols=28 Identities=36% Similarity=0.617 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+..+ +.+.|+||-.|
T Consensus 162 ~ivHrDLkp~NIll~~~----------------------~~ikL~DfG~a 189 (371)
T cd05622 162 GFIHRDVKPDNMLLDKS----------------------GHLKLADFGTC 189 (371)
T ss_pred CEEeCCCCHHHEEECCC----------------------CCEEEEeCCce
Confidence 58999999999999764 67889998755
No 158
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=95.25 E-value=0.011 Score=45.09 Aligned_cols=29 Identities=28% Similarity=0.351 Sum_probs=24.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..+.
T Consensus 118 ~i~H~dlkp~Nil~~~~----------------------~~~kL~Dfg~~~ 146 (318)
T cd05582 118 GIIYRDLKPENILLDEE----------------------GHIKLTDFGLSK 146 (318)
T ss_pred CEecCCCCHHHeEECCC----------------------CcEEEeeccCCc
Confidence 47999999999999874 679999997664
No 159
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=95.23 E-value=0.011 Score=43.31 Aligned_cols=17 Identities=29% Similarity=0.372 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+.|+||++.|||+..+
T Consensus 120 ~ivH~dlkp~Nill~~~ 136 (269)
T cd05042 120 DFIHSDLALRNCQLTAD 136 (269)
T ss_pred CEecccccHhheEecCC
Confidence 46899999999999874
No 160
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=95.22 E-value=0.013 Score=42.58 Aligned_cols=28 Identities=25% Similarity=0.362 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-+.|+||++.||++... +.+.|+||..+
T Consensus 124 ~i~H~dl~p~nilv~~~----------------------~~~~l~dfg~~ 151 (263)
T cd06625 124 MIVHRDIKGANILRDSA----------------------GNVKLGDFGAS 151 (263)
T ss_pred CeecCCCCHHHEEEcCC----------------------CCEEEeecccc
Confidence 46899999999999764 56888888765
No 161
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They
Probab=95.22 E-value=0.011 Score=42.32 Aligned_cols=30 Identities=20% Similarity=0.249 Sum_probs=24.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||.+.||++.++ +.++++||..+..
T Consensus 123 ~~~H~dl~~~nil~~~~----------------------~~~~l~d~~~~~~ 152 (258)
T cd08215 123 KILHRDIKPQNIFLTSN----------------------GLVKLGDFGISKV 152 (258)
T ss_pred CEecccCChHHeEEcCC----------------------CcEEECCccceee
Confidence 68999999999999874 6688888876543
No 162
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=95.22 E-value=0.011 Score=43.93 Aligned_cols=28 Identities=25% Similarity=0.337 Sum_probs=23.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+||++.|||+..+ +.+.|+||..+
T Consensus 125 ~i~H~dl~p~nil~~~~----------------------~~~kl~dfg~~ 152 (290)
T cd05613 125 GIIYRDIKLENILLDSN----------------------GHVVLTDFGLS 152 (290)
T ss_pred CeeccCCCHHHeEECCC----------------------CCEEEeeCccc
Confidence 47999999999999874 56888888654
No 163
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=95.22 E-value=0.012 Score=43.50 Aligned_cols=30 Identities=20% Similarity=0.321 Sum_probs=24.5
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+||++.||++... +.+.++||..+.
T Consensus 122 ~~i~H~dl~p~nil~~~~----------------------~~~~l~dfg~~~ 151 (286)
T cd06622 122 HNIIHRDVKPTNVLVNGN----------------------GQVKLCDFGVSG 151 (286)
T ss_pred CCEeeCCCCHHHEEECCC----------------------CCEEEeecCCcc
Confidence 358999999999999874 668888887653
No 164
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=95.18 E-value=0.015 Score=42.42 Aligned_cols=29 Identities=28% Similarity=0.436 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.|+||..+.
T Consensus 115 ~i~H~di~p~nili~~~----------------------~~~kl~df~~~~ 143 (257)
T cd05060 115 HFVHRDLAARNVLLVNR----------------------HQAKISDFGMSR 143 (257)
T ss_pred CeeccCcccceEEEcCC----------------------CcEEeccccccc
Confidence 47999999999999774 567788886553
No 165
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast
Probab=95.17 E-value=0.011 Score=42.36 Aligned_cols=29 Identities=24% Similarity=0.353 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+|++++||++..+ +.+.++||.++.
T Consensus 119 ~i~H~dl~p~ni~i~~~----------------------~~~~l~d~~~~~ 147 (254)
T cd06627 119 GVIHRDIKAANILTTKD----------------------GVVKLADFGVAT 147 (254)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEEeccccce
Confidence 46899999999999874 668888887655
No 166
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.16 E-value=0.014 Score=44.30 Aligned_cols=29 Identities=28% Similarity=0.395 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.++||..+.
T Consensus 154 gi~H~dlkp~Nill~~~----------------------~~~kL~Dfg~~~ 182 (314)
T cd05099 154 RCIHRDLAARNVLVTED----------------------NVMKIADFGLAR 182 (314)
T ss_pred CeeeccccceeEEEcCC----------------------CcEEEccccccc
Confidence 57999999999999764 567788877663
No 167
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=95.14 E-value=0.011 Score=45.66 Aligned_cols=29 Identities=21% Similarity=0.390 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..|.
T Consensus 116 ~ivH~dlkp~Nili~~~----------------------~~~kL~Dfg~~~ 144 (329)
T cd05588 116 GIIYRDLKLDNVLLDAE----------------------GHIKLTDYGMCK 144 (329)
T ss_pred CeEecCCCHHHeEECCC----------------------CCEEECcCcccc
Confidence 48999999999999774 568888887553
No 168
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=95.11 E-value=0.01 Score=44.69 Aligned_cols=17 Identities=41% Similarity=0.595 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+...
T Consensus 158 ~ivH~dlkp~Nill~~~ 174 (304)
T cd05096 158 NFVHRDLATRNCLVGEN 174 (304)
T ss_pred CccccCcchhheEEcCC
Confidence 37899999999999874
No 169
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=95.10 E-value=0.018 Score=42.96 Aligned_cols=28 Identities=14% Similarity=0.250 Sum_probs=22.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.+.|+||++.|||+... +.+.|+||..+
T Consensus 115 ~ivH~dikp~Nili~~~----------------------~~~~l~Dfg~~ 142 (277)
T cd05607 115 DIVYRDMKPENVLLDDQ----------------------GNCRLSDLGLA 142 (277)
T ss_pred CEEEccCChHhEEEcCC----------------------CCEEEeeceee
Confidence 47899999999999874 56788888754
No 170
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=95.10 E-value=0.0082 Score=46.04 Aligned_cols=17 Identities=35% Similarity=0.628 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++|||+...
T Consensus 125 givH~dlkp~Nili~~~ 141 (332)
T cd07857 125 NVLHRDLKPGNLLVNAD 141 (332)
T ss_pred CcccCCCCHHHeEEcCC
Confidence 47899999999999774
No 171
>PHA03209 serine/threonine kinase US3; Provisional
Probab=95.09 E-value=0.012 Score=45.96 Aligned_cols=29 Identities=17% Similarity=0.302 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+... +.+.|+||..+.
T Consensus 177 ~ivHrDlkp~Nill~~~----------------------~~~kl~DfG~a~ 205 (357)
T PHA03209 177 RIIHRDVKTENIFINDV----------------------DQVCIGDLGAAQ 205 (357)
T ss_pred CeecCCCCHHHEEECCC----------------------CCEEEecCcccc
Confidence 47899999999999874 567888887664
No 172
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=95.09 E-value=0.014 Score=42.42 Aligned_cols=29 Identities=21% Similarity=0.320 Sum_probs=24.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+.++ +.+.++||..+.
T Consensus 120 ~i~H~dl~p~nili~~~----------------------~~~~l~dfg~~~ 148 (255)
T cd08219 120 RVLHRDIKSKNIFLTQN----------------------GKVKLGDFGSAR 148 (255)
T ss_pred CcccCCCCcceEEECCC----------------------CcEEEcccCcce
Confidence 57999999999999774 668888887654
No 173
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=95.09 E-value=0.012 Score=42.72 Aligned_cols=17 Identities=41% Similarity=0.616 Sum_probs=15.2
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.||++...
T Consensus 117 ~i~H~di~p~nil~~~~ 133 (257)
T cd05040 117 RFIHRDLAARNILLASD 133 (257)
T ss_pred CccccccCcccEEEecC
Confidence 57999999999999874
No 174
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=95.08 E-value=0.011 Score=43.74 Aligned_cols=28 Identities=25% Similarity=0.393 Sum_probs=22.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||+++||++... +.+.++||..+
T Consensus 144 ~i~H~dlkp~nili~~~----------------------~~~kl~dfg~~ 171 (286)
T cd06638 144 KTIHRDVKGNNILLTTE----------------------GGVKLVDFGVS 171 (286)
T ss_pred CccccCCCHHhEEECCC----------------------CCEEEccCCce
Confidence 47999999999999874 55778888754
No 175
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=95.08 E-value=0.014 Score=42.91 Aligned_cols=17 Identities=29% Similarity=0.505 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++...
T Consensus 119 ~i~H~dl~p~ni~~~~~ 135 (286)
T cd07832 119 GIMHRDLKPANLLISAD 135 (286)
T ss_pred CeecCCcCHHHEEEcCC
Confidence 47999999999999874
No 176
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=95.08 E-value=0.013 Score=46.20 Aligned_cols=28 Identities=36% Similarity=0.617 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+... +.+.|+||..|
T Consensus 162 ~ivHrDLkp~NILl~~~----------------------~~~kL~DfG~~ 189 (370)
T cd05596 162 GFIHRDVKPDNMLLDKS----------------------GHLKLADFGTC 189 (370)
T ss_pred CeeccCCCHHHEEEcCC----------------------CCEEEEeccce
Confidence 47899999999999874 67889998765
No 177
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved
Probab=95.07 E-value=0.011 Score=45.24 Aligned_cols=29 Identities=24% Similarity=0.380 Sum_probs=24.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+..+ +.++|+||..|.
T Consensus 121 ~ivHrdlkp~Nill~~~----------------------~~~kL~Dfg~~~ 149 (324)
T cd05589 121 KIVYRDLKLDNLLLDTE----------------------GFVKIADFGLCK 149 (324)
T ss_pred CeEecCCCHHHeEECCC----------------------CcEEeCcccCCc
Confidence 47899999999999874 678888987654
No 178
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=95.05 E-value=0.011 Score=43.71 Aligned_cols=17 Identities=35% Similarity=0.565 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 139 ~~vH~dlkp~Nil~~~~ 155 (277)
T cd05062 139 KFVHRDLAARNCMVAED 155 (277)
T ss_pred CcccCCcchheEEEcCC
Confidence 47999999999999874
No 179
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=95.05 E-value=0.013 Score=43.48 Aligned_cols=28 Identities=25% Similarity=0.329 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.||++..+ +.+.++||..+
T Consensus 125 ~~~H~dl~p~nil~~~~----------------------~~~~l~dfg~~ 152 (288)
T cd05583 125 GIIYRDIKLENILLDSE----------------------GHVVLTDFGLS 152 (288)
T ss_pred CeeccCCCHHHeEECCC----------------------CCEEEEECccc
Confidence 58999999999999764 56888888654
No 180
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=95.04 E-value=0.012 Score=45.14 Aligned_cols=29 Identities=21% Similarity=0.413 Sum_probs=23.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||+++|||+..+ +.+.|+||..|.
T Consensus 121 ~ivHrDikp~Nill~~~----------------------~~ikL~Dfg~~~ 149 (323)
T cd05615 121 GIIYRDLKLDNVMLDSE----------------------GHIKIADFGMCK 149 (323)
T ss_pred CeeccCCCHHHeEECCC----------------------CCEEEecccccc
Confidence 47999999999999874 568888886543
No 181
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=95.04 E-value=0.013 Score=44.20 Aligned_cols=29 Identities=24% Similarity=0.390 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||+++||++... +.+.++||..+.
T Consensus 121 ~i~H~dl~p~NIll~~~----------------------~~~~l~dfg~~~ 149 (305)
T cd05609 121 GIVHRDLKPDNLLITSM----------------------GHIKLTDFGLSK 149 (305)
T ss_pred CccccCCchHHEEECCC----------------------CCEEEeeCCCcc
Confidence 47899999999999774 568888887654
No 182
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=95.03 E-value=0.015 Score=42.59 Aligned_cols=30 Identities=27% Similarity=0.369 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+|+++.|||+... +.+.++||..+..
T Consensus 129 ~i~H~dl~p~nil~~~~----------------------~~~~l~dfg~~~~ 158 (284)
T cd05038 129 RYIHRDLAARNILVESE----------------------DLVKISDFGLAKV 158 (284)
T ss_pred CeecCCCCHHhEEEcCC----------------------CCEEEcccccccc
Confidence 58999999999999874 5677777765543
No 183
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=95.03 E-value=0.015 Score=42.10 Aligned_cols=17 Identities=24% Similarity=0.331 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+..+
T Consensus 121 ~i~H~dlkp~Nill~~~ 137 (259)
T cd05037 121 KLVHGNVCGKNILVARY 137 (259)
T ss_pred CeecccCccceEEEecC
Confidence 47999999999999874
No 184
>KOG2345|consensus
Probab=95.02 E-value=0.017 Score=46.12 Aligned_cols=72 Identities=18% Similarity=0.222 Sum_probs=43.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch---hhhHHHHHHHhhhc-cCCCC-C
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR---AFDIANHFVESVYD-YSYKH-F 85 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r---~fDlanhf~E~~~d-y~~~~-~ 85 (107)
-+.|+|++|+|||+.++ +..+++||-=+...+- +=-=|-.+.||+-+ ++-+- .
T Consensus 149 ~yAH~DiKP~NILls~~----------------------~~~vl~D~GS~~~a~i~i~~~~~a~~lQe~a~e~Ct~pyRA 206 (302)
T KOG2345|consen 149 PYAHRDIKPANILLSDS----------------------GLPVLMDLGSATQAPIQIEGSRQALRLQEWAEERCTIPYRA 206 (302)
T ss_pred cccccCCCcceeEecCC----------------------CceEEEeccCccccceEeechHHHHHHHHHHHHhCCCcccC
Confidence 48999999999999985 6789999976654432 11124456677632 22111 2
Q ss_pred C-ceeecCCCCCCHHHHhhccc
Q psy15665 86 P-HYTVKRENYPSYSLRNSSWV 106 (107)
Q Consensus 86 p-~~~~~~~~~Pt~~~~~~~~~ 106 (107)
| .| +-..+-|-.+|.-+|.
T Consensus 207 PELf--~vk~~~ti~ertDIWS 226 (302)
T KOG2345|consen 207 PELF--NVKSHCTITERTDIWS 226 (302)
T ss_pred chhe--ecccCcccccccchhh
Confidence 2 23 3344556666666664
No 185
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=95.02 E-value=0.014 Score=43.34 Aligned_cols=17 Identities=29% Similarity=0.579 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 129 gi~H~dlkp~Nil~~~~ 145 (284)
T cd05079 129 QYVHRDLAARNVLVESE 145 (284)
T ss_pred CeeecccchheEEEcCC
Confidence 47999999999999764
No 186
>PHA03207 serine/threonine kinase US3; Provisional
Probab=95.01 E-value=0.0096 Score=47.23 Aligned_cols=28 Identities=29% Similarity=0.405 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+... +.++|+||..|
T Consensus 205 givHrDlkp~Nill~~~----------------------~~~~l~DfG~a 232 (392)
T PHA03207 205 GIIHRDVKTENIFLDEP----------------------ENAVLGDFGAA 232 (392)
T ss_pred CccccCCCHHHEEEcCC----------------------CCEEEccCccc
Confidence 47999999999999874 66888888754
No 187
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=95.01 E-value=0.014 Score=43.57 Aligned_cols=31 Identities=19% Similarity=0.344 Sum_probs=25.2
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
..++|+||++.|||+... +.+.|+||..+..
T Consensus 120 ~~i~H~dl~p~nili~~~----------------------~~~kl~dfg~~~~ 150 (290)
T cd05580 120 LDIVYRDLKPENLLLDSD----------------------GYIKITDFGFAKR 150 (290)
T ss_pred CCEecCCCCHHHEEECCC----------------------CCEEEeeCCCccc
Confidence 347999999999999874 6688888876653
No 188
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=94.99 E-value=0.013 Score=45.81 Aligned_cols=28 Identities=29% Similarity=0.506 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+..+ +.+.|+||..|
T Consensus 123 ~ivH~dlkp~Nili~~~----------------------~~~kL~Dfg~a 150 (372)
T cd07853 123 GILHRDIKPGNLLVNSN----------------------CVLKICDFGLA 150 (372)
T ss_pred CeeCCCCChHHEEECCC----------------------CCEEeccccce
Confidence 47999999999999874 56788888655
No 189
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=94.98 E-value=0.018 Score=41.70 Aligned_cols=29 Identities=31% Similarity=0.346 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|+++.|||+..+ +.+.|+||..+.
T Consensus 113 ~i~h~di~p~nili~~~----------------------~~~~l~d~g~~~ 141 (251)
T cd05041 113 NCIHRDLAARNCLVGEN----------------------NVLKISDFGMSR 141 (251)
T ss_pred CEehhhcCcceEEEcCC----------------------CcEEEeeccccc
Confidence 47899999999999764 567788876543
No 190
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=94.98 E-value=0.014 Score=45.87 Aligned_cols=29 Identities=31% Similarity=0.579 Sum_probs=24.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+... +.+.|+||..|.
T Consensus 121 givHrDlKp~Nili~~~----------------------~~~kL~DFGl~~ 149 (381)
T cd05626 121 GFIHRDIKPDNILIDLD----------------------GHIKLTDFGLCT 149 (381)
T ss_pred CeeecCCcHHHEEECCC----------------------CCEEEeeCcCCc
Confidence 47999999999999764 679999998764
No 191
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=94.98 E-value=0.012 Score=43.97 Aligned_cols=28 Identities=18% Similarity=0.286 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+... +.+.++||..+
T Consensus 117 ~i~H~dlkp~Nili~~~----------------------~~~~l~dfg~~ 144 (280)
T cd05608 117 RIIYRDLKPENVLLDND----------------------GNVRISDLGLA 144 (280)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEEeeCccc
Confidence 47999999999999764 56888888655
No 192
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=94.98 E-value=0.017 Score=42.78 Aligned_cols=18 Identities=28% Similarity=0.495 Sum_probs=15.4
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+|+++.|||+...
T Consensus 128 ~~i~H~di~p~nil~~~~ 145 (279)
T cd05057 128 KRLVHRDLAARNVLVKTP 145 (279)
T ss_pred CCEEecccCcceEEEcCC
Confidence 357999999999999764
No 193
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=94.97 E-value=0.017 Score=42.29 Aligned_cols=29 Identities=28% Similarity=0.358 Sum_probs=24.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++..+ +.+.++||..+.
T Consensus 118 ~i~H~dl~p~nili~~~----------------------~~~~l~df~~~~ 146 (283)
T cd05118 118 GILHRDLKPENLLINTE----------------------GVLKLADFGLAR 146 (283)
T ss_pred CeeecCcCHHHEEECCC----------------------CcEEEeeeeeeE
Confidence 47999999999999874 678899997653
No 194
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=94.96 E-value=0.01 Score=44.40 Aligned_cols=16 Identities=38% Similarity=0.486 Sum_probs=14.3
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
++|+|+++.|||+...
T Consensus 118 ivH~dikp~Nil~~~~ 133 (279)
T cd05633 118 VVYRDLKPANILLDEH 133 (279)
T ss_pred cCCCCCCHHHEEECCC
Confidence 7899999999999764
No 195
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=94.95 E-value=0.017 Score=43.44 Aligned_cols=16 Identities=38% Similarity=0.414 Sum_probs=14.2
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||++.|||+..
T Consensus 128 ~ivH~Dlkp~Nil~~~ 143 (317)
T cd07867 128 WVLHRDLKPANILVMG 143 (317)
T ss_pred CEEcCCCCHHHEEEcc
Confidence 4899999999999964
No 196
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=94.94 E-value=0.012 Score=43.09 Aligned_cols=28 Identities=25% Similarity=0.345 Sum_probs=22.5
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
++|+||++.|||+..+ +.+.|+||.++.
T Consensus 127 i~H~dl~p~nil~~~~----------------------~~~~l~Dfg~~~ 154 (265)
T cd06652 127 IVHRDIKGANILRDSV----------------------GNVKLGDFGASK 154 (265)
T ss_pred EecCCCCHHHEEecCC----------------------CCEEECcCcccc
Confidence 7899999999999864 567788886553
No 197
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=94.94 E-value=0.012 Score=44.77 Aligned_cols=17 Identities=35% Similarity=0.550 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||+++|||+...
T Consensus 123 gi~H~dlkp~nili~~~ 139 (330)
T cd07834 123 NVIHRDLKPSNILVNSN 139 (330)
T ss_pred CeecCCCCHHHEEEcCC
Confidence 47999999999999874
No 198
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=94.93 E-value=0.015 Score=43.62 Aligned_cols=28 Identities=21% Similarity=0.263 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+|+++.|||+... ..+.++||..+
T Consensus 122 ~iiH~dikp~Nili~~~----------------------~~~kl~Dfg~~ 149 (285)
T cd05632 122 NTVYRDLKPENILLDDY----------------------GHIRISDLGLA 149 (285)
T ss_pred CeeecCCCHHHEEECCC----------------------CCEEEecCCcc
Confidence 47899999999999764 56788888766
No 199
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly
Probab=94.93 E-value=0.017 Score=43.11 Aligned_cols=17 Identities=41% Similarity=0.579 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+|.|||+.++
T Consensus 140 ~i~H~dlkp~Nili~~~ 156 (288)
T cd05093 140 HFVHRDLATRNCLVGEN 156 (288)
T ss_pred CeeecccCcceEEEccC
Confidence 47999999999999874
No 200
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=94.92 E-value=0.014 Score=42.39 Aligned_cols=28 Identities=32% Similarity=0.511 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+|+++.||++..+ +.+.++||..+
T Consensus 123 ~i~h~di~p~nili~~~----------------------~~~~l~d~g~~ 150 (261)
T cd05034 123 NYIHRDLAARNILVGEN----------------------LVCKIADFGLA 150 (261)
T ss_pred CcccCCcchheEEEcCC----------------------CCEEECccccc
Confidence 47899999999999875 66888888654
No 201
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=94.92 E-value=0.013 Score=42.44 Aligned_cols=17 Identities=35% Similarity=0.440 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.||++..+
T Consensus 120 ~i~h~dl~p~ni~i~~~ 136 (256)
T cd05112 120 NVIHRDLAARNCLVGEN 136 (256)
T ss_pred CccccccccceEEEcCC
Confidence 47999999999999764
No 202
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=94.91 E-value=0.02 Score=44.46 Aligned_cols=29 Identities=31% Similarity=0.411 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+.+. +.+.|+||-.+.
