Query         psy15665
Match_columns 107
No_of_seqs    148 out of 855
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 18:28:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15665.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15665hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2686|consensus              100.0 1.5E-30 3.2E-35  209.7   7.1   80    4-104   206-285 (366)
  2 PTZ00296 choline kinase; Provi  99.9 5.6E-27 1.2E-31  192.5   7.6   78    4-104   278-355 (442)
  3 PTZ00384 choline kinase; Provi  99.9 1.3E-26 2.8E-31  187.5   7.9   76    7-105   224-299 (383)
  4 PF01633 Choline_kinase:  Choli  99.9 2.7E-27 5.9E-32  174.0   1.9   75    3-100   136-211 (211)
  5 KOG4720|consensus               99.9 7.2E-25 1.6E-29  175.1   4.5   74    2-104   240-313 (391)
  6 cd05156 ChoK_euk Choline Kinas  99.9 8.7E-24 1.9E-28  161.8   7.7   82    6-105   175-256 (302)
  7 PLN02421 phosphotransferase, a  99.9 1.5E-23 3.3E-28  165.2   6.2   72    4-105   176-247 (330)
  8 PLN02236 choline kinase         99.8 3.9E-21 8.4E-26  152.6   6.7   77    5-104   195-271 (344)
  9 cd05157 ETNK_euk Ethanolamine   99.8 4.1E-20   9E-25  136.4   6.4   69    6-104   166-234 (235)
 10 COG0510 ycfN Thiamine kinase a  99.7 1.2E-16 2.6E-21  124.0   5.2   73    3-98    145-218 (269)
 11 TIGR02721 ycfN_thiK thiamine k  99.5 8.1E-15 1.8E-19  110.3   4.9   47    7-76    143-189 (256)
 12 PRK10271 thiK thiamine kinase;  99.4 6.4E-13 1.4E-17   99.4   4.9   48    5-75     72-119 (188)
 13 cd05151 ChoK Choline Kinase (C  99.4   2E-13 4.4E-18   95.0   2.0   47    9-78    106-152 (170)
 14 cd05154 ACAD10_11_like Acyl-Co  99.3 2.9E-12 6.4E-17   91.8   5.0   49    8-76    172-220 (223)
 15 TIGR02172 Fb_sc_TIGR02172 Fibr  99.2 6.8E-12 1.5E-16   94.7   4.0   72    5-104   148-219 (226)
 16 PRK09550 mtnK methylthioribose  99.1   4E-11 8.7E-16   98.2   4.8   53    7-82    220-272 (401)
 17 cd05153 HomoserineK_II Homoser  99.1 3.9E-11 8.4E-16   91.4   3.9   51    7-79    172-222 (296)
 18 cd05150 APH Aminoglycoside 3'-  99.1 1.2E-10 2.7E-15   86.5   5.3   48    7-76    160-207 (244)
 19 smart00587 CHK ZnF_C4 abd HLH   99.0 3.8E-10 8.2E-15   83.1   5.5   53    8-77    118-170 (196)
 20 TIGR01767 MTRK 5-methylthiorib  99.0   4E-10 8.6E-15   91.8   4.5   52    7-81    189-240 (370)
 21 PF01636 APH:  Phosphotransfera  99.0 2.8E-10   6E-15   81.3   2.7   49    7-76    163-211 (239)
 22 PRK05231 homoserine kinase; Pr  99.0 6.5E-10 1.4E-14   85.7   4.3   51    8-80    185-235 (319)
 23 cd05155 APH_ChoK_like_1 Unchar  99.0 4.2E-10 9.1E-15   83.8   3.0   72    8-106   162-234 (235)
 24 TIGR02906 spore_CotS spore coa  98.9 6.6E-10 1.4E-14   84.7   4.0   75    7-104   184-263 (313)
 25 TIGR00938 thrB_alt homoserine   98.9 8.5E-10 1.8E-14   85.3   4.3   50    7-78    184-233 (307)
 26 PRK12396 5-methylribose kinase  98.9 9.2E-10   2E-14   90.7   3.3   52    8-82    225-276 (409)
 27 cd05120 APH_ChoK_like Aminogly  98.8 1.1E-08 2.4E-13   67.6   5.0   46   10-77    108-153 (155)
 28 TIGR02904 spore_ysxE spore coa  98.8 6.3E-09 1.4E-13   80.7   3.9   50    6-77    192-241 (309)
 29 PF02958 EcKinase:  Ecdysteroid  98.7 1.3E-08 2.7E-13   77.8   4.3   55    6-77    211-265 (294)
 30 cd05152 MPH2' Macrolide 2'-Pho  98.6 5.4E-08 1.2E-12   75.4   5.0   46    7-73    182-227 (276)
 31 PRK11768 serine/threonine prot  98.6 5.4E-08 1.2E-12   76.7   3.5   44    7-74    193-236 (325)
 32 PLN02756 S-methyl-5-thioribose  98.5 5.8E-08 1.3E-12   80.3   3.7   51    8-81    228-278 (418)
 33 PLN02876 acyl-CoA dehydrogenas  98.3 1.2E-06 2.7E-11   76.7   6.5   76    9-104   224-304 (822)
 34 COG2334 Putative homoserine ki  98.3 9.7E-07 2.1E-11   70.9   4.4   43   12-76    199-242 (331)
 35 PRK10593 hypothetical protein;  98.2 6.8E-07 1.5E-11   69.8   2.7   63    7-97    190-254 (297)
 36 COG3173 Predicted aminoglycosi  98.2   2E-06 4.4E-11   69.0   5.0   48    6-77    194-241 (321)
 37 COG4857 Predicted kinase [Gene  98.1 1.4E-06 3.1E-11   70.4   2.8   45   10-77    228-272 (408)
 38 TIGR03724 arch_bud32 Kae1-asso  97.8 1.7E-05 3.8E-10   56.7   3.6   40   10-72    109-148 (199)
 39 PRK06148 hypothetical protein;  97.8   3E-05 6.5E-10   69.8   4.7   52    7-78    200-252 (1013)
 40 PRK14879 serine/threonine prot  97.7 3.7E-05   8E-10   55.3   3.2   39   11-72    115-153 (211)
 41 PF07914 DUF1679:  Protein of u  97.6 1.1E-05 2.4E-10   66.4  -0.7   54    5-75    263-316 (414)
 42 COG3178 Predicted phosphotrans  97.6 7.5E-05 1.6E-09   60.5   3.6   52    6-75    196-247 (351)
 43 PRK06149 hypothetical protein;  97.4 0.00015 3.3E-09   65.0   4.2   54    8-78    206-259 (972)
 44 cd05145 RIO1_like RIO kinase f  97.4 0.00018 3.9E-09   52.1   3.2   31   10-63    137-167 (190)
 45 TIGR02905 spore_yutH spore coa  97.2 0.00022 4.9E-09   56.0   2.9   45    8-77    187-231 (313)
 46 PRK09605 bifunctional UGMP fam  97.2  0.0002 4.4E-09   59.7   2.4   41   11-74    448-488 (535)
 47 PF06293 Kdo:  Lipopolysacchari  97.1 0.00035 7.6E-09   51.6   2.4   45   10-73    137-186 (206)
 48 PF04655 APH_6_hur:  Aminoglyco  97.1 0.00037   8E-09   54.1   2.5   50    5-77    155-204 (253)
 49 cd05147 RIO1_euk RIO kinase fa  97.0 0.00054 1.2E-08   50.2   2.5   28   11-61    138-165 (190)
 50 PRK12274 serine/threonine prot  97.0 0.00044 9.6E-09   53.1   2.1   33   10-64    110-143 (218)
 51 PRK10359 lipopolysaccharide co  96.9 0.00093   2E-08   51.5   3.1   44   11-79    155-200 (232)
 52 PRK01723 3-deoxy-D-manno-octul  96.8 0.00068 1.5E-08   51.4   2.2   32   11-64    162-193 (239)
 53 cd05144 RIO2_C RIO kinase fami  96.8 0.00075 1.6E-08   48.7   2.2   30   10-61    144-173 (198)
 54 smart00090 RIO RIO-like kinase  96.8 0.00088 1.9E-08   50.8   2.5   29   12-63    170-198 (237)
 55 PF01163 RIO1:  RIO1 family;  I  96.7  0.0011 2.3E-08   49.4   2.2   37   10-69    126-164 (188)
 56 cd05119 RIO RIO kinase family,  96.7   0.001 2.3E-08   46.9   2.1   29   10-61    134-162 (187)
 57 PF03881 Fructosamin_kin:  Fruc  96.6  0.0014   3E-08   51.7   2.4   44    6-72    184-227 (288)
 58 TIGR01982 UbiB 2-polyprenylphe  96.5  0.0017 3.7E-08   53.6   2.6   33   11-65    277-309 (437)
 59 cd05146 RIO3_euk RIO kinase fa  96.5  0.0016 3.5E-08   48.9   1.9   28   10-60    144-171 (197)
 60 cd00180 PKc Catalytic domain o  96.3  0.0025 5.4E-08   43.3   1.9   34   11-66    112-146 (215)
 61 PF06176 WaaY:  Lipopolysacchar  96.3  0.0029 6.3E-08   49.0   2.4   29   10-61    154-182 (229)
 62 PF00069 Pkinase:  Protein kina  96.1  0.0022 4.8E-08   46.3   1.1   29   11-61    118-146 (260)
 63 cd05604 STKc_SGK3 Catalytic do  96.1  0.0031 6.7E-08   48.3   1.9   30   11-62    116-145 (325)
 64 cd05627 STKc_NDR2 Catalytic do  96.0   0.004 8.6E-08   48.5   2.0   29   11-61    121-149 (360)
 65 PRK04750 ubiB putative ubiquin  96.0  0.0043 9.4E-08   52.9   2.3   37   11-65    280-316 (537)
 66 cd05594 STKc_PKB_alpha Catalyt  95.9  0.0062 1.4E-07   46.7   2.8   30   10-61    115-144 (325)
 67 cd05603 STKc_SGK2 Catalytic do  95.9  0.0038 8.2E-08   47.7   1.6   29   11-61    116-144 (321)
 68 cd05621 STKc_ROCK2 Catalytic d  95.9  0.0046   1E-07   48.9   2.0   29   11-61    162-190 (370)
 69 smart00219 TyrKc Tyrosine kina  95.9  0.0052 1.1E-07   44.2   2.1   29   11-61    123-151 (258)
 70 cd05585 STKc_YPK1_like Catalyt  95.9  0.0046   1E-07   47.1   1.9   30   11-62    113-142 (312)
 71 cd05068 PTKc_Frk_like Catalyti  95.9  0.0051 1.1E-07   45.0   2.1   17   11-27    123-139 (261)
 72 cd05082 PTKc_Csk Catalytic dom  95.9  0.0051 1.1E-07   44.9   2.0   29   11-61    122-150 (256)
 73 KOG0667|consensus               95.9  0.0053 1.2E-07   53.1   2.4   34    9-62    307-340 (586)
 74 cd05586 STKc_Sck1_like Catalyt  95.9  0.0045 9.6E-08   47.5   1.7   30   11-62    116-145 (330)
 75 cd05614 STKc_MSK2_N N-terminal  95.9  0.0043 9.3E-08   47.5   1.6   29   11-61    125-153 (332)
 76 cd05069 PTKc_Yes Catalytic dom  95.9  0.0054 1.2E-07   44.9   2.1   29   11-61    122-150 (260)
 77 cd07863 STKc_CDK4 Catalytic do  95.9   0.004 8.8E-08   46.1   1.4   28   11-60    128-155 (288)
 78 PHA02882 putative serine/threo  95.9  0.0056 1.2E-07   46.3   2.2   28   11-60    146-173 (294)
 79 cd05083 PTKc_Chk Catalytic dom  95.8   0.005 1.1E-07   44.9   1.7   29   11-61    120-148 (254)
 80 cd05601 STKc_CRIK Catalytic do  95.8  0.0051 1.1E-07   47.0   1.8   29   11-61    122-150 (330)
 81 cd05573 STKc_ROCK_NDR_like Cat  95.8  0.0048   1E-07   47.3   1.6   31   10-62    120-150 (350)
 82 cd05039 PTKc_Csk_like Catalyti  95.8  0.0057 1.2E-07   44.5   1.9   30   11-62    122-151 (256)
 83 cd05597 STKc_DMPK_like Catalyt  95.8  0.0057 1.2E-07   47.2   2.0   28   11-60    122-149 (331)
 84 PTZ00267 NIMA-related protein   95.8  0.0067 1.4E-07   49.8   2.4   29   11-61    189-217 (478)
 85 cd05598 STKc_LATS Catalytic do  95.8  0.0058 1.2E-07   47.8   1.9   29   11-61    121-149 (376)
 86 cd05628 STKc_NDR1 Catalytic do  95.8  0.0059 1.3E-07   47.7   2.0   30   11-62    121-150 (363)
 87 KOG0594|consensus               95.7   0.007 1.5E-07   49.0   2.3   27   12-60    141-167 (323)
 88 cd05109 PTKc_HER2 Catalytic do  95.7  0.0059 1.3E-07   45.2   1.7   17   11-27    129-145 (279)
 89 cd05587 STKc_cPKC Catalytic do  95.7  0.0062 1.3E-07   46.7   1.9   29   11-61    121-149 (324)
 90 cd05584 STKc_p70S6K Catalytic   95.7  0.0058 1.3E-07   46.9   1.8   29   11-61    120-148 (323)
 91 cd08223 STKc_Nek4 Catalytic do  95.7  0.0088 1.9E-07   43.3   2.6   28   11-60    122-149 (257)
 92 cd05602 STKc_SGK1 Catalytic do  95.7  0.0056 1.2E-07   46.9   1.5   29   11-61    116-144 (325)
 93 PTZ00263 protein kinase A cata  95.6  0.0068 1.5E-07   46.7   2.0   29   11-61    138-166 (329)
 94 cd05084 PTKc_Fes Catalytic dom  95.6  0.0061 1.3E-07   44.3   1.6   17   11-27    114-130 (252)
 95 cd05571 STKc_PKB Catalytic dom  95.6   0.007 1.5E-07   46.4   2.0   29   11-61    115-143 (323)