T Consensus 193 ~ivHrDikp~Nill~~~----------------------~~vkL~DfG~a~ 221 (337)
T cd05054 193 KCIHRDLAARNILLSEN----------------------NVVKICDFGLAR 221 (337)
T ss_pred CeecCCCCcceEEEeCC----------------------CcEEEeccccch
Confidence 47999999999999874 567888887553
No 203
>KOG4250|consensus
Probab=94.89 E-value=0.018 Score=50.79 Aligned_cols=18 Identities=33% Similarity=0.571 Sum_probs=15.6
Q ss_pred EEEecccCCCceeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESP 28 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~ 28 (107)
.+||+||+||||++..+-
T Consensus 140 ~IvHRDlKP~NIvl~~Ge 157 (732)
T KOG4250|consen 140 GIVHRDLKPGNIVLQIGE 157 (732)
T ss_pred CceeccCCCCcEEEeecC
Confidence 479999999999998753
No 204
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes
Probab=94.89 E-value=0.015 Score=43.03 Aligned_cols=17 Identities=24% Similarity=0.511 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 120 ~i~H~dlkp~Nill~~~ 136 (287)
T cd07848 120 DIVHRDIKPENLLISHN 136 (287)
T ss_pred CeecCCCCHHHEEEcCC
Confidence 47899999999999764
No 205
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic
Probab=94.88 E-value=0.012 Score=43.81 Aligned_cols=17 Identities=29% Similarity=0.528 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++|||+...
T Consensus 135 ~i~H~dl~p~nil~~~~ 151 (311)
T cd07866 135 HILHRDIKAANILIDNQ 151 (311)
T ss_pred CeecCCCCHHHEEECCC
Confidence 47999999999999874
No 206
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=94.88 E-value=0.018 Score=43.72 Aligned_cols=17 Identities=29% Similarity=0.499 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+..+
T Consensus 120 ~i~H~dl~p~nil~~~~ 136 (308)
T cd06615 120 KIMHRDVKPSNILVNSR 136 (308)
T ss_pred CEEECCCChHHEEEecC
Confidence 58999999999999774
No 207
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=94.87 E-value=0.015 Score=42.65 Aligned_cols=17 Identities=35% Similarity=0.618 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+|+++.|||+.++
T Consensus 126 ~i~H~di~p~nili~~~ 142 (266)
T cd05033 126 NYVHRDLAARNILVNSN 142 (266)
T ss_pred CcccCCCCcceEEEcCC
Confidence 47999999999999874
No 208
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=94.86 E-value=0.015 Score=42.46 Aligned_cols=29 Identities=31% Similarity=0.376 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++..+ ..+.++||+++.
T Consensus 120 ~i~H~dl~p~ni~i~~~----------------------~~~kl~d~g~~~ 148 (256)
T cd05114 120 SFIHRDLAARNCLVSST----------------------GVVKVSDFGMTR 148 (256)
T ss_pred CccccccCcceEEEcCC----------------------CeEEECCCCCcc
Confidence 37999999999999874 557777777654
No 209
>KOG0984|consensus
Probab=94.86 E-value=0.0063 Score=47.75 Aligned_cols=37 Identities=24% Similarity=0.376 Sum_probs=30.9
Q ss_pred ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
...++.+-+.|+|++|+|||++-. +++.+-||--+|+
T Consensus 162 ~~L~~kL~vIHRDvKPsNiLIn~~----------------------GqVKiCDFGIsG~ 198 (282)
T KOG0984|consen 162 EFLHSKLSVIHRDVKPSNILINYD----------------------GQVKICDFGISGY 198 (282)
T ss_pred HHHHHHhhhhhccCCcceEEEccC----------------------CcEEEccccccee
Confidence 445667778999999999999885 8899999988775
No 210
>PHA03210 serine/threonine kinase US3; Provisional
Probab=94.85 E-value=0.015 Score=48.20 Aligned_cols=28 Identities=25% Similarity=0.350 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+..+ +.++|+||..|
T Consensus 287 gIiHrDLKP~NILl~~~----------------------~~vkL~DFGla 314 (501)
T PHA03210 287 KLIHRDIKLENIFLNCD----------------------GKIVLGDFGTA 314 (501)
T ss_pred CeecCCCCHHHEEECCC----------------------CCEEEEeCCCc
Confidence 47899999999999874 67888888655
No 211
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=94.83 E-value=0.019 Score=42.18 Aligned_cols=17 Identities=29% Similarity=0.581 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 127 ~~~H~dl~p~nili~~~ 143 (270)
T cd05056 127 RFVHRDIAARNVLVSSP 143 (270)
T ss_pred CeeccccChheEEEecC
Confidence 47999999999999874
No 212
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including
Probab=94.83 E-value=0.018 Score=43.20 Aligned_cols=17 Identities=35% Similarity=0.520 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+.|+||+|.|||+..+
T Consensus 149 ~i~H~dlkp~Nill~~~ 165 (295)
T cd05097 149 NFVHRDLATRNCLVGNH 165 (295)
T ss_pred CeeccccChhhEEEcCC
Confidence 46899999999999864
No 213
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is
Probab=94.83 E-value=0.02 Score=42.65 Aligned_cols=17 Identities=29% Similarity=0.440 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 122 ~i~H~dl~p~nill~~~ 138 (298)
T cd07841 122 WILHRDLKPNNLLIASD 138 (298)
T ss_pred CeeecCCChhhEEEcCC
Confidence 37999999999999874
No 214
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=94.80 E-value=0.016 Score=43.20 Aligned_cols=17 Identities=29% Similarity=0.376 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+..+
T Consensus 123 ~i~H~dlkp~Nil~~~~ 139 (291)
T cd07870 123 HILHRDLKPQNLLISYL 139 (291)
T ss_pred CcccCCCChHHEEEcCC
Confidence 48999999999999764
No 215
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=94.79 E-value=0.014 Score=43.06 Aligned_cols=17 Identities=29% Similarity=0.518 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++..+
T Consensus 119 ~i~H~dl~~~nil~~~~ 135 (284)
T cd07839 119 NVLHRDLKPQNLLINKN 135 (284)
T ss_pred CEecCCCCHHHEEEcCC
Confidence 47999999999999874
No 216
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=94.78 E-value=0.019 Score=41.70 Aligned_cols=29 Identities=34% Similarity=0.400 Sum_probs=24.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|+++.||++..+ +.+.++||+++.
T Consensus 124 ~i~h~dl~~~nilv~~~----------------------~~~kl~d~g~~~ 152 (261)
T cd05148 124 NSIHRDLAARNILVGED----------------------LVCKVADFGLAR 152 (261)
T ss_pred CeeccccCcceEEEcCC----------------------ceEEEccccchh
Confidence 37999999999999874 567888887764
No 217
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding
Probab=94.76 E-value=0.012 Score=44.48 Aligned_cols=29 Identities=28% Similarity=0.573 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.++||..+.
T Consensus 136 gi~H~dLkp~Nill~~~----------------------~~~kl~dfg~~~ 164 (296)
T cd06654 136 QVIHRDIKSDNILLGMD----------------------GSVKLTDFGFCA 164 (296)
T ss_pred CcccCCCCHHHEEEcCC----------------------CCEEECccccch
Confidence 47899999999999764 567788877543
No 218
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=94.75 E-value=0.015 Score=42.54 Aligned_cols=28 Identities=36% Similarity=0.425 Sum_probs=22.6
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
++|+|+++.||++..+ +.+.++||..+.
T Consensus 121 i~H~dl~p~ni~i~~~----------------------~~~kl~dfg~~~ 148 (256)
T cd05059 121 FIHRDLAARNCLVGED----------------------NVVKVSDFGLAR 148 (256)
T ss_pred cccccccHhhEEECCC----------------------CcEEECCcccce
Confidence 7899999999999874 567788877553
No 219
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=94.75 E-value=0.019 Score=42.22 Aligned_cols=18 Identities=22% Similarity=0.525 Sum_probs=15.5
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+||++.|||+...
T Consensus 123 ~~i~h~dlkp~nil~~~~ 140 (283)
T cd06617 123 LSVIHRDVKPSNVLINRN 140 (283)
T ss_pred CCeecCCCCHHHEEECCC
Confidence 357899999999999764
No 220
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=94.75 E-value=0.019 Score=42.89 Aligned_cols=17 Identities=35% Similarity=0.509 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 143 ~i~H~dlkp~Nil~~~~ 159 (291)
T cd05094 143 HFVHRDLATRNCLVGAN 159 (291)
T ss_pred CeeecccCcceEEEccC
Confidence 47999999999999874
No 221
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=94.74 E-value=0.018 Score=42.08 Aligned_cols=17 Identities=35% Similarity=0.595 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|++|.|||+..+
T Consensus 115 ~i~H~dlkp~nill~~~ 131 (257)
T cd05116 115 NFVHRDLAARNVLLVTQ 131 (257)
T ss_pred CEeecccchhhEEEcCC
Confidence 37899999999999874
No 222
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=94.74 E-value=0.024 Score=42.62 Aligned_cols=17 Identities=24% Similarity=0.471 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||+++|||+..+
T Consensus 121 ~ivH~dlk~~Nili~~~ 137 (314)
T cd08216 121 GFIHRSVKASHILLSGD 137 (314)
T ss_pred CeecCCCCcceEEEecC
Confidence 47999999999999874
No 223
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=94.72 E-value=0.019 Score=41.54 Aligned_cols=17 Identities=35% Similarity=0.495 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++..+
T Consensus 121 ~i~h~dl~p~ni~i~~~ 137 (262)
T cd06613 121 GKIHRDIKGANILLTED 137 (262)
T ss_pred CceecCCChhhEEECCC
Confidence 47999999999999874
No 224
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=94.72 E-value=0.019 Score=41.87 Aligned_cols=29 Identities=34% Similarity=0.604 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+|+++.||++... ..++|+||..+.
T Consensus 133 ~i~H~dlkp~Nil~~~~----------------------~~~kl~dfg~~~ 161 (273)
T cd05035 133 NFIHRDLAARNCMLRED----------------------MTVCVADFGLSK 161 (273)
T ss_pred CeeccccchheEEECCC----------------------CeEEECCcccee
Confidence 47899999999999774 567788876653
No 225
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=94.72 E-value=0.019 Score=42.37 Aligned_cols=17 Identities=41% Similarity=0.571 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+.++
T Consensus 144 ~i~H~dlkp~Nil~~~~ 160 (283)
T cd05048 144 HFVHRDLAARNCLVGEG 160 (283)
T ss_pred CeeccccccceEEEcCC
Confidence 47999999999999874
No 226
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=94.71 E-value=0.012 Score=43.03 Aligned_cols=29 Identities=24% Similarity=0.526 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|+++.||++.+. +.+.++||..+.
T Consensus 131 ~ivh~dl~~~nili~~~----------------------~~~~l~Dfg~~~ 159 (272)
T cd06637 131 KVIHRDIKGQNVLLTEN----------------------AEVKLVDFGVSA 159 (272)
T ss_pred CCccCCCCHHHEEECCC----------------------CCEEEccCCCce
Confidence 47899999999999874 567888887653
No 227
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=94.69 E-value=0.017 Score=42.07 Aligned_cols=17 Identities=41% Similarity=0.724 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+|+++.||++..+
T Consensus 123 ~i~H~dl~p~nili~~~ 139 (261)
T cd05072 123 NYIHRDLRAANVLVSES 139 (261)
T ss_pred CeeccccchhhEEecCC
Confidence 37899999999999874
No 228
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=94.67 E-value=0.019 Score=41.78 Aligned_cols=30 Identities=27% Similarity=0.434 Sum_probs=24.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||++.||++... +.+.++||+.+..
T Consensus 120 ~i~h~dl~~~nil~~~~----------------------~~~~l~d~~~~~~ 149 (258)
T cd05578 120 GIIHRDIKPDNILLDEQ----------------------GHVHITDFNIATK 149 (258)
T ss_pred CeeccCCCHHHeEEcCC----------------------CCEEEeecccccc
Confidence 47999999999999874 6788899876643
No 229
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=94.66 E-value=0.023 Score=42.33 Aligned_cols=16 Identities=31% Similarity=0.586 Sum_probs=14.5
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
+.|+||++.|||+..+
T Consensus 130 iiH~dlkp~nili~~~ 145 (279)
T cd05111 130 MVHRNLAARNILLKSD 145 (279)
T ss_pred EeccccCcceEEEcCC
Confidence 7999999999999764
No 230
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=94.66 E-value=0.017 Score=42.68 Aligned_cols=17 Identities=35% Similarity=0.591 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 128 ~i~H~dlkp~nili~~~ 144 (284)
T cd05081 128 RYVHRDLATRNILVESE 144 (284)
T ss_pred CceeccCCHhhEEECCC
Confidence 47999999999999764
No 231
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=94.66 E-value=0.022 Score=43.34 Aligned_cols=28 Identities=32% Similarity=0.542 Sum_probs=22.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.||++..+ +.+.++||..+
T Consensus 145 ~i~H~dL~p~Nil~~~~----------------------~~~kl~dfg~~ 172 (317)
T cd06635 145 NMIHRDIKAGNILLTEP----------------------GQVKLADFGSA 172 (317)
T ss_pred CcccCCCCcccEEECCC----------------------CCEEEecCCCc
Confidence 46999999999999764 56888888654
No 232
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=94.66 E-value=0.016 Score=42.31 Aligned_cols=29 Identities=28% Similarity=0.499 Sum_probs=24.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+|+.+.||++..+ +.+.++||..+.
T Consensus 122 ~~~H~dl~~~ni~i~~~----------------------~~~~l~df~~~~ 150 (280)
T cd05581 122 GIIHRDLKPENILLDKD----------------------MHIKITDFGTAK 150 (280)
T ss_pred CeeecCCCHHHeEECCC----------------------CCEEecCCcccc
Confidence 48999999999999874 678888888654
No 233
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=94.65 E-value=0.022 Score=41.92 Aligned_cols=17 Identities=35% Similarity=0.491 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+..+
T Consensus 120 ~i~H~dlkp~nil~~~~ 136 (269)
T cd05087 120 NFIHSDLALRNCLLTAD 136 (269)
T ss_pred CEeccccCcceEEEcCC
Confidence 48999999999999874
No 234
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=94.62 E-value=0.025 Score=42.20 Aligned_cols=18 Identities=33% Similarity=0.613 Sum_probs=15.2
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+||++.||++..+
T Consensus 129 ~~i~H~dlkp~Nili~~~ 146 (292)
T cd06644 129 MKIIHRDLKAGNVLLTLD 146 (292)
T ss_pred CCeeecCCCcceEEEcCC
Confidence 357899999999999763
No 235
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=94.62 E-value=0.022 Score=42.05 Aligned_cols=18 Identities=44% Similarity=0.597 Sum_probs=15.5
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+|+++.|||+...
T Consensus 131 ~~i~H~dikp~nili~~~ 148 (270)
T cd05047 131 KQFIHRDLAARNILVGEN 148 (270)
T ss_pred CCEeecccccceEEEcCC
Confidence 357999999999999874
No 236
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=94.60 E-value=0.017 Score=43.72 Aligned_cols=29 Identities=34% Similarity=0.449 Sum_probs=23.7
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
..++|+||++.|||+..+ +.+.|+||..+
T Consensus 143 ~gi~H~dlkp~Nili~~~----------------------~~~kl~dfg~~ 171 (303)
T cd05088 143 KQFIHRDLAARNILVGEN----------------------YVAKIADFGLS 171 (303)
T ss_pred CCccccccchheEEecCC----------------------CcEEeCccccC
Confidence 357999999999999764 56788888765
No 237
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=94.59 E-value=0.021 Score=41.06 Aligned_cols=30 Identities=30% Similarity=0.391 Sum_probs=24.4
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+|+.+.||++.++ +.+.++||..+.
T Consensus 112 ~~i~H~di~~~nil~~~~----------------------~~~~l~dfg~~~ 141 (265)
T cd05579 112 NGIIHRDLKPDNILIDSN----------------------GHLKLTDFGLSK 141 (265)
T ss_pred cCeecCCCCHHHeEEcCC----------------------CCEEEEecccch
Confidence 358999999999999874 668888887554
No 238
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning
Probab=94.58 E-value=0.026 Score=41.52 Aligned_cols=30 Identities=33% Similarity=0.450 Sum_probs=24.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||++.||++..+ +.+.|+||..+..
T Consensus 120 ~i~H~dl~~~ni~~~~~----------------------~~~kl~d~g~~~~ 149 (288)
T cd07833 120 NIIHRDIKPENILVSES----------------------GVLKLCDFGFARA 149 (288)
T ss_pred CeecCCCCHHHeEECCC----------------------CCEEEEeeecccc
Confidence 47999999999999874 6688888876443
No 239
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=94.58 E-value=0.023 Score=42.33 Aligned_cols=29 Identities=24% Similarity=0.425 Sum_probs=23.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||+++||++..+ +.+.|+||..+.
T Consensus 148 ~ivH~dlkp~nili~~~----------------------~~~kl~dfg~~~ 176 (291)
T cd06639 148 RIIHRDVKGNNILLTTE----------------------GGVKLVDFGVSA 176 (291)
T ss_pred CeeccCCCHHHEEEcCC----------------------CCEEEeecccch
Confidence 47999999999999774 567888886543
No 240
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=94.58 E-value=0.018 Score=40.35 Aligned_cols=31 Identities=29% Similarity=0.357 Sum_probs=25.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
.++|+|+.+.||++.+. +.+.++||..+..-
T Consensus 107 ~i~h~~i~~~ni~~~~~----------------------~~~~l~d~~~~~~~ 137 (244)
T smart00220 107 GIIHRDLKPENILLDED----------------------GHVKLADFGLARQL 137 (244)
T ss_pred CeecCCcCHHHeEECCC----------------------CcEEEccccceeee
Confidence 57999999999999874 66888888776543
No 241
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in
Probab=94.57 E-value=0.019 Score=44.09 Aligned_cols=28 Identities=29% Similarity=0.464 Sum_probs=22.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+... +.+.|+||..|
T Consensus 116 ~ivHrdikp~Nil~~~~----------------------~~~kl~Dfg~~ 143 (316)
T cd05619 116 GIVYRDLKLDNILLDTD----------------------GHIKIADFGMC 143 (316)
T ss_pred CeEeCCCCHHHEEECCC----------------------CCEEEccCCcc
Confidence 47999999999999874 56788888654
No 242
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=94.56 E-value=0.018 Score=43.15 Aligned_cols=29 Identities=28% Similarity=0.403 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++... +.+.|+||..+.
T Consensus 135 ~i~H~dl~p~nill~~~----------------------~~~kL~dfg~~~ 163 (296)
T cd06618 135 GVIHRDVKPSNILLDAS----------------------GNVKLCDFGISG 163 (296)
T ss_pred CEecCCCcHHHEEEcCC----------------------CCEEECccccch
Confidence 58999999999999764 567888886553
No 243
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=94.55 E-value=0.023 Score=41.71 Aligned_cols=17 Identities=35% Similarity=0.448 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 142 ~i~h~dlkp~nili~~~ 158 (280)
T cd05049 142 HFVHRDLATRNCLVGYD 158 (280)
T ss_pred CeeccccccceEEEcCC
Confidence 47899999999999874
No 244
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=94.55 E-value=0.02 Score=41.67 Aligned_cols=17 Identities=41% Similarity=0.626 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+.++
T Consensus 118 ~i~H~dlk~~nili~~~ 134 (262)
T cd05058 118 KFVHRDLAARNCMLDES 134 (262)
T ss_pred CccccccCcceEEEcCC
Confidence 57999999999999874
No 245
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the
Probab=94.55 E-value=0.031 Score=40.18 Aligned_cols=30 Identities=23% Similarity=0.327 Sum_probs=23.8
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+|+++.||++... +.+.++||..+.
T Consensus 112 ~~~~H~~l~p~ni~~~~~----------------------~~~~l~d~~~~~ 141 (250)
T cd05123 112 LGIIYRDLKPENILLDAD----------------------GHIKLTDFGLAK 141 (250)
T ss_pred CCceecCCCcceEEEcCC----------------------CcEEEeecCcce
Confidence 347999999999999874 567888887553
No 246
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=94.53 E-value=0.024 Score=42.46 Aligned_cols=17 Identities=35% Similarity=0.548 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+...
T Consensus 150 ~i~H~dlkp~Nili~~~ 166 (296)
T cd05095 150 NFVHRDLATRNCLVGKN 166 (296)
T ss_pred CeecccCChheEEEcCC
Confidence 48999999999999764
No 247
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5,
Probab=94.53 E-value=0.021 Score=42.80 Aligned_cols=29 Identities=21% Similarity=0.272 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+.+. +.+.++||..+.
T Consensus 122 ~ivH~dlkp~Nil~~~~----------------------~~~~l~Dfg~~~ 150 (285)
T cd05605 122 RIVYRDLKPENILLDDY----------------------GHIRISDLGLAV 150 (285)
T ss_pred CcEecCCCHHHEEECCC----------------------CCEEEeeCCCce
Confidence 47999999999999764 567788876554
No 248
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the
Probab=94.52 E-value=0.017 Score=42.91 Aligned_cols=17 Identities=35% Similarity=0.520 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 123 ~i~H~dl~p~nil~~~~ 139 (291)
T cd07844 123 RVLHRDLKPQNLLISER 139 (291)
T ss_pred CeecccCCHHHEEEcCC
Confidence 47999999999999874
No 249
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=94.51 E-value=0.017 Score=43.63 Aligned_cols=17 Identities=29% Similarity=0.509 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++...
T Consensus 128 ~i~H~dl~p~nil~~~~ 144 (309)
T cd07845 128 FIIHRDLKVSNLLLTDK 144 (309)
T ss_pred CeecCCCCHHHEEECCC
Confidence 37999999999999874
No 250
>PTZ00036 glycogen synthase kinase; Provisional
Probab=94.51 E-value=0.022 Score=46.33 Aligned_cols=16 Identities=38% Similarity=0.717 Sum_probs=14.5
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||++.|||+..
T Consensus 190 ~IiHrDLKp~NILl~~ 205 (440)
T PTZ00036 190 FICHRDLKPQNLLIDP 205 (440)
T ss_pred CEecCCcCHHHEEEcC
Confidence 4899999999999975
No 251
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=94.50 E-value=0.025 Score=42.57 Aligned_cols=17 Identities=35% Similarity=0.513 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+...
T Consensus 157 givH~dlkp~Nili~~~ 173 (304)
T cd05101 157 KCIHRDLAARNVLVTEN 173 (304)
T ss_pred CeeecccccceEEEcCC
Confidence 47999999999999864
No 252
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological
Probab=94.50 E-value=0.021 Score=41.85 Aligned_cols=17 Identities=35% Similarity=0.565 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+...