 96 cd07872 STKc_PCTAIRE2 Catalyti  95.6  0.0055 1.2E-07   46.4   1.4   17   11-27    124-140 (309)
 97 cd07869 STKc_PFTAIRE1 Catalyti  95.6  0.0051 1.1E-07   46.4   1.2   17   11-27    123-139 (303)
 98 COG3570 StrB Streptomycin 6-ki  95.6  0.0057 1.2E-07   47.9   1.4   51    4-77    155-205 (274)
 99 cd05575 STKc_SGK Catalytic dom  95.6  0.0067 1.4E-07   46.5   1.8   29   11-61    116-144 (323)
100 cd08217 STKc_Nek2 Catalytic do  95.6  0.0068 1.5E-07   43.7   1.7   32    9-62    128-159 (265)
101 COG3642 Mn2+-dependent serine/  95.6   0.013 2.8E-07   44.8   3.3   38   10-70    111-148 (204)
102 PRK09188 serine/threonine prot  95.6  0.0091   2E-07   48.6   2.6   38   11-70    131-169 (365)
103 cd05574 STKc_phototropin_like   95.6  0.0078 1.7E-07   45.5   2.1   30   11-62    123-152 (316)
104 cd05624 STKc_MRCK_beta Catalyt  95.6  0.0076 1.7E-07   46.5   2.1   29   10-60    121-149 (331)
105 cd05616 STKc_cPKC_beta Catalyt  95.6  0.0064 1.4E-07   46.6   1.6   29   11-61    121-149 (323)
106 COG0661 AarF Predicted unusual  95.6  0.0078 1.7E-07   51.3   2.2   34   10-65    284-317 (517)
107 cd05052 PTKc_Abl Catalytic dom  95.6  0.0086 1.9E-07   43.9   2.2   17   11-27    124-140 (263)
108 TIGR02457 TreS_Cterm trehalose  95.6   0.008 1.7E-07   51.3   2.3   45    9-76    378-431 (528)
109 cd05593 STKc_PKB_gamma Catalyt  95.6  0.0069 1.5E-07   46.8   1.8   29   11-61    115-143 (328)
110 cd05108 PTKc_EGFR Catalytic do  95.6  0.0081 1.8E-07   45.7   2.1   29   11-61    129-157 (316)
111 cd05600 STKc_Sid2p_Dbf2p Catal  95.6  0.0061 1.3E-07   46.8   1.4   29   11-61    121-149 (333)
112 cd07871 STKc_PCTAIRE3 Catalyti  95.5  0.0046   1E-07   46.4   0.7   17   11-27    123-139 (288)
113 cd05612 STKc_PRKX_like Catalyt  95.5   0.008 1.7E-07   45.3   2.0   29   11-61    121-149 (291)
114 cd00192 PTKc Catalytic domain   95.5  0.0081 1.8E-07   43.1   1.9   18   10-27    124-141 (262)
115 cd05595 STKc_PKB_beta Catalyti  95.5   0.006 1.3E-07   46.9   1.3   29   11-61    115-143 (323)
116 cd07862 STKc_CDK6 Catalytic do  95.5  0.0064 1.4E-07   45.2   1.4   28   11-60    130-157 (290)
117 PLN00034 mitogen-activated pro  95.5  0.0068 1.5E-07   47.1   1.5   17   11-27    188-204 (353)
118 cd05122 PKc_STE Catalytic doma  95.5  0.0087 1.9E-07   42.5   2.0   32   10-63    117-148 (253)
119 cd05629 STKc_NDR_like_fungal C  95.5  0.0081 1.7E-07   47.1   2.0   29   11-61    121-149 (377)
120 cd05053 PTKc_FGFR Catalytic do  95.5  0.0069 1.5E-07   45.0   1.5   29   11-61    152-180 (293)
121 cd06656 STKc_PAK3 Catalytic do  95.5  0.0054 1.2E-07   46.3   0.9   29   11-61    135-163 (297)
122 cd07875 STKc_JNK1 Catalytic do  95.5  0.0079 1.7E-07   46.8   1.8   29   11-61    146-174 (364)
123 cd05591 STKc_nPKC_epsilon Cata  95.5  0.0084 1.8E-07   45.9   1.9   29   11-61    116-144 (321)
124 cd05590 STKc_nPKC_eta Catalyti  95.5  0.0083 1.8E-07   46.0   1.9   29   11-61    116-144 (320)
125 cd05623 STKc_MRCK_alpha Cataly  95.5  0.0093   2E-07   45.9   2.1   28   11-60    122-149 (332)
126 cd05617 STKc_aPKC_zeta Catalyt  95.4  0.0082 1.8E-07   46.2   1.8   28   11-60    116-143 (327)
127 cd05070 PTKc_Fyn_Yrk Catalytic  95.4  0.0084 1.8E-07   43.8   1.7   29   11-61    122-150 (260)
128 cd05620 STKc_nPKC_delta Cataly  95.4  0.0072 1.6E-07   46.3   1.4   29   11-61    116-144 (316)
129 cd06605 PKc_MAPKK Catalytic do  95.4  0.0067 1.5E-07   44.1   1.2   31    9-61    119-149 (265)
130 cd07874 STKc_JNK3 Catalytic do  95.4  0.0074 1.6E-07   46.7   1.5   29   11-61    139-167 (355)
131 PTZ00426 cAMP-dependent protei  95.4  0.0081 1.8E-07   46.9   1.7   29   11-61    151-179 (340)
132 PRK10345 hypothetical protein;  95.4   0.013 2.7E-07   44.1   2.6   32   12-61    126-157 (210)
133 PRK15123 lipopolysaccharide co  95.4  0.0085 1.8E-07   46.7   1.8   50   11-75    158-213 (268)
134 cd05625 STKc_LATS1 Catalytic d  95.4  0.0087 1.9E-07   47.0   1.8   29   11-61    121-149 (382)
135 cd05085 PTKc_Fer Catalytic dom  95.4   0.009 1.9E-07   43.2   1.8   17   11-27    113-129 (250)
136 cd05091 PTKc_Ror2 Catalytic do  95.4  0.0081 1.8E-07   44.4   1.5   29   11-61    144-172 (283)
137 cd05592 STKc_nPKC_theta_delta   95.4  0.0084 1.8E-07   45.9   1.7   29   11-61    116-144 (316)
138 cd05599 STKc_NDR_like Catalyti  95.4  0.0091   2E-07   46.3   1.8   29   11-61    121-149 (364)
139 cd07878 STKc_p38beta_MAPK11 Ca  95.4  0.0099 2.1E-07   45.7   2.0   17   11-27    138-154 (343)
140 cd05080 PTKc_Tyk2_rpt2 Catalyt  95.4   0.012 2.7E-07   43.6   2.5   29   11-61    127-155 (283)
141 cd07876 STKc_JNK2 Catalytic do  95.3  0.0073 1.6E-07   46.9   1.2   29   11-61    143-171 (359)
142 cd07868 STKc_CDK8 Catalytic do  95.3   0.011 2.4E-07   44.6   2.2   16   11-26    128-143 (317)
143 cd05113 PTKc_Btk_Bmx Catalytic  95.3   0.011 2.4E-07   43.4   2.1   17   11-27    120-136 (256)
144 cd05631 STKc_GRK4 Catalytic do  95.3   0.011 2.3E-07   44.4   2.0   17   11-27    122-138 (285)