T Consensus 139 ~i~H~di~p~nill~~~ 155 (277)
T cd05032 139 KFVHRDLAARNCMVAED 155 (277)
T ss_pred CccccccChheEEEcCC
Confidence 47999999999999874
No 253
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=94.47 E-value=0.019 Score=44.44 Aligned_cols=17 Identities=29% Similarity=0.532 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 138 gi~H~dlkp~Nil~~~~ 154 (353)
T cd07850 138 GIIHRDLKPSNIVVKSD 154 (353)
T ss_pred CeeeCCCCHHHEEECCC
Confidence 47999999999999874
No 254
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=94.47 E-value=0.031 Score=41.41 Aligned_cols=29 Identities=34% Similarity=0.584 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+... +.+.++||..+.
T Consensus 123 ~i~H~dlkp~nili~~~----------------------~~~kl~dfg~~~ 151 (282)
T cd06643 123 KIIHRDLKAGNILFTLD----------------------GDIKLADFGVSA 151 (282)
T ss_pred CeeecCCCcccEEEccC----------------------CCEEEccccccc
Confidence 47899999999999764 568888887653
No 255
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=94.46 E-value=0.023 Score=41.55 Aligned_cols=34 Identities=26% Similarity=0.337 Sum_probs=24.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||++.|||+....... ...+.++||..+.
T Consensus 126 ~i~H~dl~p~nil~~~~~~~~-----------------~~~~~l~dfg~~~ 159 (269)
T cd05044 126 HFIHRDLAARNCLVSEKGYDA-----------------DRVVKIGDFGLAR 159 (269)
T ss_pred CcccCCCChheEEEecCCCCC-----------------CcceEECCccccc
Confidence 479999999999998742111 1367888887653
No 256
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=94.46 E-value=0.02 Score=41.50 Aligned_cols=17 Identities=24% Similarity=0.415 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.||++..+
T Consensus 121 ~i~h~dl~p~ni~~~~~ 137 (256)
T cd08221 121 GILHRDIKTLNIFLTKA 137 (256)
T ss_pred CccccCCChHhEEEeCC
Confidence 47899999999999874
No 257
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis. Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=94.46 E-value=0.021 Score=41.70 Aligned_cols=17 Identities=18% Similarity=0.467 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+..+
T Consensus 126 ~i~H~dl~~~nil~~~~ 142 (267)
T cd08228 126 RVMHRDIKPANVFITAT 142 (267)
T ss_pred CeeCCCCCHHHEEEcCC
Confidence 57999999999999764
No 258
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=94.46 E-value=0.025 Score=42.73 Aligned_cols=17 Identities=29% Similarity=0.563 Sum_probs=14.7
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+...
T Consensus 129 ~ivH~dikp~Nill~~~ 145 (303)
T cd05110 129 RLVHRDLAARNVLVKSP 145 (303)
T ss_pred CeeccccccceeeecCC
Confidence 46899999999999764
No 259
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=94.45 E-value=0.02 Score=41.96 Aligned_cols=17 Identities=41% Similarity=0.671 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.||++...
T Consensus 122 ~i~H~dl~p~ni~i~~~ 138 (260)
T cd05073 122 NYIHRDLRAANILVSAS 138 (260)
T ss_pred CccccccCcceEEEcCC
Confidence 47999999999999774
No 260
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=94.44 E-value=0.024 Score=41.97 Aligned_cols=17 Identities=47% Similarity=0.647 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+..+
T Consensus 144 ~i~H~dlkp~nili~~~ 160 (283)
T cd05090 144 FFVHKDLAARNILIGEQ 160 (283)
T ss_pred CeehhccccceEEEcCC
Confidence 47999999999999874
No 261
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as
Probab=94.42 E-value=0.026 Score=42.38 Aligned_cols=29 Identities=21% Similarity=0.291 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+|+++.||++... +.+.++||..+.
T Consensus 122 ~iiH~dikp~Nil~~~~----------------------~~~~l~Dfg~~~ 150 (285)
T cd05630 122 RIVYRDLKPENILLDDH----------------------GHIRISDLGLAV 150 (285)
T ss_pred CEEeCCCCHHHEEECCC----------------------CCEEEeecccee
Confidence 47899999999999874 668899987653
No 262
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=94.42 E-value=0.027 Score=41.23 Aligned_cols=17 Identities=35% Similarity=0.599 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.||++...
T Consensus 133 ~i~H~dikp~nili~~~ 149 (273)
T cd05074 133 NFIHRDLAARNCMLNEN 149 (273)
T ss_pred CEeecccchhhEEEcCC
Confidence 47999999999999764
No 263
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=94.41 E-value=0.025 Score=41.95 Aligned_cols=30 Identities=23% Similarity=0.463 Sum_probs=24.2
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.-++|+||++.||++... +.++|+||.++.
T Consensus 135 ~gi~H~dl~p~ni~i~~~----------------------~~~~l~d~~~~~ 164 (286)
T cd06614 135 QNVIHRDIKSDNILLSKD----------------------GSVKLADFGFAA 164 (286)
T ss_pred CCeeeCCCChhhEEEcCC----------------------CCEEECccchhh
Confidence 357999999999999864 568888887554
No 264
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=94.40 E-value=0.027 Score=41.67 Aligned_cols=30 Identities=23% Similarity=0.376 Sum_probs=24.2
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+||+++||++..+ +.+.++||..+.
T Consensus 120 ~~i~h~dl~p~Ni~i~~~----------------------~~~~l~dfg~~~ 149 (277)
T cd06641 120 EKKIHRDIKAANVLLSEH----------------------GEVKLADFGVAG 149 (277)
T ss_pred CCeecCCCCHHhEEECCC----------------------CCEEEeecccce
Confidence 457999999999999764 568888887653
No 265
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated
Probab=94.38 E-value=0.019 Score=42.00 Aligned_cols=17 Identities=29% Similarity=0.489 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|++++||++...
T Consensus 126 ~i~H~dl~p~nill~~~ 142 (267)
T cd06646 126 GKMHRDIKGANILLTDN 142 (267)
T ss_pred CccccCCCHHHEEECCC
Confidence 57999999999999764
No 266
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=94.37 E-value=0.026 Score=41.93 Aligned_cols=17 Identities=24% Similarity=0.452 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 115 ~i~H~dlkp~Nill~~~ 131 (279)
T cd06619 115 KILHRDVKPSNMLVNTR 131 (279)
T ss_pred CEeeCCCCHHHEEECCC
Confidence 57999999999999774
No 267
>PHA03211 serine/threonine kinase US3; Provisional
Probab=94.37 E-value=0.023 Score=47.11 Aligned_cols=28 Identities=25% Similarity=0.408 Sum_probs=22.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+||++.|||+... +.++|+||..|
T Consensus 280 gIvHrDLKP~NILl~~~----------------------~~vkL~DFGla 307 (461)
T PHA03211 280 GIIHRDIKTENVLVNGP----------------------EDICLGDFGAA 307 (461)
T ss_pred CEEECcCCHHHEEECCC----------------------CCEEEcccCCc
Confidence 47899999999999874 56778888654
No 268
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=94.36 E-value=0.021 Score=42.42 Aligned_cols=18 Identities=39% Similarity=0.517 Sum_probs=15.5
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+||++.|||+..+
T Consensus 149 ~~i~H~dl~p~nil~~~~ 166 (288)
T cd05050 149 RKFVHRDLATRNCLVGEN 166 (288)
T ss_pred CCeecccccHhheEecCC
Confidence 358999999999999764
No 269
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=94.35 E-value=0.03 Score=40.38 Aligned_cols=18 Identities=17% Similarity=0.287 Sum_probs=15.7
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+||++.||++...
T Consensus 120 ~~i~h~dl~~~nili~~~ 137 (256)
T cd08529 120 KKILHRDIKSLNLFLDAY 137 (256)
T ss_pred CCcccCCCCcceEEEeCC
Confidence 358999999999999874
No 270
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=94.35 E-value=0.028 Score=43.15 Aligned_cols=17 Identities=35% Similarity=0.505 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+.|+||++.|||+..+
T Consensus 154 givH~dlkp~Nill~~~ 170 (334)
T cd05100 154 KCIHRDLAARNVLVTED 170 (334)
T ss_pred CeeccccccceEEEcCC
Confidence 47999999999999864
No 271
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated
Probab=94.33 E-value=0.021 Score=41.74 Aligned_cols=17 Identities=29% Similarity=0.489 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++...
T Consensus 126 ~i~H~dlkp~nili~~~ 142 (267)
T cd06645 126 GKMHRDIKGANILLTDN 142 (267)
T ss_pred CeecCCCCHHHEEECCC
Confidence 47899999999999764
No 272
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=94.31 E-value=0.024 Score=42.56 Aligned_cols=17 Identities=41% Similarity=0.647 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 139 ~ivH~dlkp~Nill~~~ 155 (297)
T cd05089 139 QFIHRDLAARNVLVGEN 155 (297)
T ss_pred CcccCcCCcceEEECCC
Confidence 57999999999999764
No 273
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=94.30 E-value=0.027 Score=41.47 Aligned_cols=29 Identities=28% Similarity=0.444 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++..+ +.++|+||..+.
T Consensus 120 ~i~h~~l~p~ni~~~~~----------------------~~~~l~dfg~~~ 148 (286)
T cd07846 120 NIIHRDIKPENILVSQS----------------------GVVKLCDFGFAR 148 (286)
T ss_pred CccccCCCHHHEEECCC----------------------CcEEEEeeeeee
Confidence 47899999999999774 567888887543
No 274
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=94.30 E-value=0.024 Score=39.65 Aligned_cols=32 Identities=25% Similarity=0.296 Sum_probs=26.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY 64 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 64 (107)
.+.|+|+.+.||++... ..++++||+.+....
T Consensus 118 ~i~h~di~~~ni~v~~~----------------------~~~~l~d~g~~~~~~ 149 (225)
T smart00221 118 GIVHRDLKPENILLGMD----------------------GLVKLADFGLARFIH 149 (225)
T ss_pred CeecCCCCHHHEEEcCC----------------------CCEEEeeCceeeEec
Confidence 67999999999999874 678999998766543
No 275
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=94.29 E-value=0.033 Score=41.12 Aligned_cols=17 Identities=29% Similarity=0.448 Sum_probs=14.6
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+|+++.|||+...
T Consensus 119 ~i~H~dikp~nil~~~~ 135 (268)
T cd05086 119 NFLHSDLALRNCFLTSD 135 (268)
T ss_pred CeeccCCccceEEEcCC
Confidence 36899999999999764
No 276
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=94.27 E-value=0.025 Score=41.92 Aligned_cols=18 Identities=28% Similarity=0.534 Sum_probs=15.5
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+||++.|||+...
T Consensus 127 ~~i~H~dlkp~Nil~~~~ 144 (288)
T cd06616 127 LKIIHRDVKPSNILLDRN 144 (288)
T ss_pred CCeeccCCCHHHEEEccC
Confidence 358999999999999764
No 277
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=94.23 E-value=0.035 Score=40.72 Aligned_cols=17 Identities=29% Similarity=0.485 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++..+
T Consensus 128 ~i~H~dl~~~nil~~~~ 144 (272)
T cd06629 128 GILHRDLKADNLLVDAD 144 (272)
T ss_pred CeeecCCChhhEEEcCC
Confidence 47999999999999764
No 278
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=94.23 E-value=0.031 Score=40.54 Aligned_cols=17 Identities=18% Similarity=0.485 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.||++...
T Consensus 126 ~i~h~dl~p~nil~~~~ 142 (267)
T cd08224 126 RIMHRDIKPANVFITAT 142 (267)
T ss_pred CEecCCcChhhEEECCC
Confidence 57899999999999764
No 279
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding
Probab=94.23 E-value=0.021 Score=43.18 Aligned_cols=29 Identities=24% Similarity=0.563 Sum_probs=22.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++..+ +.+.++||..+.
T Consensus 135 ~i~H~dL~p~Nili~~~----------------------~~~kl~dfg~~~ 163 (296)
T cd06655 135 QVIHRDIKSDNVLLGMD----------------------GSVKLTDFGFCA 163 (296)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEEccCccch
Confidence 47899999999999764 567788876543
No 280
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored
Probab=94.22 E-value=0.027 Score=41.20 Aligned_cols=17 Identities=35% Similarity=0.618 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.||++..+
T Consensus 127 ~i~H~dlkp~Nili~~~ 143 (268)
T cd05063 127 NYVHRDLAARNILVNSN 143 (268)
T ss_pred CeeccccchhhEEEcCC
Confidence 47899999999999764
No 281
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=94.20 E-value=0.043 Score=42.51 Aligned_cols=29 Identities=31% Similarity=0.411 Sum_probs=24.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+... +.+.++||..+.
T Consensus 199 ~i~H~dikp~Nil~~~~----------------------~~~kl~dfg~~~ 227 (343)
T cd05103 199 KCIHRDLAARNILLSEN----------------------NVVKICDFGLAR 227 (343)
T ss_pred CeecCCCccCeEEEcCC----------------------CcEEEEeccccc
Confidence 57999999999999864 668888887654
No 282
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=94.20 E-value=0.028 Score=41.43 Aligned_cols=17 Identities=29% Similarity=0.464 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.||++..+
T Consensus 119 ~~~H~dl~p~nil~~~~ 135 (283)
T cd07835 119 RVLHRDLKPQNLLIDRE 135 (283)
T ss_pred CeeCCCCCHHHEEEcCC
Confidence 57999999999999874
No 283
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a
Probab=94.19 E-value=0.031 Score=40.31 Aligned_cols=17 Identities=41% Similarity=0.657 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|++++||++..+
T Consensus 119 ~i~H~dl~~~ni~~~~~ 135 (256)
T cd06612 119 KKIHRDIKAGNILLNEE 135 (256)
T ss_pred CcccCCCCcceEEECCC
Confidence 47899999999999874
No 284
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=94.19 E-value=0.027 Score=41.12 Aligned_cols=17 Identities=41% Similarity=0.728 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.||++..+
T Consensus 122 ~i~H~dl~p~ni~i~~~ 138 (260)
T cd05067 122 NYIHRDLRAANILVSET 138 (260)
T ss_pred CeecccccHHhEEEcCC
Confidence 47999999999999874
No 285
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=94.18 E-value=0.024 Score=43.77 Aligned_cols=29 Identities=31% Similarity=0.588 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.++|+||..+.
T Consensus 137 ~i~H~dlkp~NIll~~~----------------------~~~kL~dfg~~~ 165 (342)
T cd07879 137 GIIHRDLKPGNLAVNED----------------------CELKILDFGLAR 165 (342)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEEeeCCCCc
Confidence 46899999999999874 668888887553
No 286
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=94.17 E-value=0.03 Score=47.62 Aligned_cols=30 Identities=23% Similarity=0.465 Sum_probs=24.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||+|.|||+..+ .+.++|+||-.|.
T Consensus 275 gIiHRDLKP~NILl~~~---------------------~~~~KL~DFGlA~ 304 (566)
T PLN03225 275 GIVHRDVKPQNIIFSEG---------------------SGSFKIIDLGAAA 304 (566)
T ss_pred CEEeCcCCHHHEEEeCC---------------------CCcEEEEeCCCcc
Confidence 48999999999999852 0568999998774
No 287
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=94.17 E-value=0.034 Score=40.93 Aligned_cols=17 Identities=35% Similarity=0.614 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+.|+||++.|||+..+
T Consensus 115 ~i~H~dlkp~nil~~~~ 131 (257)
T cd05115 115 NFVHRDLAARNVLLVNQ 131 (257)
T ss_pred CeeecccchheEEEcCC
Confidence 47999999999999764
No 288
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=94.16 E-value=0.025 Score=42.63 Aligned_cols=28 Identities=25% Similarity=0.557 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-+.|+||++.||++..+ +.+.++||+.+
T Consensus 138 ~ivH~dlkp~Nill~~~----------------------~~~kL~dfg~~ 165 (292)
T cd06658 138 GVIHRDIKSDSILLTSD----------------------GRIKLSDFGFC 165 (292)
T ss_pred CEeecCCCHHHEEEcCC----------------------CCEEEccCcch
Confidence 36799999999999764 56888888765
No 289
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=94.16 E-value=0.041 Score=43.52 Aligned_cols=28 Identities=21% Similarity=0.349 Sum_probs=22.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+.++ ..+.|+||..|
T Consensus 232 giiHrDLkp~Nil~~~~----------------------~~~kL~DfGla 259 (374)
T cd05106 232 NCIHRDVAARNVLLTDG----------------------RVAKICDFGLA 259 (374)
T ss_pred CEEeccCchheEEEeCC----------------------CeEEEeeceee
Confidence 37899999999999874 56788888654
No 290
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=94.16 E-value=0.024 Score=41.84 Aligned_cols=29 Identities=24% Similarity=0.526 Sum_probs=24.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|+++.||++.+. +.+.++||..+.
T Consensus 141 ~ivH~dl~~~nili~~~----------------------~~~~l~dfg~~~ 169 (282)
T cd06636 141 KVIHRDIKGQNVLLTEN----------------------AEVKLVDFGVSA 169 (282)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEEeeCcchh
Confidence 47999999999999874 668899987654
No 291
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=94.14 E-value=0.033 Score=40.37 Aligned_cols=29 Identities=21% Similarity=0.344 Sum_probs=24.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ ..+.++||+.+.
T Consensus 121 ~i~h~~l~~~nil~~~~----------------------~~~~l~d~~~~~ 149 (256)
T cd08218 121 KILHRDIKSQNIFLTKD----------------------GTIKLGDFGIAR 149 (256)
T ss_pred CEecCCCCHHHEEEcCC----------------------CCEEEeecccee
Confidence 48999999999999774 668899998764
No 292
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=94.14 E-value=0.025 Score=41.98 Aligned_cols=17 Identities=35% Similarity=0.548 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.||++...
T Consensus 150 ~i~H~dlkp~Nili~~~ 166 (296)
T cd05051 150 NFVHRDLATRNCLVGKN 166 (296)
T ss_pred CccccccchhceeecCC
Confidence 46899999999999875
No 293
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=94.14 E-value=0.027 Score=41.08 Aligned_cols=17 Identities=18% Similarity=0.467 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++..+
T Consensus 126 ~i~H~dl~p~nili~~~ 142 (267)
T cd08229 126 RVMHRDIKPANVFITAT 142 (267)
T ss_pred CeecCCCCHHHEEEcCC
Confidence 47999999999999764
No 294
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=94.13 E-value=0.037 Score=42.12 Aligned_cols=29 Identities=34% Similarity=0.549 Sum_probs=23.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++... +.+.++||..+.
T Consensus 141 gi~H~dl~p~nili~~~----------------------~~~kL~dfg~~~ 169 (313)
T cd06633 141 NMIHRDIKAGNILLTEP----------------------GQVKLADFGSAS 169 (313)
T ss_pred CeecCCCChhhEEECCC----------------------CCEEEeecCCCc
Confidence 47899999999999764 567888886544
No 295
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=94.11 E-value=0.031 Score=41.86 Aligned_cols=28 Identities=25% Similarity=0.545 Sum_probs=22.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+||++.||++..+ +.+.++||..+
T Consensus 135 ~i~H~dl~p~Nil~~~~----------------------~~~~l~d~g~~ 162 (285)
T cd06648 135 GVIHRDIKSDSILLTSD----------------------GRVKLSDFGFC 162 (285)
T ss_pred CeecCCCChhhEEEcCC----------------------CcEEEcccccc
Confidence 47899999999999874 56778888654
No 296
>KOG0603|consensus
Probab=94.09 E-value=0.045 Score=47.67 Aligned_cols=35 Identities=31% Similarity=0.374 Sum_probs=28.5
Q ss_pred eEEEecccCCCceeee-cCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchh
Q psy15665 10 VTFCHNDLQEGNILYR-ESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRA 66 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~-~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~ 66 (107)
-.+.|+||+|+|||+. +. +.|.++||=.+....+.
T Consensus 434 ~gvvhRDLkp~NIL~~~~~----------------------g~lrltyFG~a~~~~~~ 469 (612)
T KOG0603|consen 434 QGVVHRDLKPGNILLDGSA----------------------GHLRLTYFGFWSELERS 469 (612)
T ss_pred cCeeecCCChhheeecCCC----------------------CcEEEEEechhhhCchh
Confidence 3468999999999995 32 67999999888776665
No 297
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=94.08 E-value=0.024 Score=41.74 Aligned_cols=17 Identities=29% Similarity=0.471 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+..+
T Consensus 121 ~i~H~dl~p~nil~~~~ 137 (285)
T cd07861 121 RVLHRDLKPQNLLIDNK 137 (285)
T ss_pred CeeecCCCHHHEEEcCC
Confidence 47899999999999774
No 298
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=94.08 E-value=0.027 Score=42.67 Aligned_cols=17 Identities=29% Similarity=0.470 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+...
T Consensus 161 ~ivH~dlkp~Nil~~~~ 177 (302)
T cd05055 161 NCIHRDLAARNVLLTHG 177 (302)
T ss_pred CeehhhhccceEEEcCC
Confidence 47999999999999764
No 299
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=94.07 E-value=0.026 Score=43.16 Aligned_cols=29 Identities=24% Similarity=0.426 Sum_probs=23.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||++.|||+... +.+.|+||..+.
T Consensus 116 ~ivH~dlkp~Nill~~~----------------------~~~kl~Dfg~~~ 144 (318)
T cd05570 116 GIIYRDLKLDNVLLDSE----------------------GHIKIADFGMCK 144 (318)
T ss_pred CeEccCCCHHHeEECCC----------------------CcEEecccCCCe
Confidence 57999999999999874 568888887653
No 300
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=94.06 E-value=0.026 Score=42.10 Aligned_cols=17 Identities=35% Similarity=0.415 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+..+
T Consensus 117 ~i~H~di~p~nili~~~ 133 (278)
T cd05606 117 FVVYRDLKPANILLDEH 133 (278)
T ss_pred CEEcCCCCHHHEEECCC
Confidence 48999999999999764
No 301
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=94.05 E-value=0.023 Score=43.67 Aligned_cols=17 Identities=29% Similarity=0.534 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 126 ~ivH~dlkp~Nill~~~ 142 (336)
T cd07849 126 NVLHRDLKPSNLLLNTN 142 (336)
T ss_pred CeeccCCCHHHEEECCC
Confidence 47999999999999874
No 302
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=94.05 E-value=0.027 Score=42.62 Aligned_cols=28 Identities=25% Similarity=0.547 Sum_probs=22.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+|+++.||++... +.+.++||+.+
T Consensus 136 givH~dl~p~Nilv~~~----------------------~~~~l~dfg~~ 163 (292)
T cd06657 136 GVIHRDIKSDSILLTHD----------------------GRVKLSDFGFC 163 (292)
T ss_pred CeecCCCCHHHEEECCC----------------------CCEEEcccccc
Confidence 47899999999999864 56788888754
No 303
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=94.04 E-value=0.028 Score=41.02 Aligned_cols=30 Identities=20% Similarity=0.328 Sum_probs=24.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+|+++.||++..+ +.+.++||..+..
T Consensus 113 ~~~h~dl~~~nilv~~~----------------------~~~~l~df~~~~~ 142 (262)
T cd05572 113 GIIYRDLKPENLLLDSN----------------------GYVKLVDFGFAKK 142 (262)
T ss_pred CcccCCCCHHHEEEcCC----------------------CCEEEeeCCcccc
Confidence 47999999999999774 5678888776553
No 304
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment.
Probab=94.04 E-value=0.032 Score=41.07 Aligned_cols=17 Identities=29% Similarity=0.483 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.||++..+
T Consensus 120 ~i~h~dl~p~ni~~~~~ 136 (284)
T cd07836 120 RVLHRDLKPQNLLINKR 136 (284)
T ss_pred CeeeCCCCHHHEEECCC
Confidence 48999999999999864
No 305
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=94.04 E-value=0.03 Score=41.49 Aligned_cols=17 Identities=29% Similarity=0.511 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++...
T Consensus 121 ~ivH~dl~p~Nil~~~~ 137 (277)
T cd06640 121 KKIHRDIKAANVLLSEQ 137 (277)
T ss_pred CccCcCCChhhEEEcCC
Confidence 47899999999999864
No 306
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=94.02 E-value=0.04 Score=40.40 Aligned_cols=28 Identities=29% Similarity=0.444 Sum_probs=23.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+|+++.||++... +.+.|+||..+
T Consensus 127 ~i~h~~l~~~nili~~~----------------------~~~~l~dfg~~ 154 (287)
T cd07838 127 RIVHRDLKPQNILVTSD----------------------GQVKIADFGLA 154 (287)
T ss_pred CeeeccCChhhEEEccC----------------------CCEEEeccCcc
Confidence 37999999999999875 56888888655
No 307
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=94.01 E-value=0.034 Score=43.09 Aligned_cols=29 Identities=31% Similarity=0.588 Sum_probs=24.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.|||+..+ +.+.++||..+.
T Consensus 138 gi~H~dlkp~Nill~~~----------------------~~~kl~dfg~~~ 166 (343)
T cd07880 138 GIIHRDLKPGNLAVNED----------------------CELKILDFGLAR 166 (343)
T ss_pred CeecCCCCHHHEEEcCC----------------------CCEEEeeccccc
Confidence 47999999999999874 668888887664
No 308
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=94.00 E-value=0.031 Score=41.62 Aligned_cols=17 Identities=29% Similarity=0.479 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 126 ~i~H~dl~p~nili~~~ 142 (293)
T cd07843 126 WILHRDLKTSNLLLNNR 142 (293)
T ss_pred CeeeccCCHHHEEECCC
Confidence 37899999999999874
No 309
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=93.98 E-value=0.024 Score=42.79 Aligned_cols=17 Identities=35% Similarity=0.505 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+...
T Consensus 160 gi~H~dlkp~Nill~~~ 176 (307)
T cd05098 160 KCIHRDLAARNVLVTED 176 (307)
T ss_pred CcccccccHHheEEcCC
Confidence 57899999999999764
No 310
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=93.94 E-value=0.034 Score=41.50 Aligned_cols=29 Identities=24% Similarity=0.401 Sum_probs=24.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||++.||++..+ +.+.++||.++.
T Consensus 125 ~i~H~dl~~~nil~~~~----------------------~~~~l~dfg~~~ 153 (287)
T cd06621 125 KIIHRDIKPSNILLTRK----------------------GQVKLCDFGVSG 153 (287)
T ss_pred CcccCCCCHHHEEEecC----------------------CeEEEeeccccc
Confidence 57999999999999874 668899998765
No 311
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=93.91 E-value=0.032 Score=41.59 Aligned_cols=17 Identities=35% Similarity=0.571 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+.++
T Consensus 147 ~ivH~dikp~nill~~~ 163 (290)
T cd05045 147 KLVHRDLAARNVLVAEG 163 (290)
T ss_pred CeehhhhhhheEEEcCC
Confidence 57999999999999774
No 312
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=93.89 E-value=0.04 Score=40.94 Aligned_cols=28 Identities=29% Similarity=0.667 Sum_probs=23.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCC-CeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNI-DLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa 60 (107)
.++|+||++.||++... + .+.++||..+
T Consensus 129 ~i~H~dl~p~nil~~~~----------------------~~~~~l~dfg~~ 157 (267)
T PHA03390 129 NIIHNDIKLENVLYDRA----------------------KDRIYLCDYGLC 157 (267)
T ss_pred CeeeCCCCHHHEEEeCC----------------------CCeEEEecCccc
Confidence 38999999999999874 3 6888888755
No 313
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of
Probab=93.87 E-value=0.024 Score=41.99 Aligned_cols=28 Identities=18% Similarity=0.312 Sum_probs=22.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+|+.+.||++..+ +.+.++||..+
T Consensus 115 ~i~H~di~p~Nil~~~~----------------------~~~~l~dfg~~ 142 (277)
T cd05577 115 RIVYRDLKPENVLLDDH----------------------GNVRISDLGLA 142 (277)
T ss_pred CcccCCCCHHHEEECCC----------------------CCEEEccCcch
Confidence 46899999999999874 56788888654
No 314
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=93.86 E-value=0.035 Score=40.81 Aligned_cols=17 Identities=29% Similarity=0.470 Sum_probs=14.6
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+.|+||++.||++..+
T Consensus 120 ~i~H~dl~p~nil~~~~ 136 (286)
T cd07847 120 NCIHRDVKPENILITKQ 136 (286)
T ss_pred CceecCCChhhEEEcCC
Confidence 36899999999999764
No 315
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=93.85 E-value=0.026 Score=41.21 Aligned_cols=28 Identities=21% Similarity=0.390 Sum_probs=22.4
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
+.|+||++.||++... +.+.++||..+.
T Consensus 123 i~H~dl~p~nil~~~~----------------------~~~~l~dfg~~~ 150 (265)
T cd06631 123 VVHRDIKGNNVMLMPN----------------------GIIKLIDFGCAR 150 (265)
T ss_pred cccCCcCHHhEEECCC----------------------CeEEeccchhhH
Confidence 6899999999999764 567788876543
No 316
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=93.83 E-value=0.04 Score=42.25 Aligned_cols=17 Identities=35% Similarity=0.563 Sum_probs=15.2
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.||++...
T Consensus 127 ~i~H~dl~p~nill~~~ 143 (337)
T cd07852 127 NVIHRDLKPSNILLNSD 143 (337)
T ss_pred CeecCCCCHHHEEEcCC
Confidence 47999999999999874
No 317
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=93.82 E-value=0.035 Score=42.01 Aligned_cols=28 Identities=25% Similarity=0.509 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-+.|+|++++||++..+ +.+.|+||..+
T Consensus 137 ~ivH~dl~p~Nill~~~----------------------~~~kL~dfg~~ 164 (297)
T cd06659 137 GVIHRDIKSDSILLTLD----------------------GRVKLSDFGFC 164 (297)
T ss_pred CeecCCCCHHHeEEccC----------------------CcEEEeechhH
Confidence 47899999999999774 67888998755
No 318
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=93.82 E-value=0.026 Score=40.80 Aligned_cols=30 Identities=20% Similarity=0.382 Sum_probs=23.9
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
..++|+||.+.||++... +.+.|+||..+.
T Consensus 119 ~~~~H~~l~~~ni~~~~~----------------------~~~~l~df~~~~ 148 (264)
T cd06623 119 RHIIHRDIKPSNLLINSK----------------------GEVKIADFGISK 148 (264)
T ss_pred CCCccCCCCHHHEEECCC----------------------CCEEEccCccce
Confidence 567999999999999874 567777776554
No 319
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=93.81 E-value=0.031 Score=40.28 Aligned_cols=17 Identities=29% Similarity=0.481 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++..+
T Consensus 122 ~i~H~dl~~~ni~~~~~ 138 (258)
T cd06632 122 NTVHRDIKGANILVDTN 138 (258)
T ss_pred CcccCCCCHHHEEECCC
Confidence 47999999999999764
No 320
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=93.80 E-value=0.046 Score=40.55 Aligned_cols=16 Identities=31% Similarity=0.490 Sum_probs=14.6
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
-++|+||++.||++..
T Consensus 130 ~i~H~dl~~~nil~~~ 145 (295)
T cd07837 130 GVMHRDLKPQNLLVDK 145 (295)
T ss_pred CeeecCCChHHEEEec
Confidence 4799999999999986
No 321
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=93.79 E-value=0.051 Score=39.07 Aligned_cols=28 Identities=25% Similarity=0.284 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+|+++.||++..+ +.+.|+||..+
T Consensus 123 ~i~h~~l~~~ni~~~~~----------------------~~~kl~d~g~~ 150 (256)
T cd08530 123 KILHRDLKSANILLVAN----------------------DLVKIGDLGIS 150 (256)
T ss_pred CcccCCCCcceEEEecC----------------------CcEEEeeccch
Confidence 47899999999999884 66888888654
No 322
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=93.76 E-value=0.042 Score=45.63 Aligned_cols=28 Identities=25% Similarity=0.381 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-++|+||+|.|||+... +.+.|+||-.+
T Consensus 163 ~IiHrDLKP~NILl~~~----------------------~~vkL~DFGls 190 (496)
T PTZ00283 163 HMIHRDIKSANILLCSN----------------------GLVKLGDFGFS 190 (496)
T ss_pred CEecCCCCHHHEEEeCC----------------------CCEEEEecccC
Confidence 46899999999999874 67889998654
No 323
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=93.75 E-value=0.051 Score=40.21 Aligned_cols=17 Identities=29% Similarity=0.429 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 136 ~ivH~dlkp~nil~~~~ 152 (277)
T cd05036 136 HFIHRDIAARNCLLTCK 152 (277)
T ss_pred CEeecccchheEEEecc
Confidence 38999999999999863
No 324
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=93.74 E-value=0.041 Score=47.42 Aligned_cols=30 Identities=23% Similarity=0.375 Sum_probs=25.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||++.|||+... +.++|+||-.+..
T Consensus 124 gIiHrDLKP~NILl~~~----------------------g~vkL~DFGls~~ 153 (669)
T cd05610 124 GIIHRDLKPDNMLISNE----------------------GHIKLTDFGLSKV 153 (669)
T ss_pred CEEeCCccHHHEEEcCC----------------------CCEEEEeCCCCcc
Confidence 48999999999999764 6799999988764
No 325
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1
Probab=93.71 E-value=0.035 Score=40.21 Aligned_cols=29 Identities=31% Similarity=0.477 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||.+.||++.+. +.+.|+||.++.
T Consensus 122 ~i~h~~l~p~ni~~~~~----------------------~~~~l~df~~~~ 150 (267)
T cd06610 122 GQIHRDIKAGNILLGED----------------------GSVKIADFGVSA 150 (267)
T ss_pred CeecCCCCHHhEEEcCC----------------------CCEEEcccchHH
Confidence 47999999999999874 568888887553
No 326
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=93.70 E-value=0.027 Score=40.83 Aligned_cols=29 Identities=24% Similarity=0.509 Sum_probs=23.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||.+.||++... +.+.|+||..+.
T Consensus 133 ~i~H~~l~p~ni~~~~~----------------------~~~~l~d~~~~~ 161 (275)
T cd06608 133 KVIHRDIKGQNILLTKN----------------------AEVKLVDFGVSA 161 (275)
T ss_pred CcccCCCCHHHEEEccC----------------------CeEEECCCccce
Confidence 47999999999999874 568888886553
No 327
>KOG0658|consensus
Probab=93.70 E-value=0.038 Score=45.45 Aligned_cols=18 Identities=28% Similarity=0.600 Sum_probs=16.2
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
.-+||+|++|-|||++.+
T Consensus 144 ~~IcHRDIKPqNlLvD~~ 161 (364)
T KOG0658|consen 144 HGICHRDIKPQNLLVDPD 161 (364)
T ss_pred cCcccCCCChheEEEcCC
Confidence 568999999999999885
No 328
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=93.69 E-value=0.039 Score=40.19 Aligned_cols=17 Identities=24% Similarity=0.503 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.||++...
T Consensus 117 ~i~H~dl~p~nil~~~~ 133 (260)
T cd05611 117 GIIHRDIKPENLLIDQT 133 (260)
T ss_pred CeecCCCCHHHeEECCC
Confidence 47999999999999774
No 329
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=93.68 E-value=0.051 Score=42.92 Aligned_cols=17 Identities=35% Similarity=0.487 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 234 ~ivH~Dlkp~Nill~~~ 250 (375)
T cd05104 234 NCIHRDLAARNILLTHG 250 (375)
T ss_pred CeeccCCchhhEEEECC
Confidence 37899999999999864
No 330
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=93.66 E-value=0.032 Score=40.42 Aligned_cols=17 Identities=24% Similarity=0.511 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+.|+||.++||++...
T Consensus 119 ~i~H~dl~~~nil~~~~ 135 (264)
T cd06626 119 GIVHRDIKPANIFLDHN 135 (264)
T ss_pred CcccCCCCHHHEEECCC
Confidence 36899999999999874
No 331
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=93.65 E-value=0.036 Score=41.22 Aligned_cols=17 Identities=35% Similarity=0.532 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+.++
T Consensus 142 ~i~H~dlkp~nil~~~~ 158 (280)
T cd05092 142 HFVHRDLATRNCLVGQG 158 (280)
T ss_pred CeecccccHhhEEEcCC
Confidence 47899999999999864
No 332
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=93.65 E-value=0.033 Score=42.25 Aligned_cols=29 Identities=34% Similarity=0.439 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+||.+.|||+..+ +.+.++||.++.
T Consensus 135 ~i~H~dl~p~nil~~~~----------------------~~~kl~dfg~~~ 163 (308)
T cd06634 135 NMIHRDVKAGNILLSEP----------------------GLVKLGDFGSAS 163 (308)
T ss_pred CcccCCCCHHhEEECCC----------------------CcEEECCcccce
Confidence 47999999999999764 568888887654
No 333
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=93.65 E-value=0.036 Score=40.71 Aligned_cols=17 Identities=29% Similarity=0.518 Sum_probs=14.7
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++..+
T Consensus 126 ~i~H~~l~p~nil~~~~ 142 (266)
T cd06651 126 MIVHRDIKGANILRDSA 142 (266)
T ss_pred CeeeCCCCHHHEEECCC
Confidence 47999999999998764
No 334
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=93.63 E-value=0.049 Score=40.03 Aligned_cols=17 Identities=35% Similarity=0.573 Sum_probs=15.2
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++.+.
T Consensus 119 ~i~H~dl~~~ni~i~~~ 135 (283)
T cd07830 119 GFFHRDLKPENLLVSGP 135 (283)
T ss_pred CcccCCCChhhEEEcCC
Confidence 47999999999999874
No 335
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=93.62 E-value=0.035 Score=42.90 Aligned_cols=29 Identities=31% Similarity=0.531 Sum_probs=24.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.++|+|+++.||++..+ +.+.|+||..+.
T Consensus 138 gi~H~dlkp~Nill~~~----------------------~~~kL~dfg~~~ 166 (343)
T cd07851 138 GIIHRDLKPSNIAVNED----------------------CELKILDFGLAR 166 (343)
T ss_pred CeecCCCCHHHeEECCC----------------------CCEEEccccccc
Confidence 47899999999999874 678899987664
No 336
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the
Probab=93.60 E-value=0.031 Score=41.74 Aligned_cols=16 Identities=38% Similarity=0.414 Sum_probs=14.5
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||++.|||+..
T Consensus 128 ~i~h~dlkp~Nil~~~ 143 (316)
T cd07842 128 WVLHRDLKPANILVMG 143 (316)
T ss_pred CEeeCCCCHHHEEEcC
Confidence 3789999999999987
No 337
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=93.57 E-value=0.042 Score=40.03 Aligned_cols=18 Identities=28% Similarity=0.377 Sum_probs=15.6
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+|++|.||++..+
T Consensus 104 ~~i~H~dlkp~Nil~~~~ 121 (237)
T cd05576 104 EGIVCRDLNPNNILLDDR 121 (237)
T ss_pred CCeeccCCCHHHEEEcCC
Confidence 358999999999999874
No 338
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=93.56 E-value=0.037 Score=41.30 Aligned_cols=17 Identities=29% Similarity=0.503 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+|+++.|||+...
T Consensus 139 ~i~H~dikp~nili~~~ 155 (288)
T cd05061 139 KFVHRDLAARNCMVAHD 155 (288)
T ss_pred CCcCCCCChheEEEcCC
Confidence 47999999999999874
No 339
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=93.54 E-value=0.035 Score=41.29 Aligned_cols=17 Identities=29% Similarity=0.550 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 139 ~i~H~dl~p~nil~~~~ 155 (310)
T cd07865 139 KILHRDMKAANILITKD 155 (310)
T ss_pred CeeccCCCHHHEEECCC
Confidence 47999999999999764
No 340
>KOG0610|consensus
Probab=93.52 E-value=0.058 Score=45.45 Aligned_cols=32 Identities=28% Similarity=0.390 Sum_probs=27.3
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
+.+.=+||+|.|||++++ +.++|.||+.+--.
T Consensus 198 lGivYRDLKPENILvred----------------------GHIMLsDFDLS~~~ 229 (459)
T KOG0610|consen 198 LGIVYRDLKPENILVRED----------------------GHIMLSDFDLSLRC 229 (459)
T ss_pred hceeeccCCcceeEEecC----------------------CcEEeeeccccccC
Confidence 456779999999999996 89999999987643
No 341
>KOG1235|consensus
Probab=93.52 E-value=0.06 Score=46.24 Aligned_cols=33 Identities=33% Similarity=0.633 Sum_probs=25.2
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
|-|+|.|||||++++.++. ..++++.|+--.+.
T Consensus 322 ffHaDPHPGNilv~~~~~~------------------~~~ivllDhGl~~~ 354 (538)
T KOG1235|consen 322 FFHADPHPGNILVRPNPEG------------------DEEIVLLDHGLYAV 354 (538)
T ss_pred CccCCCCCCcEEEecCCCC------------------CccEEEEccccccc
Confidence 8899999999999975422 16789999864443
No 342
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex
Probab=93.52 E-value=0.044 Score=40.42 Aligned_cols=17 Identities=29% Similarity=0.466 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++..+
T Consensus 120 ~i~H~~l~p~nill~~~ 136 (284)
T cd07860 120 RVLHRDLKPQNLLINTE 136 (284)
T ss_pred CeecCCCCHHHEEECCC
Confidence 47899999999999874
No 343
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=93.51 E-value=0.063 Score=40.49 Aligned_cols=29 Identities=34% Similarity=0.477 Sum_probs=22.9
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-++|+||+++||++..+ +.+.+.||..+.
T Consensus 135 ~i~H~dl~p~nIl~~~~----------------------~~~kL~dfg~~~ 163 (307)
T cd06607 135 ERIHRDIKAGNILLTEP----------------------GTVKLADFGSAS 163 (307)
T ss_pred CceecCCCcccEEECCC----------------------CCEEEeecCcce
Confidence 36899999999999874 567778876553
No 344
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=93.49 E-value=0.036 Score=41.23 Aligned_cols=17 Identities=35% Similarity=0.624 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++.+.
T Consensus 136 ~i~H~dl~p~nili~~~ 152 (302)
T cd07864 136 NFLHRDIKCSNILLNNK 152 (302)
T ss_pred CeecCCCCHHHEEECCC
Confidence 47999999999999874
No 345
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=93.48 E-value=0.035 Score=40.72 Aligned_cols=17 Identities=29% Similarity=0.518 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++...
T Consensus 126 ~i~H~dl~p~ni~i~~~ 142 (264)
T cd06653 126 MIVHRDIKGANILRDSA 142 (264)
T ss_pred CEecCCCCHHHEEEcCC
Confidence 47999999999999764
No 346
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=93.46 E-value=0.034 Score=40.89 Aligned_cols=18 Identities=33% Similarity=0.556 Sum_probs=15.6
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..+.|+||.+.||++..+
T Consensus 120 ~~i~H~dl~p~ni~i~~~ 137 (277)
T cd06917 120 VGVIHRDIKAANILVTNT 137 (277)
T ss_pred CCcccCCcCHHHEEEcCC
Confidence 357999999999999874
No 347
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=93.45 E-value=0.034 Score=40.57 Aligned_cols=17 Identities=29% Similarity=0.495 Sum_probs=14.7
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+|+++.||++.+.
T Consensus 126 ~ivH~di~p~nil~~~~ 142 (267)
T cd06628 126 GIIHRDIKGANILVDNK 142 (267)
T ss_pred CcccccCCHHHEEEcCC
Confidence 37899999999999764
No 348
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=93.41 E-value=0.054 Score=41.98 Aligned_cols=17 Identities=29% Similarity=0.491 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++..+
T Consensus 140 ~ivH~dlkp~NIll~~~ 156 (345)
T cd07877 140 DIIHRDLKPSNLAVNED 156 (345)
T ss_pred CeeecCCChHHEEEcCC
Confidence 47999999999999874
No 349
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=93.41 E-value=0.037 Score=42.70 Aligned_cols=17 Identities=41% Similarity=0.614 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+...
T Consensus 128 ~iiH~dl~p~Nili~~~ 144 (328)
T cd07856 128 GVVHRDLKPSNILINEN 144 (328)
T ss_pred CcccCCCCHHHEeECCC
Confidence 47899999999999764
No 350
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25
Probab=93.36 E-value=0.065 Score=39.57 Aligned_cols=17 Identities=29% Similarity=0.505 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.||++..+
T Consensus 121 ~ivH~dl~p~ni~i~~~ 137 (277)
T cd06642 121 RKIHRDIKAANVLLSEQ 137 (277)
T ss_pred CeeccCCChheEEEeCC
Confidence 47899999999999874
No 351
>KOG0983|consensus
Probab=93.34 E-value=0.033 Score=45.37 Aligned_cols=37 Identities=27% Similarity=0.386 Sum_probs=30.2
Q ss_pred cccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 3 LLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 3 l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
|...+..-.+.|+|++|.|||++++ +.+.|-||--+|
T Consensus 204 L~YLKeKH~viHRDvKPSNILlDe~----------------------GniKlCDFGIsG 240 (391)
T KOG0983|consen 204 LYYLKEKHGVIHRDVKPSNILLDER----------------------GNIKLCDFGISG 240 (391)
T ss_pred HHHHHHhcceeecccCccceEEccC----------------------CCEEeecccccc
Confidence 4445566678999999999999996 889999997666
No 352
>KOG0608|consensus
Probab=93.32 E-value=0.053 Score=48.45 Aligned_cols=32 Identities=28% Similarity=0.566 Sum_probs=28.2
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
....|.|+|+++.|||++.+ +.+.|-||-.|.
T Consensus 746 HkmGFIHRDiKPDNILIDrd----------------------GHIKLTDFGLCT 777 (1034)
T KOG0608|consen 746 HKMGFIHRDIKPDNILIDRD----------------------GHIKLTDFGLCT 777 (1034)
T ss_pred HhccceecccCccceEEccC----------------------Cceeeeeccccc
Confidence 45789999999999999885 889999998775
No 353
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=93.32 E-value=0.054 Score=39.70 Aligned_cols=16 Identities=25% Similarity=0.534 Sum_probs=14.3
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||++.||++..