145 cd05066 PTKc_EphR_A Catalytic   95.3  0.0092   2E-07   43.9   1.7   17   11-27    126-142 (267)
146 cd05071 PTKc_Src Catalytic dom  95.3  0.0094   2E-07   43.9   1.7   17   11-27    122-138 (262)
147 cd05102 PTKc_VEGFR3 Catalytic   95.3   0.014   3E-07   44.7   2.7   17   11-27    194-210 (338)
148 cd05618 STKc_aPKC_iota Catalyt  95.3    0.01 2.2E-07   45.8   1.9   29   11-61    116-144 (329)
149 cd07859 STKc_TDY_MAPK_plant Ca  95.3  0.0083 1.8E-07   45.5   1.4   17   11-27    123-139 (338)
150 cd05075 PTKc_Axl Catalytic dom  95.3  0.0088 1.9E-07   43.8   1.4   17   11-27    132-148 (272)
151 cd06650 PKc_MEK1 Catalytic dom  95.3   0.013 2.7E-07   45.4   2.4   29   11-61    124-152 (333)
152 cd06649 PKc_MEK2 Catalytic dom  95.3   0.012 2.6E-07   45.3   2.2   29   11-61    124-152 (331)
153 cd07873 STKc_PCTAIRE1 Catalyti  95.3  0.0078 1.7E-07   45.2   1.2   17   11-27    124-140 (301)
154 cd08528 STKc_Nek10 Catalytic d  95.3   0.011 2.3E-07   43.4   1.8   30   10-61    133-162 (269)
155 PHA03212 serine/threonine kina  95.3   0.011 2.3E-07   47.4   2.0   28   11-60    202-229 (391)
156 KOG0583|consensus               95.3  0.0063 1.4E-07   49.3   0.6   45   11-76    140-184 (370)
157 cd05622 STKc_ROCK1 Catalytic d  95.3   0.011 2.5E-07   46.6   2.1   28   11-60    162-189 (371)
158 cd05582 STKc_RSK_N N-terminal   95.2   0.011 2.4E-07   45.1   1.9   29   11-61    118-146 (318)
159 cd05042 PTKc_Aatyk Catalytic d  95.2   0.011 2.5E-07   43.3   1.9   17   11-27    120-136 (269)
160 cd06625 STKc_MEKK3_like Cataly  95.2   0.013 2.8E-07   42.6   2.1   28   11-60    124-151 (263)
161 cd08215 STKc_Nek Catalytic dom  95.2   0.011 2.3E-07   42.3   1.7   30   11-62    123-152 (258)
162 cd05613 STKc_MSK1_N N-terminal  95.2   0.011 2.5E-07   43.9   1.9   28   11-60    125-152 (290)
163 cd06622 PKc_MAPKK_PBS2_like Ca  95.2   0.012 2.7E-07   43.5   2.1   30   10-61    122-151 (286)
164 cd05060 PTKc_Syk_like Catalyti  95.2   0.015 3.2E-07   42.4   2.4   29   11-61    115-143 (257)
165 cd06627 STKc_Cdc7_like Catalyt  95.2   0.011 2.4E-07   42.4   1.6   29   11-61    119-147 (254)
166 cd05099 PTKc_FGFR4 Catalytic d  95.2   0.014 3.1E-07   44.3   2.3   29   11-61    154-182 (314)
167 cd05588 STKc_aPKC Catalytic do  95.1   0.011 2.3E-07   45.7   1.5   29   11-61    116-144 (329)
168 cd05096 PTKc_DDR1 Catalytic do  95.1    0.01 2.2E-07   44.7   1.3   17   11-27    158-174 (304)
169 cd05607 STKc_GRK7 Catalytic do  95.1   0.018 3.9E-07   43.0   2.6   28   11-60    115-142 (277)
170 cd07857 STKc_MPK1 Catalytic do  95.1  0.0082 1.8E-07   46.0   0.8   17   11-27    125-141 (332)
171 PHA03209 serine/threonine kina  95.1   0.012 2.7E-07   46.0   1.8   29   11-61    177-205 (357)
172 cd08219 STKc_Nek3 Catalytic do  95.1   0.014   3E-07   42.4   2.0   29   11-61    120-148 (255)
173 cd05040 PTKc_Ack_like Catalyti  95.1   0.012 2.6E-07   42.7   1.6   17   11-27    117-133 (257)
174 cd06638 STKc_myosinIIIA Cataly  95.1   0.011 2.3E-07   43.7   1.4   28   11-60    144-171 (286)
175 cd07832 STKc_CCRK Catalytic do  95.1   0.014   3E-07   42.9   2.0   17   11-27    119-135 (286)
176 cd05596 STKc_ROCK Catalytic do  95.1   0.013 2.8E-07   46.2   1.9   28   11-60    162-189 (370)
177 cd05589 STKc_PKN Catalytic dom  95.1   0.011 2.4E-07   45.2   1.5   29   11-61    121-149 (324)
178 cd05062 PTKc_IGF-1R Catalytic   95.0   0.011 2.4E-07   43.7   1.3   17   11-27    139-155 (277)
179 cd05583 STKc_MSK_N N-terminal   95.0   0.013 2.9E-07   43.5   1.8   28   11-60    125-152 (288)
180 cd05615 STKc_cPKC_alpha Cataly  95.0   0.012 2.7E-07   45.1   1.7   29   11-61    121-149 (323)
181 cd05609 STKc_MAST Catalytic do  95.0   0.013 2.8E-07   44.2   1.8   29   11-61    121-149 (305)
182 cd05038 PTKc_Jak_rpt2 Catalyti  95.0   0.015 3.3E-07   42.6   2.0   30   11-62    129-158 (284)
183 cd05037 PTK_Jak_rpt1 Pseudokin  95.0   0.015 3.2E-07   42.1   1.9   17   11-27    121-137 (259)
184 KOG2345|consensus               95.0   0.017 3.7E-07   46.1   2.4   72   11-106   149-226 (302)
185 cd05079 PTKc_Jak1_rpt2 Catalyt  95.0   0.014 3.1E-07   43.3   1.9   17   11-27    129-145 (284)
186 PHA03207 serine/threonine kina  95.0  0.0096 2.1E-07   47.2   1.0   28   11-60    205-232 (392)
187 cd05580 STKc_PKA Catalytic dom  95.0   0.014 3.1E-07   43.6   1.9   31   10-62    120-150 (290)
188 cd07853 STKc_NLK Catalytic dom  95.0   0.013 2.8E-07   45.8   1.7   28   11-60    123-150 (372)
189 cd05041 PTKc_Fes_like Catalyti  95.0   0.018 3.8E-07   41.7   2.2   29   11-61    113-141 (251)
190 cd05626 STKc_LATS2 Catalytic d  95.0   0.014 3.1E-07   45.9   1.9   29   11-61    121-149 (381)
191 cd05608 STKc_GRK1 Catalytic do  95.0   0.012 2.6E-07   44.0   1.4   28   11-60    117-144 (280)
192 cd05057 PTKc_EGFR_like Catalyt  95.0   0.017 3.6E-07   42.8   2.2   18   10-27    128-145 (279)
193 cd05118 STKc_CMGC Catalytic do  95.0   0.017 3.7E-07   42.3   2.2   29   11-61    118-146 (283)