T Consensus 128 ~i~h~dl~p~nil~~~ 143 (268)
T cd06624 128 QIVHRDIKGDNVLVNT 143 (268)
T ss_pred CEeecCCCHHHEEEcC
Confidence 4799999999999965
No 354
>KOG1006|consensus
Probab=93.30 E-value=0.016 Score=46.88 Aligned_cols=38 Identities=29% Similarity=0.463 Sum_probs=32.2
Q ss_pred cccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 3 LLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 3 l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
|++.+..+-+.|+|++|.|||++.. +.+.|-||--||.
T Consensus 180 L~yLK~~lkiIHRDvKPSNILldr~----------------------G~vKLCDFGIcGq 217 (361)
T KOG1006|consen 180 LDYLKEELKIIHRDVKPSNILLDRH----------------------GDVKLCDFGICGQ 217 (361)
T ss_pred HHHHHHHhhhhhccCChhheEEecC----------------------CCEeeecccchHh
Confidence 5566777889999999999999885 8899999987773
No 355
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=93.28 E-value=0.057 Score=39.64 Aligned_cols=17 Identities=35% Similarity=0.518 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+..+
T Consensus 137 ~i~H~dlkp~Nili~~~ 153 (275)
T cd05046 137 RFVHRDLAARNCLVSSQ 153 (275)
T ss_pred CcccCcCccceEEEeCC
Confidence 37999999999999774
No 356
>PRK09902 hypothetical protein; Provisional
Probab=93.27 E-value=0.048 Score=41.87 Aligned_cols=44 Identities=14% Similarity=0.060 Sum_probs=31.1
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc-----hhhhHHHHH
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY-----RAFDIANHF 73 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----r~fDlanhf 73 (107)
..++|+||.+.||+++.. + .-++.|||||=+.... +.-||+-..
T Consensus 147 ~Gv~Hgdly~khIll~~~--g------------------~~~v~lIDlEk~r~~l~~~~~~~~Dl~~l~ 195 (216)
T PRK09902 147 VNRQHGCCYVRHIYVKTE--G------------------KAEAGFLDLEKSRRRLRRDKAINHDFRQLE 195 (216)
T ss_pred CCCcCCCCCHhheeecCC--C------------------CeeEEEEEhhccchhhhhhhhhHhHHHHHH
Confidence 357999999999999853 0 0359999999776544 345665443
No 357
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=93.21 E-value=0.04 Score=40.32 Aligned_cols=17 Identities=29% Similarity=0.513 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+.+.
T Consensus 120 ~~~h~dl~p~nil~~~~ 136 (287)
T cd07840 120 GILHRDIKGSNILINND 136 (287)
T ss_pred CceeccCcHHHeEEcCC
Confidence 47999999999999874
No 358
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=93.16 E-value=0.062 Score=45.54 Aligned_cols=28 Identities=25% Similarity=0.413 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.++|+||++.|||+..+ ..+.++||..|
T Consensus 329 ~ivHrDLKp~NILl~~~----------------------~~~kL~DFGla 356 (507)
T PLN03224 329 GIVHRDIKPENLLVTVD----------------------GQVKIIDFGAA 356 (507)
T ss_pred CeecCCCchHhEEECCC----------------------CcEEEEeCcCc
Confidence 37899999999999874 56888888765
No 359
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=93.10 E-value=0.066 Score=39.27 Aligned_cols=18 Identities=33% Similarity=0.613 Sum_probs=15.2
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+|+++.||++...
T Consensus 125 ~g~~H~dl~p~nili~~~ 142 (269)
T cd05065 125 MNYVHRDLAARNILVNSN 142 (269)
T ss_pred CCEeecccChheEEEcCC
Confidence 357899999999999764
No 360
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It
Probab=93.09 E-value=0.053 Score=40.00 Aligned_cols=17 Identities=24% Similarity=0.360 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+|+++.|||+...
T Consensus 137 ~i~H~di~p~nil~~~~ 153 (280)
T cd05043 137 GVIHKDIAARNCVIDEE 153 (280)
T ss_pred CEeecccCHhhEEEcCC
Confidence 47899999999999774
No 361
>PTZ00284 protein kinase; Provisional
Probab=93.07 E-value=0.048 Score=44.31 Aligned_cols=18 Identities=39% Similarity=0.595 Sum_probs=15.4
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+||++.|||+...
T Consensus 251 ~gIiHrDlKP~NILl~~~ 268 (467)
T PTZ00284 251 LHLMHTDLKPENILMETS 268 (467)
T ss_pred CCeecCCCCHHHEEEecC
Confidence 458999999999999763
No 362
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=93.04 E-value=0.047 Score=42.01 Aligned_cols=17 Identities=29% Similarity=0.536 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 128 ~i~H~dlkp~Nil~~~~ 144 (337)
T cd07858 128 NVLHRDLKPSNLLLNAN 144 (337)
T ss_pred CEecCCCCHHHEEEcCC
Confidence 48999999999999764
No 363
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=93.04 E-value=0.052 Score=40.88 Aligned_cols=17 Identities=29% Similarity=0.470 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.||++..+
T Consensus 135 gi~H~dL~p~Nili~~~ 151 (293)
T cd06647 135 QVIHRDIKSDNILLGMD 151 (293)
T ss_pred CEeeccCCHHHEEEcCC
Confidence 47999999999999874
No 364
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=93.03 E-value=0.038 Score=39.27 Aligned_cols=18 Identities=28% Similarity=0.442 Sum_probs=15.6
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+|+.+.||++...
T Consensus 120 ~~~~h~dl~p~ni~i~~~ 137 (260)
T cd06606 120 NGIVHRDIKGANILVDSD 137 (260)
T ss_pred CCccccCCCHHHEEEcCC
Confidence 357999999999999874
No 365
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=93.03 E-value=0.069 Score=42.97 Aligned_cols=31 Identities=42% Similarity=0.482 Sum_probs=26.2
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
...+.|+|+.+-|||+.++ +.+++|||--|-
T Consensus 220 ~~GiVHGDlSefNIlV~~d----------------------g~~~vIDwPQ~v 250 (304)
T COG0478 220 RRGIVHGDLSEFNILVTED----------------------GDIVVIDWPQAV 250 (304)
T ss_pred HcCccccCCchheEEEecC----------------------CCEEEEeCcccc
Confidence 3567899999999999985 789999997554
No 366
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the
Probab=93.03 E-value=0.049 Score=41.77 Aligned_cols=17 Identities=35% Similarity=0.585 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+|+++.||++..+
T Consensus 127 ~ivH~dlkp~Nil~~~~ 143 (334)
T cd07855 127 NVIHRDLKPSNLLVNED 143 (334)
T ss_pred CeecCCCCHHHEEEcCC
Confidence 37999999999999874
No 367
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=92.96 E-value=0.07 Score=43.06 Aligned_cols=16 Identities=31% Similarity=0.530 Sum_probs=14.6
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
++|+||++.|||+...
T Consensus 258 ivH~dikp~Nill~~~ 273 (400)
T cd05105 258 CVHRDLAARNVLLAQG 273 (400)
T ss_pred eeCCCCChHhEEEeCC
Confidence 7999999999999874
No 368
>COG3281 Ble Uncharacterized protein, probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]
Probab=92.92 E-value=0.059 Score=44.85 Aligned_cols=42 Identities=26% Similarity=0.259 Sum_probs=31.4
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC---------CchhhhHHHHHHHh
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY---------NYRAFDIANHFVES 76 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~---------n~r~fDlanhf~E~ 76 (107)
=.|+|||.|.+|+.+ +..+|||||==.- --+--|+|-.+...
T Consensus 286 RvHGDLHLgQVLvt~-----------------------g~~~liDFEGEPsRpl~err~~~sPlrDvAgllRS~ 336 (438)
T COG3281 286 RVHGDLHLGQVLVTP-----------------------GRALLIDFEGEPSRPLDERRAPDSPLRDVAGLLRSF 336 (438)
T ss_pred HHhccceehheeeeC-----------------------CcEEEEecCCCCCCChhhccCCCCchHHHHHHHHHh
Confidence 369999999999998 7899999994322 22456777766654
No 369
>KOG0581|consensus
Probab=92.88 E-value=0.028 Score=46.25 Aligned_cols=43 Identities=26% Similarity=0.385 Sum_probs=33.0
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE 75 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E 75 (107)
..-+.|+|++|.|||++.+ +++.+=||--++.--.. +||.|.-
T Consensus 197 ~~~IIHRDIKPsNlLvNsk----------------------GeVKicDFGVS~~lvnS--~a~tfvG 239 (364)
T KOG0581|consen 197 ERKIIHRDIKPSNLLVNSK----------------------GEVKICDFGVSGILVNS--IANTFVG 239 (364)
T ss_pred ccCeeeccCCHHHeeeccC----------------------CCEEeccccccHHhhhh--hcccccc
Confidence 3568899999999999985 88999999877754444 5555543
No 370
>PLN00181 protein SPA1-RELATED; Provisional
Probab=92.79 E-value=0.089 Score=45.88 Aligned_cols=18 Identities=0% Similarity=0.021 Sum_probs=15.3
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..++|+||+|.|||+...
T Consensus 99 ~gIvHrDlKP~NiLl~~~ 116 (793)
T PLN00181 99 QGIVVHNVRPSCFVMSSF 116 (793)
T ss_pred CCeeeccCCchhEEEccc
Confidence 358999999999999763
No 371
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=92.68 E-value=0.054 Score=39.83 Aligned_cols=17 Identities=35% Similarity=0.505 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++..+
T Consensus 118 ~i~h~dl~p~ni~i~~~ 134 (274)
T cd06609 118 GKIHRDIKAANILLSEE 134 (274)
T ss_pred CcccCCCCHHHEEECCC
Confidence 37999999999999874
No 372
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=92.67 E-value=0.096 Score=38.99 Aligned_cols=16 Identities=31% Similarity=0.488 Sum_probs=14.3
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
-++|+||++.||++..
T Consensus 122 ~i~H~dl~p~nill~~ 137 (294)
T PLN00009 122 RVLHRDLKPQNLLIDR 137 (294)
T ss_pred CeeCCCCCcceEEEEC
Confidence 4799999999999975
No 373
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=92.61 E-value=0.078 Score=48.21 Aligned_cols=30 Identities=27% Similarity=0.414 Sum_probs=25.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
.++|+||+|.|||+... +.+.++||..|..
T Consensus 133 GIIHRDLKPeNILLd~d----------------------g~vKLiDFGLAk~ 162 (932)
T PRK13184 133 GVLHRDLKPDNILLGLF----------------------GEVVILDWGAAIF 162 (932)
T ss_pred CccccCCchheEEEcCC----------------------CCEEEEecCccee
Confidence 47999999999999874 6788999987653
No 374
>KOG1163|consensus
Probab=92.60 E-value=0.089 Score=42.28 Aligned_cols=33 Identities=27% Similarity=0.414 Sum_probs=25.6
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-.|.|+|++|.|+|+.-..- ..+|.+|||-.|-
T Consensus 130 r~fiHRDIKPdNFLMGlgrh-------------------~~kl~LIDFGLaK 162 (341)
T KOG1163|consen 130 RNFIHRDIKPDNFLMGLGRH-------------------CNKLYLIDFGLAK 162 (341)
T ss_pred hccccccCCccceeeccccc-------------------cceEEEEeccchh
Confidence 46899999999999865321 2689999996554
No 375
>KOG3087|consensus
Probab=92.47 E-value=0.15 Score=39.50 Aligned_cols=34 Identities=38% Similarity=0.579 Sum_probs=26.1
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
-+||+||...|||+.++... -..++|||--+..+
T Consensus 133 diiHGDLTTSNill~~~~~~-------------------~~~~lIdfgls~~s 166 (229)
T KOG3087|consen 133 DIIHGDLTTSNILLRSDGNQ-------------------ITPILIDFGLSSVS 166 (229)
T ss_pred CeecccccccceEEecCCCc-------------------CceEEEeecchhcc
Confidence 37999999999999885211 34599999877655
No 376
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=92.43 E-value=0.058 Score=41.21 Aligned_cols=17 Identities=35% Similarity=0.571 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+++||++...
T Consensus 139 ~i~H~dl~~~nill~~~ 155 (335)
T PTZ00024 139 YFMHRDLSPANIFINSK 155 (335)
T ss_pred CeecccccHHHeEECCC
Confidence 48999999999999764
No 377
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=92.37 E-value=0.083 Score=38.70 Aligned_cols=16 Identities=31% Similarity=0.617 Sum_probs=14.4
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||++.||++..
T Consensus 120 ~i~H~dl~p~ni~l~~ 135 (282)
T cd07831 120 GIFHRDIKPENILIKD 135 (282)
T ss_pred CceecccCHHHEEEcC
Confidence 4799999999999987
No 378
>KOG0588|consensus
Probab=92.35 E-value=0.062 Score=47.65 Aligned_cols=34 Identities=26% Similarity=0.510 Sum_probs=27.6
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
.-+||+||++.|+|+... ..+.+=||-.|..-..
T Consensus 131 ~~icHRDLKpENlLLd~~----------------------~nIKIADFGMAsLe~~ 164 (786)
T KOG0588|consen 131 FNICHRDLKPENLLLDVK----------------------NNIKIADFGMASLEVP 164 (786)
T ss_pred hcceeccCCchhhhhhcc----------------------cCEeeeccceeecccC
Confidence 458999999999999885 5699999977765444
No 379
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=92.18 E-value=0.1 Score=38.54 Aligned_cols=17 Identities=24% Similarity=0.405 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+...
T Consensus 125 ~ivH~dlkp~Nill~~~ 141 (262)
T cd05077 125 DLVHGNVCTKNILLARE 141 (262)
T ss_pred CeECCCCCcccEEEecC
Confidence 47999999999999753
No 380
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=92.16 E-value=0.1 Score=42.18 Aligned_cols=17 Identities=35% Similarity=0.501 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 259 ~ivHrdlkp~NiLl~~~ 275 (401)
T cd05107 259 NCVHRDLAARNVLICEG 275 (401)
T ss_pred CcCcccCCcceEEEeCC
Confidence 36999999999999874
No 381
>KOG0599|consensus
Probab=92.08 E-value=0.073 Score=43.48 Aligned_cols=39 Identities=21% Similarity=0.386 Sum_probs=33.0
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH 72 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh 72 (107)
+.|+||++.|||+.+. -.+++=||-+|.--.+|=-|-+.
T Consensus 144 IVHRDLKpENILlddn----------------------~~i~isDFGFa~~l~~GekLrel 182 (411)
T KOG0599|consen 144 IVHRDLKPENILLDDN----------------------MNIKISDFGFACQLEPGEKLREL 182 (411)
T ss_pred hhhcccChhheeeccc----------------------cceEEeccceeeccCCchhHHHh
Confidence 5799999999999884 67999999999988887766543
No 382
>KOG0596|consensus
Probab=92.07 E-value=0.11 Score=45.37 Aligned_cols=29 Identities=31% Similarity=0.437 Sum_probs=24.9
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-.+.|.||+|.|+|+-. +.|.||||--|.
T Consensus 479 ~gIVHSDLKPANFLlVk-----------------------G~LKLIDFGIA~ 507 (677)
T KOG0596|consen 479 HGIVHSDLKPANFLLVK-----------------------GRLKLIDFGIAN 507 (677)
T ss_pred hceeecCCCcccEEEEe-----------------------eeEEeeeechhc
Confidence 35789999999999988 789999996554
No 383
>KOG0592|consensus
Probab=92.02 E-value=0.1 Score=45.24 Aligned_cols=18 Identities=33% Similarity=0.464 Sum_probs=16.0
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..+.|+||+|.|||++.+
T Consensus 193 ~GIIHRDlKPENILLd~d 210 (604)
T KOG0592|consen 193 NGIIHRDLKPENILLDKD 210 (604)
T ss_pred cCceeccCChhheeEcCC
Confidence 467899999999999985
No 384
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the
Probab=91.93 E-value=0.11 Score=37.96 Aligned_cols=16 Identities=38% Similarity=0.559 Sum_probs=14.5
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
++|+|+++.||++...
T Consensus 119 i~H~~l~~~ni~~~~~ 134 (282)
T cd07829 119 ILHRDLKPQNILINRD 134 (282)
T ss_pred cccCCCChheEEEcCC
Confidence 6899999999999874
No 385
>KOG0593|consensus
Probab=91.87 E-value=0.097 Score=43.05 Aligned_cols=28 Identities=25% Similarity=0.421 Sum_probs=23.6
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
+.|+|++|.|||++.. +.+.+-||-+|.
T Consensus 122 ~IHRDIKPENILit~~----------------------gvvKLCDFGFAR 149 (396)
T KOG0593|consen 122 CIHRDIKPENILITQN----------------------GVVKLCDFGFAR 149 (396)
T ss_pred eecccCChhheEEecC----------------------CcEEeccchhhH
Confidence 5689999999999985 778888887654
No 386
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=91.81 E-value=0.073 Score=38.36 Aligned_cols=17 Identities=24% Similarity=0.507 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.||++.+.
T Consensus 121 ~i~H~dl~~~nil~~~~ 137 (257)
T cd08225 121 KILHRDIKSQNIFLSKN 137 (257)
T ss_pred CcccccCCHHHEEEcCC
Confidence 48999999999999763
No 387
>KOG1166|consensus
Probab=91.73 E-value=0.18 Score=46.16 Aligned_cols=36 Identities=25% Similarity=0.435 Sum_probs=26.6
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
..+.|+||+|.|+|++....+.. +...|.||||-+|
T Consensus 813 ~~IIHgDiKPDNfll~~~~~~~~---------------~~~~l~lIDfG~s 848 (974)
T KOG1166|consen 813 MGIIHGDIKPDNFLLRREICADS---------------DSKGLYLIDFGRS 848 (974)
T ss_pred cceecccCCcceeEeecccCCCC---------------cccceEEEecccc
Confidence 45889999999999987643321 1278999999543
No 388
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their
Probab=91.62 E-value=0.1 Score=37.97 Aligned_cols=16 Identities=25% Similarity=0.495 Sum_probs=14.2
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||++.||++..
T Consensus 123 ~i~H~~i~~~nil~~~ 138 (268)
T cd06630 123 QIIHRDVKGANLLIDS 138 (268)
T ss_pred CeecCCCCHHHEEEcC
Confidence 5799999999999965
No 389
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=91.51 E-value=0.098 Score=38.04 Aligned_cols=16 Identities=31% Similarity=0.586 Sum_probs=14.4
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+||.+.||++..
T Consensus 126 ~i~h~~l~~~nili~~ 141 (260)
T cd08222 126 RILHRDLKAKNIFLKN 141 (260)
T ss_pred CccccCCChhheEeec
Confidence 5799999999999975
No 390
>KOG1164|consensus
Probab=91.39 E-value=0.11 Score=40.40 Aligned_cols=36 Identities=22% Similarity=0.395 Sum_probs=26.6
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
...|.|+|++|+|+++...... +...+.+|||-.|.
T Consensus 140 ~~G~iHRDiKp~N~~~g~~~~~-----------------~~~~~~llDfGlar 175 (322)
T KOG1164|consen 140 SKGFIHRDIKPENFVVGQSSRS-----------------EVRTLYLLDFGLAR 175 (322)
T ss_pred hcCcccCCcCHHHeeecCCCCc-----------------ccceEEEEecCCCc
Confidence 4579999999999999874211 11569999996554
No 391
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with
Probab=91.32 E-value=0.1 Score=37.52 Aligned_cols=16 Identities=38% Similarity=0.549 Sum_probs=14.4
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+|++++||++.+
T Consensus 121 ~i~h~dl~~~nil~~~ 136 (256)
T cd08220 121 LILHRDLKTQNILLDK 136 (256)
T ss_pred CeecCCCCHHHEEEcC
Confidence 5799999999999975
No 392
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=91.21 E-value=0.14 Score=37.78 Aligned_cols=17 Identities=18% Similarity=0.415 Sum_probs=14.7
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+|+++.|||+..+
T Consensus 127 ~iiH~dikp~nili~~~ 143 (266)
T cd05064 127 GYVHKGLAAHKVLVNSD 143 (266)
T ss_pred CEeeccccHhhEEEcCC
Confidence 47899999999999764
No 393
>KOG1035|consensus
Probab=91.00 E-value=0.14 Score=48.02 Aligned_cols=30 Identities=23% Similarity=0.332 Sum_probs=25.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
++.|+||+|.||+++.+ ++|.+.||--|.-
T Consensus 717 giIHRDLKP~NIFLd~~----------------------~~VKIGDFGLAt~ 746 (1351)
T KOG1035|consen 717 GIIHRDLKPRNIFLDSR----------------------NSVKIGDFGLATD 746 (1351)
T ss_pred ceeeccCCcceeEEcCC----------------------CCeeecccccchh
Confidence 48999999999999975 7789999866653
No 394
>KOG0660|consensus
Probab=90.88 E-value=0.12 Score=42.56 Aligned_cols=33 Identities=30% Similarity=0.491 Sum_probs=26.7
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY 64 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 64 (107)
-...|+||+|+|||++.+ -.+++-||-+|..-.
T Consensus 144 AnViHRDLKPsNll~n~~----------------------c~lKI~DFGLAR~~~ 176 (359)
T KOG0660|consen 144 ANVIHRDLKPSNLLLNAD----------------------CDLKICDFGLARYLD 176 (359)
T ss_pred ccccccccchhheeeccC----------------------CCEEeccccceeecc
Confidence 456799999999999985 668888888777653
No 395
>KOG0668|consensus
Probab=90.86 E-value=0.11 Score=41.56 Aligned_cols=37 Identities=16% Similarity=0.292 Sum_probs=27.2
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhh
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFD 68 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fD 68 (107)
.+.|+|++|.|+|++.. .++|.+|||-.|-+..++-+
T Consensus 152 GImHRDVKPhNvmIdh~---------------------~rkLrlIDWGLAEFYHp~~e 188 (338)
T KOG0668|consen 152 GIMHRDVKPHNVMIDHE---------------------LRKLRLIDWGLAEFYHPGKE 188 (338)
T ss_pred CcccccCCcceeeechh---------------------hceeeeeecchHhhcCCCce
Confidence 46799999999999874 16788888876665554433
No 396
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=90.84 E-value=0.13 Score=37.99 Aligned_cols=17 Identities=41% Similarity=0.618 Sum_probs=14.7
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.||++...
T Consensus 123 ~i~h~dl~p~nili~~~ 139 (280)
T cd06611 123 KVIHRDLKAGNILLTLD 139 (280)
T ss_pred CcccCCCChhhEEECCC
Confidence 46899999999999764
No 397
>KOG0616|consensus
Probab=90.57 E-value=0.18 Score=41.15 Aligned_cols=29 Identities=21% Similarity=0.414 Sum_probs=24.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-+..+||+|.|||++.. +-+.++||-+|-
T Consensus 164 ~iiYRDLKPENiLlD~~----------------------G~iKitDFGFAK 192 (355)
T KOG0616|consen 164 DIIYRDLKPENLLLDQN----------------------GHIKITDFGFAK 192 (355)
T ss_pred CeeeccCChHHeeeccC----------------------CcEEEEeccceE
Confidence 36789999999999985 889999997764
No 398
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=90.48 E-value=0.14 Score=38.03 Aligned_cols=17 Identities=29% Similarity=0.512 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.||++.++
T Consensus 124 ~i~H~dl~p~nil~~~~ 140 (284)
T cd06620 124 RIMHRDIKPSNILVNSR 140 (284)
T ss_pred CeeccCCCHHHEEECCC
Confidence 48999999999999774
No 399
>PRK14705 glycogen branching enzyme; Provisional
Probab=90.42 E-value=0.21 Score=46.75 Aligned_cols=35 Identities=26% Similarity=0.360 Sum_probs=25.6
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeec
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEY 59 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY 59 (107)
.+..=||+|+|.|.+|+..+-.++ ....+|||||=
T Consensus 329 ~~~~RIHGD~HLGQVL~t~~D~~~-----------------~~~~~IIDFEG 363 (1224)
T PRK14705 329 GQLQRIHGDLHLGQILQVPGAEGQ-----------------PERWAILDFEG 363 (1224)
T ss_pred cceEEEecccccccEEEecCCCCc-----------------cCCEEEEecCC
Confidence 356779999999999987531000 15699999984
No 400
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=90.13 E-value=0.13 Score=43.36 Aligned_cols=45 Identities=27% Similarity=0.349 Sum_probs=37.2
Q ss_pred ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHH
Q psy15665 4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIAN 71 (107)
Q Consensus 4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlan 71 (107)
.-.....-|-|++|.-+|||+++ +.+.+|||-.|..++.+=+|.+
T Consensus 335 ~~lekkf~fehrnlt~~niLId~-----------------------GnvtLIDfklsRl~~~q~~isy 379 (488)
T COG5072 335 DILEKKFPFEHRNLTLDNILIDE-----------------------GNVTLIDFKLSRLSYSQGIISY 379 (488)
T ss_pred hhhhhcCCcccccccccceeeec-----------------------CceEEEEeeeeecccCCceeec
Confidence 33445677899999999999996 8899999999998888766654
No 401
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity
Probab=89.86 E-value=0.25 Score=36.15 Aligned_cols=17 Identities=18% Similarity=0.323 Sum_probs=15.2
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+..+
T Consensus 120 ~iiH~dlkp~nili~~~ 136 (258)
T cd05078 120 GLTHGNVCAKNVLLIRE 136 (258)
T ss_pred CeecCCCccceEEEecc
Confidence 47999999999999874
No 402
>KOG0659|consensus
Probab=89.70 E-value=0.21 Score=40.27 Aligned_cols=29 Identities=28% Similarity=0.502 Sum_probs=24.1
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
+-|+||+|.|+|+..+ +.|.+=||--|..
T Consensus 122 IlHRDlKPnNLLis~~----------------------g~lKiADFGLAr~ 150 (318)
T KOG0659|consen 122 ILHRDLKPNNLLISSD----------------------GQLKIADFGLARF 150 (318)
T ss_pred hhcccCCccceEEcCC----------------------CcEEeecccchhc
Confidence 5699999999999985 7888888876643
No 403
>KOG0615|consensus
Probab=89.61 E-value=0.19 Score=42.45 Aligned_cols=18 Identities=28% Similarity=0.451 Sum_probs=16.0
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..+||+||+|.|||+..+
T Consensus 295 ~GI~HRDiKPeNILl~~~ 312 (475)
T KOG0615|consen 295 QGIIHRDIKPENILLSND 312 (475)
T ss_pred cCcccccCCcceEEeccC
Confidence 468999999999999875
No 404
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=89.57 E-value=0.13 Score=39.66 Aligned_cols=16 Identities=25% Similarity=0.501 Sum_probs=14.3
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.++|+|+++.||++..
T Consensus 134 givH~dikp~Nili~~ 149 (342)
T cd07854 134 NVLHRDLKPANVFINT 149 (342)
T ss_pred CcccCCCCHHHEEEcC
Confidence 4899999999999974
No 405
>KOG0032|consensus
Probab=89.45 E-value=0.22 Score=40.73 Aligned_cols=38 Identities=21% Similarity=0.358 Sum_probs=29.4
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
..++|+||+|.|||+....... ..+.++||--|.+..+
T Consensus 154 ~gvvHrDlKpEN~L~~~~~~~~------------------~~ik~~DFGla~~~~~ 191 (382)
T KOG0032|consen 154 LGVVHRDLKPENLLLASKDEGS------------------GRIKLIDFGLAKFIKP 191 (382)
T ss_pred CCceeccCCHHHeeeccccCCC------------------CcEEEeeCCCceEccC
Confidence 5689999999999998752221 5799999987776554
No 406
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=89.26 E-value=0.29 Score=37.39 Aligned_cols=17 Identities=18% Similarity=0.421 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+||++.|||+...
T Consensus 121 ~iiH~dlkp~Nil~~~~ 137 (327)
T cd08227 121 GYVHRSVKASHILISVD 137 (327)
T ss_pred CEecCCCChhhEEEecC
Confidence 47899999999999764
No 407
>KOG0595|consensus
Probab=89.24 E-value=0.38 Score=40.39 Aligned_cols=41 Identities=24% Similarity=0.400 Sum_probs=29.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhh
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAF 67 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~f 67 (107)
-+.|+||+|.|||+.......+ ...+.|=||-+|.+-..+-
T Consensus 129 ~IiHRDLKPQNiLLs~~~~~~~----------------~~~LKIADFGfAR~L~~~~ 169 (429)
T KOG0595|consen 129 NIIHRDLKPQNILLSTTARNDT----------------SPVLKIADFGFARFLQPGS 169 (429)
T ss_pred CeeeccCCcceEEeccCCCCCC----------------CceEEecccchhhhCCchh
Confidence 4789999999999988522211 0468899999888765443
No 408
>KOG0598|consensus
Probab=89.14 E-value=0.15 Score=41.99 Aligned_cols=18 Identities=33% Similarity=0.361 Sum_probs=15.7
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
.-+.|+||+|.|||++.+
T Consensus 144 ~gIiyRDlKPENILLd~~ 161 (357)
T KOG0598|consen 144 KGIIYRDLKPENILLDEQ 161 (357)
T ss_pred CCeeeccCCHHHeeecCC
Confidence 347899999999999986
No 409
>PHA02988 hypothetical protein; Provisional
Probab=89.13 E-value=0.21 Score=37.57 Aligned_cols=15 Identities=20% Similarity=0.173 Sum_probs=13.4
Q ss_pred EecccCCCceeeecC
Q psy15665 13 CHNDLQEGNILYRES 27 (107)
Q Consensus 13 cHnDl~~gNiL~~~~ 27 (107)
.|+||++.|||+..+
T Consensus 145 ~Hrdlkp~nill~~~ 159 (283)
T PHA02988 145 PYKNLTSVSFLVTEN 159 (283)
T ss_pred CCCcCChhhEEECCC
Confidence 399999999999874
No 410
>COG2187 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=88.92 E-value=0.28 Score=39.91 Aligned_cols=20 Identities=30% Similarity=0.471 Sum_probs=17.5
Q ss_pred CCCeEEEecccCCCceeeec
Q psy15665 7 KSPVTFCHNDLQEGNILYRE 26 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~ 26 (107)
..-+.=||+||+.+||.+-+
T Consensus 206 ~g~IRecHGDLhl~ni~l~d 225 (337)
T COG2187 206 EGFIRECHGDLHLRNICLWD 225 (337)
T ss_pred cCCceecccchhhcceeeec
Confidence 34578899999999999988
No 411
>KOG0578|consensus
Probab=88.89 E-value=0.35 Score=41.77 Aligned_cols=31 Identities=26% Similarity=0.503 Sum_probs=27.1
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
..+.|+|++..|||+..+ +.+.+.||-+|+.
T Consensus 388 ~gIiHrDIKSDnILL~~~----------------------g~vKltDFGFcaq 418 (550)
T KOG0578|consen 388 RGIIHRDIKSDNILLTMD----------------------GSVKLTDFGFCAQ 418 (550)
T ss_pred cceeeeccccceeEeccC----------------------CcEEEeeeeeeec
Confidence 357899999999999886 7899999998864
No 412
>KOG0605|consensus
Probab=88.77 E-value=0.19 Score=43.35 Aligned_cols=32 Identities=19% Similarity=0.401 Sum_probs=27.6
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
+...+.|+||+|.|+|++.. +.|.|=||-.|.
T Consensus 258 H~~gyIHRDIKPdNlLiD~~----------------------GHiKLSDFGLs~ 289 (550)
T KOG0605|consen 258 HQLGYIHRDIKPDNLLIDAK----------------------GHIKLSDFGLST 289 (550)
T ss_pred HHcCcccccCChhheeecCC----------------------CCEeeccccccc
Confidence 34678999999999999985 889999998773
No 413
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=88.70 E-value=0.25 Score=37.71 Aligned_cols=17 Identities=18% Similarity=0.473 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||++.|||+..+
T Consensus 121 ~ivHrDlkp~Nill~~~ 137 (328)
T cd08226 121 GYIHRNIKASHILISGD 137 (328)
T ss_pred CeecCCCCHHHEEEeCC
Confidence 47999999999999864
No 414
>COG3231 Aph Aminoglycoside phosphotransferase [Translation, ribosomal structure and biogenesis]
Probab=88.68 E-value=0.52 Score=37.30 Aligned_cols=44 Identities=18% Similarity=0.025 Sum_probs=37.6
Q ss_pred CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHH
Q psy15665 8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHF 73 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf 73 (107)
..+|+||+|--.-|+|+.+. +---+||+.-+|...|--||+--.
T Consensus 183 edLVv~HGDACLPN~i~d~~----------------------rf~GfIDlGrlGVaDRh~DLala~ 226 (266)
T COG3231 183 EDLVVTHGDACLPNFILDGW----------------------RFSGFIDLGRLGVADRHQDLALAT 226 (266)
T ss_pred hhceeecCcccCcceEecCC----------------------ceEEeeecCcccchHHHHhHHHHH
Confidence 45899999999999999874 445699999999999999997543
No 415
>KOG0198|consensus
Probab=88.68 E-value=0.33 Score=39.03 Aligned_cols=16 Identities=31% Similarity=0.503 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeec
Q psy15665 11 TFCHNDLQEGNILYRE 26 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~ 26 (107)
.+.|+||++.|||+..
T Consensus 137 g~vH~DiK~~NiLl~~ 152 (313)
T KOG0198|consen 137 GIVHCDIKPANILLDP 152 (313)
T ss_pred CEeccCcccceEEEeC
Confidence 5889999999999988
No 416
>KOG0665|consensus
Probab=88.54 E-value=0.27 Score=40.49 Aligned_cols=32 Identities=25% Similarity=0.434 Sum_probs=26.0
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
...+.|+||+|.||++..+ .-+.+.||-||--
T Consensus 136 s~~IihRdLkPsnivv~~~----------------------~~lKi~dfg~ar~ 167 (369)
T KOG0665|consen 136 SAGIIHRDLKPSNIVVNSD----------------------CTLKILDFGLART 167 (369)
T ss_pred hcceeecccCcccceecch----------------------hheeeccchhhcc
Confidence 4568999999999999985 5688888877753
No 417
>KOG0582|consensus
Probab=88.52 E-value=0.31 Score=41.60 Aligned_cols=17 Identities=35% Similarity=0.591 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.-.|+|++.||||+..+
T Consensus 146 G~IHRdvKAgnILi~~d 162 (516)
T KOG0582|consen 146 GHIHRDVKAGNILIDSD 162 (516)
T ss_pred CceecccccccEEEcCC
Confidence 35799999999999986
No 418
>KOG1187|consensus
Probab=87.78 E-value=0.34 Score=39.12 Aligned_cols=19 Identities=32% Similarity=0.455 Sum_probs=16.4
Q ss_pred eEEEecccCCCceeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESP 28 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~ 28 (107)
..+.|+|+++.|||++.+.
T Consensus 196 ~~iiHrDiKssNILLD~~~ 214 (361)
T KOG1187|consen 196 PPIIHRDIKSSNILLDEDF 214 (361)
T ss_pred CCEecCCCCHHHeeECCCC
Confidence 3688999999999999763
No 419
>KOG0579|consensus
Probab=87.73 E-value=0.32 Score=43.86 Aligned_cols=17 Identities=41% Similarity=0.643 Sum_probs=14.9
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+.|+||+.||||+.-+
T Consensus 150 ~iIHRDLKAGNiL~Tld 166 (1187)
T KOG0579|consen 150 NIIHRDLKAGNILLTLD 166 (1187)
T ss_pred chhhhhccccceEEEec
Confidence 36799999999999875
No 420
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]
Probab=87.55 E-value=0.36 Score=38.34 Aligned_cols=27 Identities=33% Similarity=0.439 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-+.|+||.+=|||+.+ +.+++|||--|
T Consensus 187 ~LVHgDLSEyNiL~~~-----------------------~~p~iID~~Qa 213 (268)
T COG1718 187 GLVHGDLSEYNILVHD-----------------------GEPYIIDVSQA 213 (268)
T ss_pred CcccccchhhheEEEC-----------------------CeEEEEECccc
Confidence 4789999999999996 77999999644
No 421
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=87.35 E-value=0.47 Score=35.31 Aligned_cols=17 Identities=24% Similarity=0.372 Sum_probs=14.6
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-++|+||++.|||+...
T Consensus 137 ~iiH~dlkp~Nill~~~ 153 (274)
T cd05076 137 NLVHGNVCAKNILLARL 153 (274)
T ss_pred CccCCCCCcccEEEecc
Confidence 46899999999999753
No 422
>KOG1167|consensus
Probab=87.01 E-value=0.38 Score=40.32 Aligned_cols=32 Identities=25% Similarity=0.434 Sum_probs=25.6
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
..+.|+|++|+|+|+.... ++-+||||--|-.
T Consensus 151 ~GIvHRDiKpsNFL~n~~t---------------------~rg~LvDFgLA~~ 182 (418)
T KOG1167|consen 151 NGIVHRDIKPSNFLYNRRT---------------------QRGVLVDFGLAQR 182 (418)
T ss_pred cCccccCCCcccccccccc---------------------CCceEEechhHHH
Confidence 4578999999999998741 5678999977663
No 423
>KOG0586|consensus
Probab=86.48 E-value=0.35 Score=42.13 Aligned_cols=31 Identities=29% Similarity=0.670 Sum_probs=26.1
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
-.+||+||+..|||+... -.+.+=||+++..
T Consensus 174 k~ivHrdLk~eNilL~~~----------------------mnikIaDfgfS~~ 204 (596)
T KOG0586|consen 174 KNIVHRDLKAENILLDEN----------------------MNIKIADFGFSTF 204 (596)
T ss_pred cceeccccchhhcccccc----------------------cceeeecccccee
Confidence 358999999999999984 4588999988764
No 424
>KOG0604|consensus
Probab=86.28 E-value=0.37 Score=39.73 Aligned_cols=36 Identities=28% Similarity=0.512 Sum_probs=26.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
-+.|+||++.|+|+.....+ -.+.|=||-+|.--.+
T Consensus 181 nIAHRDlKpENLLyt~t~~n-------------------a~lKLtDfGFAK~t~~ 216 (400)
T KOG0604|consen 181 NIAHRDLKPENLLYTTTSPN-------------------APLKLTDFGFAKETQE 216 (400)
T ss_pred chhhccCChhheeeecCCCC-------------------cceEecccccccccCC
Confidence 46899999999999875322 4588888877765443
No 425
>KOG0577|consensus
Probab=86.25 E-value=0.32 Score=43.37 Aligned_cols=33 Identities=30% Similarity=0.325 Sum_probs=26.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
...|+|++.||||+.+. +.|.|-||--|+.--+
T Consensus 146 ~~IHRDiKAGNILLse~----------------------g~VKLaDFGSAsi~~P 178 (948)
T KOG0577|consen 146 NRIHRDIKAGNILLSEP----------------------GLVKLADFGSASIMAP 178 (948)
T ss_pred hHHhhhccccceEecCC----------------------CeeeeccccchhhcCc
Confidence 35799999999999985 7788888877665433
No 426
>KOG2268|consensus
Probab=85.59 E-value=0.61 Score=39.14 Aligned_cols=27 Identities=37% Similarity=0.583 Sum_probs=23.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeec
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEY 59 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY 59 (107)
.+.|+|...-|||+.++ ..+++|||--
T Consensus 222 GlIHgDFNEFNimv~dd----------------------~~i~vIDFPQ 248 (465)
T KOG2268|consen 222 GLIHGDFNEFNIMVKDD----------------------DKIVVIDFPQ 248 (465)
T ss_pred CceecccchheeEEecC----------------------CCEEEeechH
Confidence 47899999999999974 7799999963
No 427
>KOG4236|consensus
Probab=85.47 E-value=0.61 Score=41.24 Aligned_cols=33 Identities=21% Similarity=0.383 Sum_probs=26.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
-+.|+||+|.|||+... .+-.++.|-||-||..
T Consensus 684 nIvHCDLKPENVLLas~-------------------~~FPQvKlCDFGfARi 716 (888)
T KOG4236|consen 684 NIVHCDLKPENVLLASA-------------------SPFPQVKLCDFGFARI 716 (888)
T ss_pred ceeeccCCchheeeccC-------------------CCCCceeeccccceee
Confidence 46799999999998763 2227899999998864
No 428
>KOG1151|consensus
Probab=85.08 E-value=0.8 Score=39.81 Aligned_cols=30 Identities=30% Similarity=0.475 Sum_probs=23.5
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
+.|-||+|||||+-++... +.+.+-||-.+
T Consensus 591 IIHYDLKPgNILLv~Gtac-------------------GeIKITDFGLS 620 (775)
T KOG1151|consen 591 IIHYDLKPGNILLVNGTAC-------------------GEIKITDFGLS 620 (775)
T ss_pred eeeeccCCccEEEecCccc-------------------ceeEeeecchh
Confidence 5699999999999875322 77888888654
No 429
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=84.91 E-value=0.53 Score=32.93 Aligned_cols=28 Identities=29% Similarity=0.433 Sum_probs=23.6
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCC-CeEEEeeecCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNI-DLVVIDFEYCS 61 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa~ 61 (107)
++|+|++|.|||+... . .+.++||-.+.
T Consensus 122 ~~hrd~kp~nil~~~~----------------------~~~~~l~dfg~~~ 150 (384)
T COG0515 122 IIHRDIKPENILLDRD----------------------GRVVKLIDFGLAK 150 (384)
T ss_pred eeccCCCHHHeeecCC----------------------CCeEEEeccCcce
Confidence 8999999999999874 3 57888887766
No 430
>KOG0663|consensus
Probab=84.23 E-value=0.71 Score=38.47 Aligned_cols=18 Identities=28% Similarity=0.399 Sum_probs=15.6
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
.-+.|+||++.|+|+..+
T Consensus 196 ~wilHRDLK~SNLLm~~~ 213 (419)
T KOG0663|consen 196 NWILHRDLKTSNLLLSHK 213 (419)
T ss_pred ceeEecccchhheeeccC
Confidence 357899999999999885
No 431
>KOG0607|consensus
Probab=84.21 E-value=0.79 Score=38.26 Aligned_cols=32 Identities=28% Similarity=0.416 Sum_probs=23.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+.|+||+|.|||-..... -.++.+-||+.++
T Consensus 196 gIAHRDlKPENiLC~~pn~-------------------vsPvKiCDfDLgS 227 (463)
T KOG0607|consen 196 GIAHRDLKPENILCESPNK-------------------VSPVKICDFDLGS 227 (463)
T ss_pred CcccccCCccceeecCCCC-------------------cCceeeecccccc
Confidence 4889999999999766311 1568888887654
No 432
>KOG0192|consensus
Probab=83.58 E-value=0.82 Score=37.22 Aligned_cols=16 Identities=38% Similarity=0.509 Sum_probs=15.1
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
+.|+||++.|||+...
T Consensus 164 iIHrDLK~~NiLv~~~ 179 (362)
T KOG0192|consen 164 IIHRDLKSDNILVDLK 179 (362)
T ss_pred eeecccChhhEEEcCC
Confidence 8999999999999985
No 433
>KOG0661|consensus
Probab=83.47 E-value=0.6 Score=40.15 Aligned_cols=17 Identities=41% Similarity=0.557 Sum_probs=15.1
Q ss_pred eEEEecccCCCceeeec
Q psy15665 10 VTFCHNDLQEGNILYRE 26 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~ 26 (107)
-.|-|+|++|.|||+..
T Consensus 129 ~GfFHRDlKPENiLi~~ 145 (538)
T KOG0661|consen 129 HGFFHRDLKPENILISG 145 (538)
T ss_pred cCcccccCChhheEecc
Confidence 45889999999999995
No 434
>KOG0666|consensus
Probab=83.47 E-value=0.97 Score=37.57 Aligned_cols=16 Identities=38% Similarity=0.497 Sum_probs=14.3
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
+.|+||+|.|||+..+
T Consensus 153 vlHRDLKPaNIlvmgd 168 (438)
T KOG0666|consen 153 VLHRDLKPANILVMGD 168 (438)
T ss_pred eeeccCCcceEEEecc
Confidence 5699999999999875
No 435
>KOG0600|consensus
Probab=83.34 E-value=0.87 Score=39.38 Aligned_cols=29 Identities=28% Similarity=0.385 Sum_probs=24.5
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.+-|+|++..|||++.. +.|.|=||-.|.
T Consensus 238 gvlHRDIK~SNiLidn~----------------------G~LKiaDFGLAr 266 (560)
T KOG0600|consen 238 GVLHRDIKGSNILIDNN----------------------GVLKIADFGLAR 266 (560)
T ss_pred CeeeccccccceEEcCC----------------------CCEEecccccee
Confidence 46799999999999985 778888887666
No 436
>KOG0671|consensus
Probab=83.20 E-value=1.2 Score=37.36 Aligned_cols=48 Identities=25% Similarity=0.306 Sum_probs=28.0
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCC-CCCCCCCCCCeEEEeeecC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNN-NNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~lIDfEYa 60 (107)
+-+.|-||+|.|||+-++--.++ .+.-+. ......+...+.||||-=|
T Consensus 211 ~kl~HTDLKPENILfvss~~~~~---~~~k~~~~~~r~~ks~~I~vIDFGsA 259 (415)
T KOG0671|consen 211 LKLTHTDLKPENILFVSSEYFKT---YNPKKKVCFIRPLKSTAIKVIDFGSA 259 (415)
T ss_pred cceeecCCChheEEEeccceEEE---eccCCccceeccCCCcceEEEecCCc
Confidence 56889999999999987511110 000010 1123334467999999544
No 437
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=83.12 E-value=0.8 Score=36.53 Aligned_cols=64 Identities=27% Similarity=0.347 Sum_probs=42.7
Q ss_pred cccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCC
Q psy15665 3 LLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY 82 (107)
Q Consensus 3 l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~ 82 (107)
|++....--+.|+||+.||.+...+ + -+++|= =|-++.|.+|||.. |+- .