194 cd05633 STKc_GRK3 Catalytic do  95.0    0.01 2.2E-07   44.4   1.0   16   12-27    118-133 (279)
195 cd07867 STKc_CDC2L6 Catalytic   94.9   0.017 3.7E-07   43.4   2.1   16   11-26    128-143 (317)
196 cd06652 STKc_MEKK2 Catalytic d  94.9   0.012 2.6E-07   43.1   1.3   28   12-61    127-154 (265)
197 cd07834 STKc_MAPK Catalytic do  94.9   0.012 2.5E-07   44.8   1.2   17   11-27    123-139 (330)
198 cd05632 STKc_GRK5 Catalytic do  94.9   0.015 3.2E-07   43.6   1.8   28   11-60    122-149 (285)
199 cd05093 PTKc_TrkB Catalytic do  94.9   0.017 3.7E-07   43.1   2.1   17   11-27    140-156 (288)
200 cd05034 PTKc_Src_like Catalyti  94.9   0.014 3.1E-07   42.4   1.7   28   11-60    123-150 (261)
201 cd05112 PTKc_Itk Catalytic dom  94.9   0.013 2.9E-07   42.4   1.5   17   11-27    120-136 (256)
202 cd05054 PTKc_VEGFR Catalytic d  94.9    0.02 4.4E-07   44.5   2.6   29   11-61    193-221 (337)
203 KOG4250|consensus               94.9   0.018   4E-07   50.8   2.5   18   11-28    140-157 (732)
204 cd07848 STKc_CDKL5 Catalytic d  94.9   0.015 3.4E-07   43.0   1.8   17   11-27    120-136 (287)
205 cd07866 STKc_BUR1 Catalytic do  94.9   0.012 2.6E-07   43.8   1.2   17   11-27    135-151 (311)
206 cd06615 PKc_MEK Catalytic doma  94.9   0.018 3.9E-07   43.7   2.1   17   11-27    120-136 (308)
207 cd05033 PTKc_EphR Catalytic do  94.9   0.015 3.2E-07   42.6   1.6   17   11-27    126-142 (266)
208 cd05114 PTKc_Tec_Rlk Catalytic  94.9   0.015 3.1E-07   42.5   1.5   29   11-61    120-148 (256)
209 KOG0984|consensus               94.9  0.0063 1.4E-07   47.7  -0.4   37    4-62    162-198 (282)
210 PHA03210 serine/threonine kina  94.8   0.015 3.2E-07   48.2   1.8   28   11-60    287-314 (501)
211 cd05056 PTKc_FAK Catalytic dom  94.8   0.019 4.1E-07   42.2   2.1   17   11-27    127-143 (270)
212 cd05097 PTKc_DDR_like Catalyti  94.8   0.018 3.8E-07   43.2   2.0   17   11-27    149-165 (295)
213 cd07841 STKc_CDK7 Catalytic do  94.8    0.02 4.3E-07   42.6   2.3   17   11-27    122-138 (298)
214 cd07870 STKc_PFTAIRE2 Catalyti  94.8   0.016 3.4E-07   43.2   1.6   17   11-27    123-139 (291)
215 cd07839 STKc_CDK5 Catalytic do  94.8   0.014 3.1E-07   43.1   1.4   17   11-27    119-135 (284)
216 cd05148 PTKc_Srm_Brk Catalytic  94.8   0.019 4.2E-07   41.7   2.0   29   11-61    124-152 (261)
217 cd06654 STKc_PAK1 Catalytic do  94.8   0.012 2.5E-07   44.5   0.8   29   11-61    136-164 (296)
218 cd05059 PTKc_Tec_like Catalyti  94.8   0.015 3.2E-07   42.5   1.3   28   12-61    121-148 (256)
219 cd06617 PKc_MKK3_6 Catalytic d  94.7   0.019 4.2E-07   42.2   2.0   18   10-27    123-140 (283)
220 cd05094 PTKc_TrkC Catalytic do  94.7   0.019 4.2E-07   42.9   2.0   17   11-27    143-159 (291)
221 cd05116 PTKc_Syk Catalytic dom  94.7   0.018 3.9E-07   42.1   1.8   17   11-27    115-131 (257)
222 cd08216 PK_STRAD Pseudokinase   94.7   0.024 5.3E-07   42.6   2.5   17   11-27    121-137 (314)
223 cd06613 STKc_MAP4K3_like Catal  94.7   0.019 4.2E-07   41.5   1.9   17   11-27    121-137 (262)
224 cd05035 PTKc_Axl_like Catalyti  94.7   0.019   4E-07   41.9   1.8   29   11-61    133-161 (273)
225 cd05048 PTKc_Ror Catalytic Dom  94.7   0.019 4.1E-07   42.4   1.9   17   11-27    144-160 (283)
226 cd06637 STKc_TNIK Catalytic do  94.7   0.012 2.7E-07   43.0   0.8   29   11-61    131-159 (272)
227 cd05072 PTKc_Lyn Catalytic dom  94.7   0.017 3.8E-07   42.1   1.6   17   11-27    123-139 (261)
228 cd05578 STKc_Yank1 Catalytic d  94.7   0.019 4.1E-07   41.8   1.8   30   11-62    120-149 (258)
229 cd05111 PTK_HER3 Pseudokinase   94.7   0.023   5E-07   42.3   2.2   16   12-27    130-145 (279)
230 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  94.7   0.017 3.8E-07   42.7   1.5   17   11-27    128-144 (284)
231 cd06635 STKc_TAO1 Catalytic do  94.7   0.022 4.9E-07   43.3   2.2   28   11-60    145-172 (317)
232 cd05581 STKc_PDK1 Catalytic do  94.7   0.016 3.4E-07   42.3   1.3   29   11-61    122-150 (280)
233 cd05087 PTKc_Aatyk1_Aatyk3 Cat  94.7   0.022 4.8E-07   41.9   2.1   17   11-27    120-136 (269)
234 cd06644 STKc_STK10_LOK Catalyt  94.6   0.025 5.4E-07   42.2   2.3   18   10-27    129-146 (292)
235 cd05047 PTKc_Tie Catalytic dom  94.6   0.022 4.7E-07   42.0   2.0   18   10-27    131-148 (270)
236 cd05088 PTKc_Tie2 Catalytic do  94.6   0.017 3.7E-07   43.7   1.4   29   10-60    143-171 (303)
237 cd05579 STKc_MAST_like Catalyt  94.6   0.021 4.6E-07   41.1   1.8   30   10-61    112-141 (265)
238 cd07833 STKc_CDKL Catalytic do  94.6   0.026 5.7E-07   41.5   2.3   30   11-62    120-149 (288)
239 cd06639 STKc_myosinIIIB Cataly  94.6   0.023 4.9E-07   42.3   2.0   29   11-61    148-176 (291)
240 smart00220 S_TKc Serine/Threon  94.6   0.018 3.9E-07   40.3   1.4   31   11-63    107-137 (244)
241 cd05619 STKc_nPKC_theta Cataly  94.6   0.019 4.1E-07   44.1   1.6   28   11-60    116-143 (316)
242 cd06618 PKc_MKK7 Catalytic dom  94.6   0.018 3.9E-07   43.2   1.4   29   11-61    135-163 (296)