T Consensus 180 L~~hqpqPsLlHGDLW~gN~a~~~~----------------------G-Pv~fDP-A~y~GDrE~Dlam~--elF----g 229 (286)
T COG3001 180 LADHQPQPSLLHGDLWSGNCAFGKD----------------------G-PVIFDP-ACYWGDRECDLAML--ELF----G 229 (286)
T ss_pred HhcCCCCcceeecccccccccccCC----------------------C-Ceeecc-ccccCCcccceehh--hhh----c
Confidence 4555666789999999999998873 4 567674 34568999999863 331 1
Q ss_pred CCCC--ceeecCCCCCC
Q psy15665 83 KHFP--HYTVKRENYPS 97 (107)
Q Consensus 83 ~~~p--~~~~~~~~~Pt 97 (107)
. +| +|+-|.+-+|-
T Consensus 230 g-fp~efy~gY~sv~PL 245 (286)
T COG3001 230 G-FPPEFYDGYQSVSPL 245 (286)
T ss_pred C-CcHHHHHhhhccCCC
Confidence 2 22 45555565553
No 438
>KOG0585|consensus
Probab=82.75 E-value=0.86 Score=39.38 Aligned_cols=17 Identities=24% Similarity=0.493 Sum_probs=15.1
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+|++|.|+|+...
T Consensus 230 giiHRDIKPsNLLl~~~ 246 (576)
T KOG0585|consen 230 GIIHRDIKPSNLLLSSD 246 (576)
T ss_pred CeeccccchhheEEcCC
Confidence 36899999999999985
No 439
>KOG0612|consensus
Probab=81.98 E-value=0.81 Score=42.97 Aligned_cols=20 Identities=25% Similarity=0.579 Sum_probs=17.2
Q ss_pred CCeEEEecccCCCceeeecC
Q psy15665 8 SPVTFCHNDLQEGNILYRES 27 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~ 27 (107)
+.+.+.|+|++|.|||++..
T Consensus 192 H~mgyVHRDiKPDNvLld~~ 211 (1317)
T KOG0612|consen 192 HSMGYVHRDIKPDNVLLDKS 211 (1317)
T ss_pred HhccceeccCCcceeEeccc
Confidence 35678999999999999875
No 440
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=81.80 E-value=0.79 Score=42.31 Aligned_cols=17 Identities=29% Similarity=0.458 Sum_probs=14.8
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.++|+||+|.|||+..+
T Consensus 145 ~IVHRDLKPeNILL~s~ 161 (1021)
T PTZ00266 145 RVLHRDLKPQNIFLSTG 161 (1021)
T ss_pred CceeccCcHHHeEeecC
Confidence 38999999999999763
No 441
>KOG0664|consensus
Probab=81.61 E-value=0.93 Score=37.25 Aligned_cols=17 Identities=29% Similarity=0.634 Sum_probs=14.7
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
-+-|+|++|||+|++..
T Consensus 176 ~ILHRDIKPGNLLVNSN 192 (449)
T KOG0664|consen 176 NILHRDIKPGNLLVNSN 192 (449)
T ss_pred chhhccCCCccEEeccC
Confidence 46799999999999873
No 442
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain; InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []: Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction []. Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases []. ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=81.32 E-value=1 Score=33.17 Aligned_cols=16 Identities=31% Similarity=0.526 Sum_probs=13.8
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
++|++|.+.||++...
T Consensus 124 iiH~~l~~~nill~~~ 139 (259)
T PF07714_consen 124 IIHGNLSPSNILLDSN 139 (259)
T ss_dssp EEEST-SGGGEEEETT
T ss_pred cccccccccccccccc
Confidence 7999999999999975
No 443
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the
Probab=81.21 E-value=1.3 Score=33.17 Aligned_cols=31 Identities=23% Similarity=0.205 Sum_probs=24.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
++.=+|-+++|||++.. + +.++-|||.++--
T Consensus 129 ilglgDRh~~NIli~~~----~-----------------G~~~hIDfg~~~~ 159 (219)
T cd00142 129 ILGIGDRHPDNIMIDLD----T-----------------GKLFHIDFGFIFG 159 (219)
T ss_pred HhccCCCCCccEEEECC----C-----------------CeEEEEeeHHhhC
Confidence 45558999999999972 1 8899999987643
No 444
>KOG1027|consensus
Probab=81.01 E-value=0.83 Score=41.50 Aligned_cols=18 Identities=33% Similarity=0.506 Sum_probs=16.0
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
+-+.|+||+|.|||+..+
T Consensus 625 l~iVHRDLkPQNILI~~~ 642 (903)
T KOG1027|consen 625 LKIVHRDLKPQNILISVP 642 (903)
T ss_pred cccccccCCCceEEEEcc
Confidence 678999999999999874
No 445
>KOG0907|consensus
Probab=80.69 E-value=3.9 Score=27.70 Aligned_cols=45 Identities=24% Similarity=0.309 Sum_probs=36.7
Q ss_pred CCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCCceeecCCCCCC
Q psy15665 50 IDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPS 97 (107)
Q Consensus 50 ~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p~~~~~~~~~Pt 97 (107)
+++++||| ||.+..++-=|+-.|++..-.|.... +++++-+..+.
T Consensus 21 ~kliVvdF-~a~wCgPCk~i~P~~~~La~~y~~v~--Flkvdvde~~~ 65 (106)
T KOG0907|consen 21 DKLVVVDF-YATWCGPCKAIAPKFEKLAEKYPDVV--FLKVDVDELEE 65 (106)
T ss_pred CCeEEEEE-ECCCCcchhhhhhHHHHHHHHCCCCE--EEEEecccCHh
Confidence 58999999 99999999999999999998888744 56666555333
No 446
>KOG0591|consensus
Probab=80.13 E-value=1.3 Score=36.34 Aligned_cols=17 Identities=29% Similarity=0.540 Sum_probs=15.0
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
...|+|++|+||+++..
T Consensus 148 ~VmHRDIKPaNIFl~~~ 164 (375)
T KOG0591|consen 148 TVMHRDIKPANIFLTAN 164 (375)
T ss_pred ceeeccCcchheEEcCC
Confidence 56799999999999974
No 447
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phosphoinositide 3-kinase isoforms participate in a variety of processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
Probab=79.92 E-value=1.6 Score=32.32 Aligned_cols=31 Identities=26% Similarity=0.290 Sum_probs=24.0
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY 64 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~ 64 (107)
+-=+|-+++|||++.+ +.++-|||.++--..
T Consensus 103 lglgDRh~~NIli~~~----------------------G~v~hIDfg~~~~~~ 133 (202)
T smart00146 103 LGLGDRHNDNIMLDKT----------------------GHLFHIDFGFILGNG 133 (202)
T ss_pred hcCCCCCCCcEEEeCC----------------------CCEEEEechhhhCcc
Confidence 3447999999999953 889999998765433
No 448
>KOG0694|consensus
Probab=78.78 E-value=1 Score=39.92 Aligned_cols=44 Identities=20% Similarity=0.289 Sum_probs=36.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
.+.++||+..|||++.. +-+.|+||-.|--+.-.-|-+..||-.
T Consensus 488 ~IIYRDlKLdNiLLD~e----------------------Gh~kiADFGlcKe~m~~g~~TsTfCGT 531 (694)
T KOG0694|consen 488 GIIYRDLKLDNLLLDTE----------------------GHVKIADFGLCKEGMGQGDRTSTFCGT 531 (694)
T ss_pred CceeeecchhheEEccc----------------------CcEEecccccccccCCCCCccccccCC
Confidence 36789999999999985 889999999888777666777788754
No 449
>KOG0574|consensus
Probab=78.65 E-value=0.64 Score=38.65 Aligned_cols=15 Identities=40% Similarity=0.740 Sum_probs=13.5
Q ss_pred EecccCCCceeeecC
Q psy15665 13 CHNDLQEGNILYRES 27 (107)
Q Consensus 13 cHnDl~~gNiL~~~~ 27 (107)
.|+|++.||||++.+
T Consensus 151 IHRDIKAGNILLNT~ 165 (502)
T KOG0574|consen 151 IHRDIKAGNILLNTD 165 (502)
T ss_pred HHhhcccccEEEccc
Confidence 599999999999875
No 450
>KOG0590|consensus
Probab=78.07 E-value=1.7 Score=37.61 Aligned_cols=37 Identities=30% Similarity=0.350 Sum_probs=27.3
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhh
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAF 67 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~f 67 (107)
-.+++|+|+++.|+|+... +.+.+|||--+...--++
T Consensus 438 ~~GiahrdlK~enll~~~~----------------------g~lki~Dfg~~~vf~~~~ 474 (601)
T KOG0590|consen 438 SMGLAHRDLKLENLLVTEN----------------------GILKIIDFGAASVFRYPW 474 (601)
T ss_pred hcCceeccCccccEEEecC----------------------CceEEeecCcceeeccCc
Confidence 3578999999999999985 567777776555433333
No 451
>KOG1989|consensus
Probab=77.75 E-value=1.1 Score=40.03 Aligned_cols=34 Identities=21% Similarity=0.248 Sum_probs=26.3
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhh
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAF 67 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~f 67 (107)
+.|+||+-.|||+... +..+|=||-=|.-..+..
T Consensus 167 iIHRDLKiENvLls~~----------------------g~~KLCDFGSatt~~~~~ 200 (738)
T KOG1989|consen 167 IIHRDLKIENVLLSAD----------------------GNYKLCDFGSATTKILSP 200 (738)
T ss_pred cchhhhhhhheEEcCC----------------------CCEEeCcccccccccCCC
Confidence 6899999999999985 678888887655444433
No 452
>PHA03111 Ser/Thr kinase; Provisional
Probab=77.51 E-value=2.6 Score=35.41 Aligned_cols=21 Identities=38% Similarity=0.412 Sum_probs=17.5
Q ss_pred CCCeEEEecccCCCceeeecC
Q psy15665 7 KSPVTFCHNDLQEGNILYRES 27 (107)
Q Consensus 7 ~~~~VfcHnDl~~gNiL~~~~ 27 (107)
+.--.|.|+||+|.|||+-++
T Consensus 299 p~c~nF~H~DLKPdNILiFds 319 (444)
T PHA03111 299 PCCDNFLHVDLKPDNILIFDS 319 (444)
T ss_pred CCcceeeeccCCCCcEEEecC
Confidence 334579999999999999885
No 453
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP. PhoP controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multi-component loop in Salmonella sp., where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner [].
Probab=77.48 E-value=2.4 Score=31.72 Aligned_cols=27 Identities=30% Similarity=0.380 Sum_probs=20.1
Q ss_pred EecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEee
Q psy15665 13 CHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDF 57 (107)
Q Consensus 13 cHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDf 57 (107)
+.+|+.++||++....++. ..+++||-
T Consensus 140 v~~dl~~~NIv~~~~~~~~------------------~~lvlIDG 166 (199)
T PF10707_consen 140 VIRDLNPHNIVVQRRDSGE------------------FRLVLIDG 166 (199)
T ss_pred eecCCCcccEEEEecCCCc------------------eEEEEEeC
Confidence 4459999999998853221 47999997
No 454
>KOG0193|consensus
Probab=77.14 E-value=1.3 Score=39.18 Aligned_cols=33 Identities=27% Similarity=0.500 Sum_probs=25.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
-+.|+||+..||++.++ ..|++=||-.++..-+
T Consensus 508 ~IIHrDLKSnNIFl~~~----------------------~kVkIgDFGLatvk~~ 540 (678)
T KOG0193|consen 508 NIIHRDLKSNNIFLHED----------------------LKVKIGDFGLATVKTR 540 (678)
T ss_pred hhhhhhccccceEEccC----------------------CcEEEecccceeeeee
Confidence 36799999999999986 5677778877665443
No 455
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central
Probab=75.96 E-value=2.2 Score=32.63 Aligned_cols=30 Identities=27% Similarity=0.362 Sum_probs=23.3
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
|+-=+|-+++|||++.. + +.++-|||.++-
T Consensus 140 ilgigDRh~~NIli~~~----t-----------------G~~~HIDfg~~~ 169 (237)
T cd00892 140 ILGLGDRHGENILFDSN----T-----------------GDVVHVDFNCLF 169 (237)
T ss_pred HhccCCCCcccEEEEcC----C-----------------CcEEEEehHhhh
Confidence 44457999999999873 1 889999997654
No 456
>PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly. ; GO: 0004672 protein kinase activity, 0005524 ATP binding
Probab=75.96 E-value=2.9 Score=35.18 Aligned_cols=22 Identities=36% Similarity=0.479 Sum_probs=18.3
Q ss_pred CCCCeEEEecccCCCceeeecC
Q psy15665 6 IKSPVTFCHNDLQEGNILYRES 27 (107)
Q Consensus 6 ~~~~~VfcHnDl~~gNiL~~~~ 27 (107)
.+.---|.|+||+|.|||+-++
T Consensus 294 lp~c~nF~H~DLKPdNILiFds 315 (434)
T PF05445_consen 294 LPCCTNFLHVDLKPDNILIFDS 315 (434)
T ss_pred CCCcceeeecccCcCcEEEecC
Confidence 3444679999999999999886
No 457
>KOG0575|consensus
Probab=75.74 E-value=1.6 Score=38.12 Aligned_cols=18 Identities=33% Similarity=0.636 Sum_probs=15.7
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..+.|+||+.|||+++..
T Consensus 137 ~~IiHRDLKLGNlfL~~~ 154 (592)
T KOG0575|consen 137 LGIIHRDLKLGNLFLNEN 154 (592)
T ss_pred cCceecccchhheeecCc
Confidence 347899999999999984
No 458
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st
Probab=75.49 E-value=2.9 Score=32.01 Aligned_cols=31 Identities=26% Similarity=0.128 Sum_probs=24.7
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
.|+.=+|-+++|||++.. + +.++-|||.++-
T Consensus 136 YilglgDRH~~NIli~~~----t-----------------G~v~HIDfg~~f 166 (235)
T cd05172 136 WILGIGDRHLSNFLVDLE----T-----------------GGLVGIDFGHAF 166 (235)
T ss_pred heeeccCCCcccEEEECC----C-----------------CcEEEEeeHhhh
Confidence 466778999999999852 1 889999997653
No 459
>cd05168 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIbeta (also called Pik1p in yeast) is a 110 kDa protein that is localized to the Golgi and the nucleus. It is required for maintaining the structural integrity of the Golgi complex (GC), and is a key regulator of protein transport from the GC to the plasma membrane. PI4KII
Probab=74.45 E-value=2.3 Score=33.90 Aligned_cols=26 Identities=31% Similarity=0.502 Sum_probs=21.9
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
+|=|.+|||++.+ +.++-|||-++-=
T Consensus 146 gDRH~~NILi~~~----------------------G~liHIDFG~~fg 171 (293)
T cd05168 146 KDRHNGNILIDND----------------------GHIIHIDFGFMLS 171 (293)
T ss_pred cccCCCceEEcCC----------------------CCEEEEehHHhhc
Confidence 6788999999874 8899999987653
No 460
>cd00893 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. There are two types of PI4Ks, types II and III. Type II PI4Ks lack the characteristic catalytic kinase domain present in PI3Ks and type III PI4Ks, and are excluded from this family. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes.
Probab=74.00 E-value=2.4 Score=33.77 Aligned_cols=30 Identities=27% Similarity=0.408 Sum_probs=24.0
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchh
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRA 66 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~ 66 (107)
+|=|.+|||++.+ +.++-|||-++-=+.++
T Consensus 144 gDRH~~NILid~~----------------------G~liHIDFG~ilg~~p~ 173 (289)
T cd00893 144 KDRHNGNILLDSD----------------------GHIIHIDFGFILDSSPG 173 (289)
T ss_pred cccCCCceEECCC----------------------CCEEEEehHHhhCcCCc
Confidence 6888999999874 88999999887655444
No 461
>KOG1236|consensus
Probab=73.53 E-value=1.9 Score=37.15 Aligned_cols=16 Identities=50% Similarity=0.845 Sum_probs=14.5
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
|.|.|++|||||++.-
T Consensus 366 FvHaDlHPGNVlirf~ 381 (565)
T KOG1236|consen 366 FVHADLHPGNVLIRFN 381 (565)
T ss_pred ceecccCCCcEEEEec
Confidence 8899999999999864
No 462
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with
Probab=73.32 E-value=2.6 Score=32.70 Aligned_cols=30 Identities=23% Similarity=0.349 Sum_probs=23.9
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
.|+.=+|-+++|||++.. + +.++-|||.++
T Consensus 181 YilglgDRH~~NIll~~~----t-----------------G~v~HIDfg~~ 210 (280)
T cd05169 181 YILGLGDRHPSNIMIDRL----T-----------------GKVIHIDFGDC 210 (280)
T ss_pred hheeccCCCcceEEEEcC----C-----------------CCEEEEecHHH
Confidence 356668999999999873 1 88999999654
No 463
>cd05167 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIalpha is a 220 kDa protein found in the plasma membrane and the endoplasmic reticulum (ER). The role of PI4KIIIalpha in the ER remains unclear. In the plasma membrane, it provides PtdIns(4)P, which is then converted by PI5Ks to PtdIns(4,5)P2, an important signaling mole
Probab=70.75 E-value=3.4 Score=33.22 Aligned_cols=29 Identities=24% Similarity=0.408 Sum_probs=23.4
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
+=-+|=|.+|||++.+ +.++-|||-+.-=
T Consensus 162 LgigDRHn~NILid~~----------------------G~l~HIDFG~il~ 190 (311)
T cd05167 162 LQIKDRHNGNIMIDDD----------------------GHIIHIDFGFIFE 190 (311)
T ss_pred hhccccCccceEEcCC----------------------CCEEEEeeHHhhc
Confidence 3446889999999975 8899999987653
No 464
>KOG0670|consensus
Probab=70.69 E-value=3.1 Score=36.72 Aligned_cols=18 Identities=39% Similarity=0.530 Sum_probs=16.0
Q ss_pred eEEEecccCCCceeeecC
Q psy15665 10 VTFCHNDLQEGNILYRES 27 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~ 27 (107)
..+.|.|++|.|||+..+
T Consensus 555 c~vlHaDIKPDNiLVNE~ 572 (752)
T KOG0670|consen 555 CGVLHADIKPDNILVNES 572 (752)
T ss_pred cCeeecccCccceEeccC
Confidence 457899999999999985
No 465
>KOG0662|consensus
Probab=70.61 E-value=2.7 Score=32.76 Aligned_cols=25 Identities=32% Similarity=0.526 Sum_probs=20.3
Q ss_pred ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
|+||+|.|+|+... +.+.+-||-.|
T Consensus 124 hrdlkpqnllin~n----------------------gelkladfgla 148 (292)
T KOG0662|consen 124 HRDLKPQNLLINRN----------------------GELKLADFGLA 148 (292)
T ss_pred hccCCcceEEeccC----------------------CcEEecccchh
Confidence 47999999999874 67888888655
No 466
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno
Probab=70.07 E-value=3.9 Score=32.44 Aligned_cols=29 Identities=24% Similarity=0.377 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
|+.=+|-+++|||+... + +.++-|||.++
T Consensus 210 ilglgDRh~~NIli~~~----t-----------------G~v~hiDf~~~ 238 (307)
T cd05170 210 VIGLGDRHLDNVLIDLK----T-----------------GEVVHIDYNVC 238 (307)
T ss_pred HccCCCCCCccEEEEcC----C-----------------CcEEEEeeHhh
Confidence 45668999999999853 1 88999999865
No 467
>cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms c
Probab=69.91 E-value=3 Score=33.97 Aligned_cols=26 Identities=27% Similarity=0.307 Sum_probs=21.8
Q ss_pred ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
=+|=|.+|||++.+ +.++-|||-+.-
T Consensus 207 igDRH~~NILi~~~----------------------G~~~HIDFG~il 232 (352)
T cd00891 207 IGDRHNDNIMLTKT----------------------GHLFHIDFGHFL 232 (352)
T ss_pred ccccCCCceEECCC----------------------CCEEEEehHHhh
Confidence 36889999999864 889999998763
No 468
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transi
Probab=69.36 E-value=4 Score=31.90 Aligned_cols=29 Identities=28% Similarity=0.367 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
|+.=+|-+++|||+... + +.++-|||.++
T Consensus 182 ilglgDRh~~NIll~~~----t-----------------G~v~hiDf~~~ 210 (279)
T cd05171 182 ILGLGDRHANNILIDEK----T-----------------AEVVHIDLGIA 210 (279)
T ss_pred hhccCCCCcccEEEEcC----c-----------------CcEEEEechhh
Confidence 45568999999999853 1 88999999876
No 469
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members include ATM (Ataxia telangiectasia mutated), ATR (Ataxia telangiectasia and Rad3-related), TOR (Target of rapamycin), SMG-1 (Suppressor of morphogenetic effect on genitalia-1), and DNA-PK (DNA-dependent protein kinase). PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). They show strong preference for phosphorylating serine/threonine residues followed by a glutamine and are also referred to as (S/T)-Q-directed kinases. They all contain a FATC (FRAP, ATM and TRRAP, C-terminal) d
Probab=69.20 E-value=3.8 Score=31.03 Aligned_cols=29 Identities=28% Similarity=0.295 Sum_probs=23.4
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
|+.=+|-+++|||++.. + +.++-|||-++
T Consensus 132 vlglgDRh~~NIli~~~----t-----------------G~v~hIDf~~~ 160 (222)
T cd05164 132 ILGLGDRHLDNILIDRE----T-----------------GEVVHIDFGCI 160 (222)
T ss_pred HhccCCCCCceEEEECC----C-----------------CcEEEEccHHh
Confidence 45568999999999983 1 78999999765
No 470
>KOG0611|consensus
Probab=68.80 E-value=3.2 Score=35.85 Aligned_cols=42 Identities=26% Similarity=0.434 Sum_probs=27.8
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES 76 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~ 76 (107)
..|+||+..|||+++. ..+.+-||-.+.+ |.-=-+-..||-.