243 cd05049 PTKc_Trk Catalytic dom  94.6   0.023 5.1E-07   41.7   2.0   17   11-27    142-158 (280)
244 cd05058 PTKc_Met_Ron Catalytic  94.6    0.02 4.3E-07   41.7   1.6   17   11-27    118-134 (262)
245 cd05123 STKc_AGC Catalytic dom  94.6   0.031 6.7E-07   40.2   2.6   30   10-61    112-141 (250)
246 cd05095 PTKc_DDR2 Catalytic do  94.5   0.024 5.3E-07   42.5   2.1   17   11-27    150-166 (296)
247 cd05605 STKc_GRK4_like Catalyt  94.5   0.021 4.5E-07   42.8   1.7   29   11-61    122-150 (285)
248 cd07844 STKc_PCTAIRE_like Cata  94.5   0.017 3.7E-07   42.9   1.2   17   11-27    123-139 (291)
249 cd07845 STKc_CDK10 Catalytic d  94.5   0.017 3.6E-07   43.6   1.2   17   11-27    128-144 (309)
250 PTZ00036 glycogen synthase kin  94.5   0.022 4.7E-07   46.3   1.9   16   11-26    190-205 (440)
251 cd05101 PTKc_FGFR2 Catalytic d  94.5   0.025 5.4E-07   42.6   2.1   17   11-27    157-173 (304)
252 cd05032 PTKc_InsR_like Catalyt  94.5   0.021 4.6E-07   41.8   1.7   17   11-27    139-155 (277)
253 cd07850 STKc_JNK Catalytic dom  94.5   0.019 4.2E-07   44.4   1.5   17   11-27    138-154 (353)
254 cd06643 STKc_SLK Catalytic dom  94.5   0.031 6.7E-07   41.4   2.5   29   11-61    123-151 (282)
255 cd05044 PTKc_c-ros Catalytic d  94.5   0.023 4.9E-07   41.5   1.7   34   11-61    126-159 (269)
256 cd08221 STKc_Nek9 Catalytic do  94.5    0.02 4.4E-07   41.5   1.5   17   11-27    121-137 (256)
257 cd08228 STKc_Nek6 Catalytic do  94.5   0.021 4.5E-07   41.7   1.5   17   11-27    126-142 (267)
258 cd05110 PTKc_HER4 Catalytic do  94.5   0.025 5.4E-07   42.7   2.0   17   11-27    129-145 (303)
259 cd05073 PTKc_Hck Catalytic dom  94.5    0.02 4.3E-07   42.0   1.4   17   11-27    122-138 (260)
260 cd05090 PTKc_Ror1 Catalytic do  94.4   0.024 5.3E-07   42.0   1.9   17   11-27    144-160 (283)
261 cd05630 STKc_GRK6 Catalytic do  94.4   0.026 5.6E-07   42.4   2.0   29   11-61    122-150 (285)
262 cd05074 PTKc_Tyro3 Catalytic d  94.4   0.027 5.8E-07   41.2   2.1   17   11-27    133-149 (273)
263 cd06614 STKc_PAK Catalytic dom  94.4   0.025 5.5E-07   42.0   1.9   30   10-61    135-164 (286)
264 cd06641 STKc_MST3 Catalytic do  94.4   0.027 5.9E-07   41.7   2.1   30   10-61    120-149 (277)
265 cd06646 STKc_MAP4K5 Catalytic   94.4   0.019 4.1E-07   42.0   1.2   17   11-27    126-142 (267)
266 cd06619 PKc_MKK5 Catalytic dom  94.4   0.026 5.6E-07   41.9   1.9   17   11-27    115-131 (279)
267 PHA03211 serine/threonine kina  94.4   0.023   5E-07   47.1   1.8   28   11-60    280-307 (461)
268 cd05050 PTKc_Musk Catalytic do  94.4   0.021 4.6E-07   42.4   1.4   18   10-27    149-166 (288)
269 cd08529 STKc_FA2-like Catalyti  94.4    0.03 6.5E-07   40.4   2.2   18   10-27    120-137 (256)
270 cd05100 PTKc_FGFR3 Catalytic d  94.3   0.028   6E-07   43.1   2.1   17   11-27    154-170 (334)
271 cd06645 STKc_MAP4K3 Catalytic   94.3   0.021 4.6E-07   41.7   1.3   17   11-27    126-142 (267)
272 cd05089 PTKc_Tie1 Catalytic do  94.3   0.024 5.3E-07   42.6   1.7   17   11-27    139-155 (297)
273 cd07846 STKc_CDKL2_3 Catalytic  94.3   0.027 5.9E-07   41.5   1.9   29   11-61    120-148 (286)
274 smart00221 STYKc Protein kinas  94.3   0.024 5.2E-07   39.7   1.5   32   11-64    118-149 (225)
275 cd05086 PTKc_Aatyk2 Catalytic   94.3   0.033 7.2E-07   41.1   2.3   17   11-27    119-135 (268)
276 cd06616 PKc_MKK4 Catalytic dom  94.3   0.025 5.4E-07   41.9   1.7   18   10-27    127-144 (288)
277 cd06629 STKc_MAPKKK_Bck1_like   94.2   0.035 7.5E-07   40.7   2.3   17   11-27    128-144 (272)
278 cd08224 STKc_Nek6_Nek7 Catalyt  94.2   0.031 6.8E-07   40.5   2.0   17   11-27    126-142 (267)
279 cd06655 STKc_PAK2 Catalytic do  94.2   0.021 4.5E-07   43.2   1.2   29   11-61    135-163 (296)
280 cd05063 PTKc_EphR_A2 Catalytic  94.2   0.027 5.9E-07   41.2   1.7   17   11-27    127-143 (268)
281 cd05103 PTKc_VEGFR2 Catalytic   94.2   0.043 9.3E-07   42.5   2.9   29   11-61    199-227 (343)
282 cd07835 STKc_CDK1_like Catalyt  94.2   0.028 6.1E-07   41.4   1.8   17   11-27    119-135 (283)
283 cd06612 STKc_MST1_2 Catalytic   94.2   0.031 6.7E-07   40.3   2.0   17   11-27    119-135 (256)
284 cd05067 PTKc_Lck_Blk Catalytic  94.2   0.027 5.9E-07   41.1   1.7   17   11-27    122-138 (260)
285 cd07879 STKc_p38delta_MAPK13 C  94.2   0.024 5.3E-07   43.8   1.5   29   11-61    137-165 (342)
286 PLN03225 Serine/threonine-prot  94.2    0.03 6.5E-07   47.6   2.1   30   11-61    275-304 (566)
287 cd05115 PTKc_Zap-70 Catalytic   94.2   0.034 7.3E-07   40.9   2.1   17   11-27    115-131 (257)
288 cd06658 STKc_PAK5 Catalytic do  94.2   0.025 5.5E-07   42.6   1.5   28   11-60    138-165 (292)
289 cd05106 PTKc_CSF-1R Catalytic   94.2   0.041 8.9E-07   43.5   2.8   28   11-60    232-259 (374)
290 cd06636 STKc_MAP4K4_6 Catalyti  94.2   0.024 5.3E-07   41.8   1.4   29   11-61    141-169 (282)
291 cd08218 STKc_Nek1 Catalytic do  94.1   0.033 7.1E-07   40.4   2.0   29   11-61    121-149 (256)
292 cd05051 PTKc_DDR Catalytic dom  94.1   0.025 5.4E-07   42.0   1.4   17   11-27    150-166 (296)
293 cd08229 STKc_Nek7 Catalytic do  94.1   0.027 5.9E-07   41.1   1.6   17   11-27    126-142 (267)
294 cd06633 STKc_TAO3 Catalytic do  94.1   0.037 8.1E-07   42.1   2.4   29   11-61    141-169 (313)
295 cd06648 STKc_PAK_II Catalytic   94.1   0.031 6.6E-07   41.9   1.9   28   11-60    135-162 (285)
296 KOG0603|consensus               94.1   0.045 9.7E-07   47.7   3.0   35   10-66    434-469 (612)
297 cd07861 STKc_CDK1_euk Catalyti  94.1   0.024 5.2E-07   41.7   1.2   17   11-27    121-137 (285)
298 cd05055 PTKc_PDGFR Catalytic d  94.1   0.027 5.9E-07   42.7   1.5   17   11-27    161-177 (302)
299 cd05570 STKc_PKC Catalytic dom  94.1   0.026 5.7E-07   43.2   1.4   29   11-61    116-144 (318)
300 cd05606 STKc_beta_ARK Catalyti  94.1   0.026 5.7E-07   42.1   1.4   17   11-27    117-133 (278)
301 cd07849 STKc_ERK1_2_like Catal  94.1   0.023 4.9E-07   43.7   1.1   17   11-27    126-142 (336)
302 cd06657 STKc_PAK4 Catalytic do  94.0   0.027 5.8E-07   42.6   1.4   28   11-60    136-163 (292)
303 cd05572 STKc_cGK_PKG Catalytic  94.0   0.028   6E-07   41.0   1.5   30   11-62    113-142 (262)
304 cd07836 STKc_Pho85 Catalytic d  94.0   0.032 6.9E-07   41.1   1.8   17   11-27    120-136 (284)
305 cd06640 STKc_MST4 Catalytic do  94.0    0.03 6.4E-07   41.5   1.6   17   11-27    121-137 (277)
306 cd07838 STKc_CDK4_6_like Catal  94.0    0.04 8.7E-07   40.4   2.3   28   11-60    127-154 (287)
307 cd07880 STKc_p38gamma_MAPK12 C  94.0   0.034 7.3E-07   43.1   2.0   29   11-61    138-166 (343)
308 cd07843 STKc_CDC2L1 Catalytic   94.0   0.031 6.7E-07   41.6   1.7   17   11-27    126-142 (293)
309 cd05098 PTKc_FGFR1 Catalytic d  94.0   0.024 5.2E-07   42.8   1.1   17   11-27    160-176 (307)
310 cd06621 PKc_MAPKK_Pek1_like Ca  93.9   0.034 7.3E-07   41.5   1.8   29   11-61    125-153 (287)
311 cd05045 PTKc_RET Catalytic dom  93.9   0.032 6.9E-07   41.6   1.6   17   11-27    147-163 (290)
312 PHA03390 pk1 serine/threonine-  93.9    0.04 8.7E-07   40.9   2.1   28   11-60    129-157 (267)
313 cd05577 STKc_GRK Catalytic dom  93.9   0.024 5.2E-07   42.0   0.9   28   11-60    115-142 (277)
314 cd07847 STKc_CDKL1_4 Catalytic  93.9   0.035 7.5E-07   40.8   1.7   17   11-27    120-136 (286)
315 cd06631 STKc_YSK4 Catalytic do  93.9   0.026 5.7E-07   41.2   1.0   28   12-61    123-150 (265)
316 cd07852 STKc_MAPK15 Catalytic   93.8    0.04 8.6E-07   42.3   2.0   17   11-27    127-143 (337)
317 cd06659 STKc_PAK6 Catalytic do  93.8   0.035 7.5E-07   42.0   1.7   28   11-60    137-164 (297)
318 cd06623 PKc_MAPKK_plant_like C  93.8   0.026 5.6E-07   40.8   1.0   30   10-61    119-148 (264)
319 cd06632 STKc_MEKK1_plant Catal  93.8   0.031 6.6E-07   40.3   1.3   17   11-27    122-138 (258)
320 cd07837 STKc_CdkB_plant Cataly  93.8   0.046 9.9E-07   40.5   2.3   16   11-26    130-145 (295)
321 cd08530 STKc_CNK2-like Catalyt  93.8   0.051 1.1E-06   39.1   2.4   28   11-60    123-150 (256)
322 PTZ00283 serine/threonine prot  93.8   0.042 9.1E-07   45.6   2.2   28   11-60    163-190 (496)
323 cd05036 PTKc_ALK_LTK Catalytic  93.7   0.051 1.1E-06   40.2   2.4   17   11-27    136-152 (277)
324 cd05610 STKc_MASTL Catalytic d  93.7   0.041 8.9E-07   47.4   2.2   30   11-62    124-153 (669)
325 cd06610 STKc_OSR1_SPAK Catalyt  93.7   0.035 7.5E-07   40.2   1.4   29   11-61    122-150 (267)
326 cd06608 STKc_myosinIII_like Ca  93.7   0.027 5.9E-07   40.8   0.9   29   11-61    133-161 (275)
327 KOG0658|consensus               93.7   0.038 8.2E-07   45.4   1.8   18   10-27    144-161 (364)
328 cd05611 STKc_Rim15_like Cataly  93.7   0.039 8.4E-07   40.2   1.7   17   11-27    117-133 (260)
329 cd05104 PTKc_Kit Catalytic dom  93.7   0.051 1.1E-06   42.9   2.5   17   11-27    234-250 (375)
330 cd06626 STKc_MEKK4 Catalytic d  93.7   0.032 6.9E-07   40.4   1.2   17   11-27    119-135 (264)
331 cd05092 PTKc_TrkA Catalytic do  93.7   0.036 7.7E-07   41.2   1.5   17   11-27    142-158 (280)
332 cd06634 STKc_TAO2 Catalytic do  93.6   0.033 7.1E-07   42.2   1.3   29   11-61    135-163 (308)
333 cd06651 STKc_MEKK3 Catalytic d  93.6   0.036 7.8E-07   40.7   1.4   17   11-27    126-142 (266)
334 cd07830 STKc_MAK_like Catalyti  93.6   0.049 1.1E-06   40.0   2.2   17   11-27    119-135 (283)
335 cd07851 STKc_p38 Catalytic dom  93.6   0.035 7.6E-07   42.9   1.4   29   11-61    138-166 (343)
336 cd07842 STKc_CDK8_like Catalyt  93.6   0.031 6.8E-07   41.7   1.1   16   11-26    128-143 (316)
337 cd05576 STKc_RPK118_like Catal  93.6   0.042 9.1E-07   40.0   1.7   18   10-27    104-121 (237)
338 cd05061 PTKc_InsR Catalytic do  93.6   0.037   8E-07   41.3   1.4   17   11-27    139-155 (288)
339 cd07865 STKc_CDK9 Catalytic do  93.5   0.035 7.5E-07   41.3   1.2   17   11-27    139-155 (310)
340 KOG0610|consensus               93.5   0.058 1.2E-06   45.4   2.6   32   10-63    198-229 (459)