T Consensus 174 VvHRDLKLENILLD~N----------------------~NiKIADFGLSNl-y~~~kfLqTFCGS 215 (668)
T KOG0611|consen 174 VVHRDLKLENILLDQN----------------------NNIKIADFGLSNL-YADKKFLQTFCGS 215 (668)
T ss_pred ceecccchhheeecCC----------------------CCeeeeccchhhh-hccccHHHHhcCC
Confidence 4699999999999884 5677888866554 2222333444443
No 471
>PF00454 PI3_PI4_kinase: Phosphatidylinositol 3- and 4-kinase; InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Phosphatidylinositol 3-kinase (PI3-kinase) (2.7.1.137 from EC) [] is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. The three products of PI3-kinase - PI-3-P, PI-3,4-P(2) and PI-3,4,5-P(3) function as secondary messengers in cell signalling. Phosphatidylinositol 4-kinase (PI4-kinase) (2.7.1.67 from EC) [] is an enzyme that acts on phosphatidylinositol (PI) in the first committed step in the production of the secondary messenger inositol-1'4'5'-trisphosphate. This domain is also present in a wide range of protein kinases, involved in diverse cellular functions, such as control of cell growth, regulation of cell cycle progression, a DNA damage checkpoint, recombination, and maintenance of telomere length. Despite significant homology to lipid kinases, no lipid kinase activity has been demonstrated for any of the PIK-related kinases []. The PI3- and PI4-kinases share a well conserved domain at their C-terminal section; this domain seems to be distantly related to the catalytic domain of protein kinases [, ]. The catalytic domain of PI3K has the typical bilobal structure that is seen in other ATP-dependent kinases, with a small N-terminal lobe and a large C-terminal lobe. The core of this domain is the most conserved region of the PI3Ks. The ATP cofactor binds in the crevice formed by the N-and C-terminal lobes, a loop between two strands provides a hydrophobic pocket for binding of the adenine moiety, and a lysine residue interacts with the alpha-phosphate. In contrast to protein kinases, the PI3K loop which interacts with the phosphates of the ATP and is known as the glycine-rich or P-loop, contains no glycine residues. Instead, contact with the ATP -phosphate is maintained through the side chain of a conserved serine residue.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 2WXL_A 4AJW_B 2WXQ_A 2WXP_A 2WXM_A 2WXH_A 2WXK_A 2WXG_A 2X38_A 2WXF_A ....
Probab=68.79 E-value=3.2 Score=30.71 Aligned_cols=27 Identities=33% Similarity=0.472 Sum_probs=16.8
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
+|=+++|||+... + +.++-|||.++--
T Consensus 139 gDRh~~Nili~~~----~-----------------g~~~hIDfg~~f~ 165 (235)
T PF00454_consen 139 GDRHPGNILIDKK----T-----------------GELIHIDFGFIFG 165 (235)
T ss_dssp CS--TTTEEE-ET----T-----------------SEEEE--HSSCTT
T ss_pred cCCCchhheeccc----c-----------------ceeeeEEeHHhhh
Confidence 5789999999432 1 8899999977754
No 472
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=68.49 E-value=3.3 Score=32.95 Aligned_cols=17 Identities=24% Similarity=0.505 Sum_probs=13.4
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+|+++.|+++..+
T Consensus 165 GlVHgdi~~~nfll~~~ 181 (288)
T PF14531_consen 165 GLVHGDIKPENFLLDQD 181 (288)
T ss_dssp TEEEST-SGGGEEE-TT
T ss_pred ceEecccceeeEEEcCC
Confidence 37899999999999985
No 473
>KOG3653|consensus
Probab=68.33 E-value=3.6 Score=35.52 Aligned_cols=20 Identities=25% Similarity=0.476 Sum_probs=17.1
Q ss_pred CCeEEEecccCCCceeeecC
Q psy15665 8 SPVTFCHNDLQEGNILYRES 27 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~~ 27 (107)
.+-.+.|+||+..|||+..+
T Consensus 333 ~Kp~IaHRDlkSkNVLvK~D 352 (534)
T KOG3653|consen 333 HKPPIAHRDLKSKNVLVKND 352 (534)
T ss_pred CCCccccccccccceEEccC
Confidence 34568999999999999986
No 474
>cd05166 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class II, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do not associate with any
Probab=67.09 E-value=4.7 Score=32.96 Aligned_cols=26 Identities=27% Similarity=0.273 Sum_probs=21.5
Q ss_pred ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
=+|=|.+|||++.+ +.++-|||-+.-
T Consensus 206 igDRH~~NILl~~~----------------------G~l~HIDFG~~l 231 (353)
T cd05166 206 ICDRHNDNIMLTKS----------------------GHMFHIDFGKFL 231 (353)
T ss_pred ccccCCCceEECCC----------------------CCEEEEeeHHhc
Confidence 36888999999864 889999998753
No 475
>cd00896 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class III PI3Ks, also called Vps34 (vacuolar protein sorting 34), contain an N-terminal lipid binding C2 domain, a PI3K homology domain of unknown function, and a C-termin
Probab=65.29 E-value=4.5 Score=33.01 Aligned_cols=27 Identities=30% Similarity=0.311 Sum_probs=22.0
Q ss_pred ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
=+|=|.+|||++.+ +.++-|||-++-=
T Consensus 206 igDRH~~NILi~~~----------------------G~~~HIDFG~ilg 232 (350)
T cd00896 206 VGDRHLDNLLLTKD----------------------GKLFHIDFGYILG 232 (350)
T ss_pred ccccCCCcEEEcCC----------------------CCEEEEEhHHhhC
Confidence 36888999999864 8899999987653
No 476
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=65.29 E-value=4.2 Score=31.09 Aligned_cols=32 Identities=25% Similarity=0.557 Sum_probs=23.6
Q ss_pred EEEecccCC--CceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 11 TFCHNDLQE--GNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 11 VfcHnDl~~--gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
.+-|+.+|- .|||+.+ +.+.+||||=|.++-.
T Consensus 125 GI~H~El~~~~k~vlv~~-----------------------~~~~iIDFd~At~k~~ 158 (201)
T COG2112 125 GIEHGELSRPWKNVLVND-----------------------RDVYIIDFDSATFKKK 158 (201)
T ss_pred ccchhhhcCCceeEEecC-----------------------CcEEEEEccchhhccC
Confidence 456777765 4777666 6799999999986544
No 477
>KOG0201|consensus
Probab=65.28 E-value=4.8 Score=34.33 Aligned_cols=29 Identities=34% Similarity=0.450 Sum_probs=23.8
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
-.|+|++..|||+... +.+.|-||-+++.
T Consensus 132 kiHrDIKaanil~s~~----------------------g~vkl~DfgVa~q 160 (467)
T KOG0201|consen 132 KIHRDIKAANILLSES----------------------GDVKLADFGVAGQ 160 (467)
T ss_pred eecccccccceeEecc----------------------CcEEEEecceeee
Confidence 3699999999999985 6688888887764
No 478
>PF08207 EFP_N: Elongation factor P (EF-P) KOW-like domain; InterPro: IPR013185 This entry represents the N-terminal domain of homologues of elongation factor P, which probably are translation initiation factors. ; PDB: 3TRE_A 1YBY_A 1IZ6_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H 3OYY_B.
Probab=65.26 E-value=7.2 Score=23.57 Aligned_cols=26 Identities=27% Similarity=0.450 Sum_probs=20.2
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
+||..|+++..+. ....|+|+++...
T Consensus 3 ~dlr~G~~i~~~g----------------------~~~~V~~~~~~k~ 28 (58)
T PF08207_consen 3 SDLRKGMVIEIDG----------------------EPYVVLDFQHVKP 28 (58)
T ss_dssp GG--TTSEEEETT----------------------EEEEEEEEEEECC
T ss_pred HHccCCCEEEECC----------------------EEEEEEEEEEECC
Confidence 6899999998875 6789999998764
No 479
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1. Like Dim1, it is also implicated in pre-mRNA splicing and cell cycle progression. DLP is located in the nucleus and has been shown to interact with the U5 small nuclear ribonucleoprotein particle (snRNP)-specific 102kD protein (or Prp6). Dim1 protein, also known as U5 snRNP-specific 15kD protein is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif.
Probab=65.06 E-value=15 Score=25.54 Aligned_cols=53 Identities=15% Similarity=0.181 Sum_probs=42.9
Q ss_pred CCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCCceeecCCCCCCHHHHhhc
Q psy15665 50 IDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 50 ~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p~~~~~~~~~Pt~~~~~~~ 104 (107)
+++++||| +|.+.+++--++-.|-|.+-+|... .-.++++-+.-|.-.++..+
T Consensus 14 ~klVVVdF-~a~WC~pCk~mdp~l~ela~~~~~~-~~f~kVDVDev~dva~~y~I 66 (114)
T cd02986 14 EKVLVLRF-GRDEDAVCLQLDDILSKTSHDLSKM-ASIYLVDVDKVPVYTQYFDI 66 (114)
T ss_pred CCEEEEEE-eCCCChhHHHHHHHHHHHHHHccCc-eEEEEEeccccHHHHHhcCc
Confidence 78999999 7888999999999999999887542 33788888888887776543
No 480
>KOG1165|consensus
Probab=64.66 E-value=7.6 Score=32.64 Aligned_cols=34 Identities=18% Similarity=0.275 Sum_probs=24.8
Q ss_pred EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
+.=+|++|.|+|+..... ++..-+.+|||-.|-.
T Consensus 145 LIYRDIKPdNFLIGrp~~-----------------k~~n~IhiiDFGmAK~ 178 (449)
T KOG1165|consen 145 LIYRDIKPDNFLIGRPGT-----------------KDANVIHIIDFGMAKE 178 (449)
T ss_pred eeecccCccceeecCCCC-----------------CCCceEEEEeccchhh
Confidence 556899999999976421 2236799999977663
No 481
>KOG1152|consensus
Probab=63.49 E-value=5.9 Score=35.37 Aligned_cols=31 Identities=23% Similarity=0.434 Sum_probs=26.3
Q ss_pred eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
-.+.|+|++-.|+++... +-+.+|||-=|.|
T Consensus 689 ~~ivhrdikdenvivd~~----------------------g~~klidfgsaa~ 719 (772)
T KOG1152|consen 689 QGIVHRDIKDENVIVDSN----------------------GFVKLIDFGSAAY 719 (772)
T ss_pred cCceecccccccEEEecC----------------------CeEEEeeccchhh
Confidence 357899999999999884 8899999986665
No 482
>KOG0197|consensus
Probab=62.90 E-value=3.3 Score=35.28 Aligned_cols=29 Identities=31% Similarity=0.521 Sum_probs=23.6
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
-+.|+||-..|||+.+. ..+.|=||-.|-
T Consensus 323 ~~IHRDLAARNiLV~~~----------------------~~vKIsDFGLAr 351 (468)
T KOG0197|consen 323 NYIHRDLAARNILVDED----------------------LVVKISDFGLAR 351 (468)
T ss_pred CccchhhhhhheeeccC----------------------ceEEEccccccc
Confidence 37899999999999985 567788886555
No 483
>KOG4158|consensus
Probab=62.70 E-value=5.2 Score=34.44 Aligned_cols=33 Identities=36% Similarity=0.545 Sum_probs=24.0
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
...|+||+..|||+.=+.++- ..|++-||--|-
T Consensus 361 gvAhRDlKSDNiL~ElddD~~------------------P~LVvaDFGCcL 393 (598)
T KOG4158|consen 361 GVAHRDLKSDNILLELDDDEI------------------PQLVVADFGCCL 393 (598)
T ss_pred cchhhcccccceEEEecCCCC------------------cEEEEcccceee
Confidence 478999999999987553331 567888886543
No 484
>KOG2270|consensus
Probab=62.62 E-value=4.7 Score=34.48 Aligned_cols=26 Identities=38% Similarity=0.588 Sum_probs=22.7
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeec
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEY 59 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY 59 (107)
-+.|-||-+-|+|+++ +.|.+||---
T Consensus 285 ~LVHADLSEfN~Lyhd-----------------------G~lyiIDVSQ 310 (520)
T KOG2270|consen 285 RLVHADLSEFNLLYHD-----------------------GKLYIIDVSQ 310 (520)
T ss_pred ceeccchhhhhheEEC-----------------------CEEEEEEccc
Confidence 4789999999999999 7899999643
No 485
>cd05173 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and de
Probab=62.14 E-value=5.7 Score=32.66 Aligned_cols=25 Identities=32% Similarity=0.384 Sum_probs=21.1
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
+|=|.+|||++.+ +.++-|||-+.-
T Consensus 213 GDRHn~NILi~~~----------------------G~l~HIDFG~il 237 (362)
T cd05173 213 GDRHSDNIMVRKN----------------------GQLFHIDFGHIL 237 (362)
T ss_pred cccCCCceEECCC----------------------CCEEEEehHHhh
Confidence 5778899999864 889999998764
No 486
>cd05165 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. In vitro, they can also phosphorylate the substrates P
Probab=61.90 E-value=5.8 Score=32.70 Aligned_cols=25 Identities=32% Similarity=0.406 Sum_probs=21.2
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
+|=|.+|||++.+ +.++-|||-|+-
T Consensus 217 gDRH~~NILi~~~----------------------G~l~HIDFG~il 241 (366)
T cd05165 217 GDRHNDNIMVKET----------------------GQLFHIDFGHIL 241 (366)
T ss_pred cccCCcceEEcCC----------------------CCEEEEehHHhh
Confidence 5778899999874 889999998864
No 487
>KOG1240|consensus
Probab=59.66 E-value=3.3 Score=39.31 Aligned_cols=19 Identities=32% Similarity=0.656 Sum_probs=16.1
Q ss_pred CCeEEEecccCCCceeeec
Q psy15665 8 SPVTFCHNDLQEGNILYRE 26 (107)
Q Consensus 8 ~~~VfcHnDl~~gNiL~~~ 26 (107)
....+||+|++..|||++.
T Consensus 137 H~~gVcHGDIKsENILiTS 155 (1431)
T KOG1240|consen 137 HKLGVCHGDIKSENILITS 155 (1431)
T ss_pred HHcCccccccccceEEEee
Confidence 3467899999999999874
No 488
>KOG0587|consensus
Probab=59.25 E-value=8.8 Score=35.37 Aligned_cols=67 Identities=19% Similarity=0.361 Sum_probs=42.2
Q ss_pred CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC-----CchhhhHHHHHHHhhhccCCC
Q psy15665 9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY-----NYRAFDIANHFVESVYDYSYK 83 (107)
Q Consensus 9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~-----n~r~fDlanhf~E~~~dy~~~ 83 (107)
.....|+|++-.|||++.. ++|+++||--+.- .=|.--||.-| ||
T Consensus 141 ~nkviHRDikG~NiLLT~e----------------------~~VKLvDFGvSaQldsT~grRnT~iGtP~--WM------ 190 (953)
T KOG0587|consen 141 NNKVIHRDIKGQNVLLTEN----------------------AEVKLVDFGVSAQLDSTVGRRNTFIGTPY--WM------ 190 (953)
T ss_pred hcceeeecccCceEEEecc----------------------CcEEEeeeeeeeeeecccccccCcCCCcc--cc------
Confidence 3456899999999999985 7899999975432 22222222211 33
Q ss_pred CCC-ceeecCCCCCCHHHHhhccc
Q psy15665 84 HFP-HYTVKRENYPSYSLRNSSWV 106 (107)
Q Consensus 84 ~~p-~~~~~~~~~Pt~~~~~~~~~ 106 (107)
.| -+.|+.+.-+|..-|--+|.
T Consensus 191 -APEViac~e~~d~tyd~R~D~Ws 213 (953)
T KOG0587|consen 191 -APEVIACDESPDATYDYRSDLWS 213 (953)
T ss_pred -cceeeecccCCCCCcccccchhh
Confidence 23 46677777777776665553
No 489
>cd05177 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), class II, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=58.50 E-value=7.2 Score=32.00 Aligned_cols=26 Identities=27% Similarity=0.240 Sum_probs=21.4
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY 62 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~ 62 (107)
+|=|.+|||++.+ +.++-|||-|.-=
T Consensus 208 gDRHn~NILi~~~----------------------G~~~HIDFG~ilg 233 (354)
T cd05177 208 CDRHNDNIMLTHS----------------------GHMFHIDFGKFLG 233 (354)
T ss_pred cCcCCCceeEcCC----------------------CCEEEEehHHhcC
Confidence 5778899999864 8899999988753
No 490
>KOG0580|consensus
Probab=58.19 E-value=3.4 Score=33.00 Aligned_cols=16 Identities=25% Similarity=0.499 Sum_probs=13.7
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
..|+|++|.|+|+...
T Consensus 145 VIhRdiKpenlLlg~~ 160 (281)
T KOG0580|consen 145 VIHRDIKPENLLLGSA 160 (281)
T ss_pred cccCCCCHHHhccCCC
Confidence 4699999999998764
No 491
>KOG4721|consensus
Probab=57.81 E-value=5.2 Score=35.90 Aligned_cols=16 Identities=38% Similarity=0.495 Sum_probs=14.4
Q ss_pred EEecccCCCceeeecC
Q psy15665 12 FCHNDLQEGNILYRES 27 (107)
Q Consensus 12 fcHnDl~~gNiL~~~~ 27 (107)
+.|+||+.-|||+...
T Consensus 233 IIHRDLKSPNiLIs~~ 248 (904)
T KOG4721|consen 233 IIHRDLKSPNILISYD 248 (904)
T ss_pred HhhhccCCCceEeecc
Confidence 6799999999999874
No 492
>PF13575 DUF4135: Domain of unknown function (DUF4135)
Probab=56.56 E-value=7.7 Score=31.19 Aligned_cols=26 Identities=31% Similarity=0.200 Sum_probs=21.4
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
+|+|..||+... ..-++||.|-..-.
T Consensus 153 ~DlH~ENIIa~g-----------------------~~PvlIDlETlf~~ 178 (370)
T PF13575_consen 153 TDLHFENIIASG-----------------------EYPVLIDLETLFHP 178 (370)
T ss_pred CcccccceEEeC-----------------------CCcEEEehhhhCCc
Confidence 699999999987 45689999977654
No 493
>KOG0914|consensus
Probab=56.52 E-value=13 Score=29.41 Aligned_cols=54 Identities=13% Similarity=0.260 Sum_probs=49.0
Q ss_pred CCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCCceeecCCCCCCHHHHhhc
Q psy15665 50 IDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRNSS 104 (107)
Q Consensus 50 ~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p~~~~~~~~~Pt~~~~~~~ 104 (107)
....+|-| |+.+++.+--.+-.|.|....|+.+...+=+++-.+||..++|..+
T Consensus 144 ~t~WlIeF-fa~ws~~Cv~~spvfaeLS~kyn~~~lkFGkvDiGrfpd~a~kfri 197 (265)
T KOG0914|consen 144 RTYWLIEF-FACWSPKCVRFSPVFAELSIKYNNNLLKFGKVDIGRFPDVAAKFRI 197 (265)
T ss_pred ceEEEEEE-EeecChhhcccccccHHHHHHhCCCCCcccceeeccCcChHHheee
Confidence 66899998 8999999999999999999999999888888999999999998643
No 494
>KOG0033|consensus
Probab=55.15 E-value=8.6 Score=31.25 Aligned_cols=17 Identities=29% Similarity=0.499 Sum_probs=14.6
Q ss_pred EEEecccCCCceeeecC
Q psy15665 11 TFCHNDLQEGNILYRES 27 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~ 27 (107)
.+.|+|++|.|+|+-.+
T Consensus 130 ~IvHRDvkP~nllLASK 146 (355)
T KOG0033|consen 130 GIVHRDLKPENLLLASK 146 (355)
T ss_pred CceeccCChhheeeeec
Confidence 46799999999998775
No 495
>cd05174 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), class IA, delta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and
Probab=54.70 E-value=9.1 Score=31.53 Aligned_cols=25 Identities=40% Similarity=0.442 Sum_probs=20.7
Q ss_pred cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
+|=|.+|||++.+ +.++-|||-+.-
T Consensus 213 GDRHn~NILi~~~----------------------G~l~HIDFG~il 237 (361)
T cd05174 213 GDRHSDNIMIRES----------------------GQLFHIDFGHFL 237 (361)
T ss_pred cCcCccceeEcCC----------------------CCEEEEehHHhh
Confidence 5778899999864 889999998754
No 496
>cd00894 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and
Probab=54.55 E-value=11 Score=31.18 Aligned_cols=28 Identities=32% Similarity=0.320 Sum_probs=22.5
Q ss_pred ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665 14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN 63 (107)
Q Consensus 14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n 63 (107)
=+|=|.+|||++.+ +.++-|||-|.-=+
T Consensus 216 IgDRHndNImi~~~----------------------G~lfHIDFG~ilg~ 243 (365)
T cd00894 216 IGDRHNDNIMITET----------------------GNLFHIDFGHILGN 243 (365)
T ss_pred ccCccccceeEcCC----------------------CCEEEEeeHHhhCC
Confidence 35778899999974 88999999876544
No 497
>KOG0614|consensus
Probab=54.12 E-value=7.8 Score=34.25 Aligned_cols=28 Identities=25% Similarity=0.396 Sum_probs=22.8
Q ss_pred EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665 11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC 60 (107)
Q Consensus 11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa 60 (107)
-+.-+||+|.|+|+... +=+.|+||-+|
T Consensus 540 ~iIYRDLKPENllLd~~----------------------Gy~KLVDFGFA 567 (732)
T KOG0614|consen 540 GIIYRDLKPENLLLDNR----------------------GYLKLVDFGFA 567 (732)
T ss_pred CceeccCChhheeeccC----------------------CceEEeehhhH
Confidence 35568999999999885 77899998655
No 498
>KOG2464|consensus
Probab=53.62 E-value=4.6 Score=30.85 Aligned_cols=23 Identities=35% Similarity=0.580 Sum_probs=19.0
Q ss_pred cCCCCeEEEecccCCCceeeecC
Q psy15665 5 KIKSPVTFCHNDLQEGNILYRES 27 (107)
Q Consensus 5 ~~~~~~VfcHnDl~~gNiL~~~~ 27 (107)
..+...-|-|+|++.||||+...
T Consensus 152 i~~~~~~~~hrdl~~gnili~k~ 174 (246)
T KOG2464|consen 152 IAEKSLGFEHRDLHLGNILIKKT 174 (246)
T ss_pred HhhhhhcccccccCcCcEEEecc
Confidence 34566788999999999999874
No 499
>cd05176 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), class II, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=53.41 E-value=11 Score=30.96 Aligned_cols=26 Identities=27% Similarity=0.314 Sum_probs=21.3
Q ss_pred ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665 14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS 61 (107)
Q Consensus 14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~ 61 (107)
=+|=|.+|||++.+ +.++-|||-|.-
T Consensus 206 IgDRHn~NILi~~~----------------------Ghl~HIDFG~il 231 (353)
T cd05176 206 ICDRHNDNIMLRST----------------------GHMFHIDFGKFL 231 (353)
T ss_pred ccCcCCcceEEcCC----------------------CCEEEEeeHHhc
Confidence 35778899999864 889999998863
No 500
>KOG0903|consensus
Probab=53.17 E-value=11 Score=34.22 Aligned_cols=27 Identities=33% Similarity=0.458 Sum_probs=20.9
Q ss_pred cCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665 17 LQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR 65 (107)
Q Consensus 17 l~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r 65 (107)
=|=||||++.. +.++-|||-+.--|-+
T Consensus 702 RHNGNILiD~E----------------------GHIIHIDFGFmLsnsP 728 (847)
T KOG0903|consen 702 RHNGNILIDEE----------------------GHIIHIDFGFMLSNSP 728 (847)
T ss_pred ccCCceEecCC----------------------CCEEEEeeeeEecCCC
Confidence 34499999985 8999999997654444
Done!