341 KOG1235|consensus               93.5    0.06 1.3E-06   46.2   2.8   33   12-62    322-354 (538)
342 cd07860 STKc_CDK2_3 Catalytic   93.5   0.044 9.5E-07   40.4   1.8   17   11-27    120-136 (284)
343 cd06607 STKc_TAO Catalytic dom  93.5   0.063 1.4E-06   40.5   2.6   29   11-61    135-163 (307)
344 cd07864 STKc_CDK12 Catalytic d  93.5   0.036 7.9E-07   41.2   1.3   17   11-27    136-152 (302)
345 cd06653 STKc_MEKK3_like_1 Cata  93.5   0.035 7.6E-07   40.7   1.2   17   11-27    126-142 (264)
346 cd06917 STKc_NAK1_like Catalyt  93.5   0.034 7.3E-07   40.9   1.0   18   10-27    120-137 (277)
347 cd06628 STKc_MAPKKK_Byr2_like   93.5   0.034 7.3E-07   40.6   1.0   17   11-27    126-142 (267)
348 cd07877 STKc_p38alpha_MAPK14 C  93.4   0.054 1.2E-06   42.0   2.2   17   11-27    140-156 (345)
349 cd07856 STKc_Sty1_Hog1 Catalyt  93.4   0.037   8E-07   42.7   1.2   17   11-27    128-144 (328)
350 cd06642 STKc_STK25-YSK1 Cataly  93.4   0.065 1.4E-06   39.6   2.4   17   11-27    121-137 (277)
351 KOG0983|consensus               93.3   0.033 7.2E-07   45.4   0.9   37    3-61    204-240 (391)
352 KOG0608|consensus               93.3   0.053 1.1E-06   48.5   2.2   32    8-61    746-777 (1034)
353 cd06624 STKc_ASK Catalytic dom  93.3   0.054 1.2E-06   39.7   1.9   16   11-26    128-143 (268)
354 KOG1006|consensus               93.3   0.016 3.5E-07   46.9  -0.9   38    3-62    180-217 (361)
355 cd05046 PTK_CCK4 Pseudokinase   93.3   0.057 1.2E-06   39.6   2.0   17   11-27    137-153 (275)
356 PRK09902 hypothetical protein;  93.3   0.048   1E-06   41.9   1.6   44   10-73    147-195 (216)
357 cd07840 STKc_CDK9_like Catalyt  93.2    0.04 8.6E-07   40.3   1.1   17   11-27    120-136 (287)
358 PLN03224 probable serine/threo  93.2   0.062 1.3E-06   45.5   2.3   28   11-60    329-356 (507)
359 cd05065 PTKc_EphR_B Catalytic   93.1   0.066 1.4E-06   39.3   2.1   18   10-27    125-142 (269)
360 cd05043 PTK_Ryk Pseudokinase d  93.1   0.053 1.1E-06   40.0   1.6   17   11-27    137-153 (280)
361 PTZ00284 protein kinase; Provi  93.1   0.048   1E-06   44.3   1.5   18   10-27    251-268 (467)
362 cd07858 STKc_TEY_MAPK_plant Ca  93.0   0.047   1E-06   42.0   1.3   17   11-27    128-144 (337)
363 cd06647 STKc_PAK_I Catalytic d  93.0   0.052 1.1E-06   40.9   1.5   17   11-27    135-151 (293)
364 cd06606 STKc_MAPKKK Catalytic   93.0   0.038 8.3E-07   39.3   0.8   18   10-27    120-137 (260)
365 COG0478 RIO-like serine/threon  93.0   0.069 1.5E-06   43.0   2.3   31    9-61    220-250 (304)
366 cd07855 STKc_ERK5 Catalytic do  93.0   0.049 1.1E-06   41.8   1.4   17   11-27    127-143 (334)
367 cd05105 PTKc_PDGFR_alpha Catal  93.0    0.07 1.5E-06   43.1   2.3   16   12-27    258-273 (400)
368 COG3281 Ble Uncharacterized pr  92.9   0.059 1.3E-06   44.9   1.8   42   12-76    286-336 (438)
369 KOG0581|consensus               92.9   0.028   6E-07   46.3  -0.2   43    9-75    197-239 (364)
370 PLN00181 protein SPA1-RELATED;  92.8   0.089 1.9E-06   45.9   2.8   18   10-27     99-116 (793)
371 cd06609 STKc_MST3_like Catalyt  92.7   0.054 1.2E-06   39.8   1.2   17   11-27    118-134 (274)
372 PLN00009 cyclin-dependent kina  92.7   0.096 2.1E-06   39.0   2.5   16   11-26    122-137 (294)
373 PRK13184 pknD serine/threonine  92.6   0.078 1.7E-06   48.2   2.3   30   11-62    133-162 (932)
374 KOG1163|consensus               92.6   0.089 1.9E-06   42.3   2.3   33   10-61    130-162 (341)
375 KOG3087|consensus               92.5    0.15 3.1E-06   39.5   3.3   34   11-63    133-166 (229)
376 PTZ00024 cyclin-dependent prot  92.4   0.058 1.3E-06   41.2   1.1   17   11-27    139-155 (335)
377 cd07831 STKc_MOK Catalytic dom  92.4   0.083 1.8E-06   38.7   1.8   16   11-26    120-135 (282)
378 KOG0588|consensus               92.3   0.062 1.4E-06   47.6   1.3   34   10-65    131-164 (786)
379 cd05077 PTK_Jak1_rpt1 Pseudoki  92.2     0.1 2.2E-06   38.5   2.1   17   11-27    125-141 (262)
380 cd05107 PTKc_PDGFR_beta Cataly  92.2     0.1 2.2E-06   42.2   2.3   17   11-27    259-275 (401)
381 KOG0599|consensus               92.1   0.073 1.6E-06   43.5   1.3   39   12-72    144-182 (411)
382 KOG0596|consensus               92.1    0.11 2.4E-06   45.4   2.4   29   10-61    479-507 (677)
383 KOG0592|consensus               92.0     0.1 2.2E-06   45.2   2.2   18   10-27    193-210 (604)
384 cd07829 STKc_CDK_like Catalyti  91.9    0.11 2.4E-06   38.0   2.0   16   12-27    119-134 (282)
385 KOG0593|consensus               91.9   0.097 2.1E-06   43.1   1.8   28   12-61    122-149 (396)
386 cd08225 STKc_Nek5 Catalytic do  91.8   0.073 1.6E-06   38.4   0.9   17   11-27    121-137 (257)
387 KOG1166|consensus               91.7    0.18 3.9E-06   46.2   3.5   36   10-60    813-848 (974)
388 cd06630 STKc_MEKK1 Catalytic d  91.6     0.1 2.2E-06   38.0   1.5   16   11-26    123-138 (268)
389 cd08222 STKc_Nek11 Catalytic d  91.5   0.098 2.1E-06   38.0   1.3   16   11-26    126-141 (260)
390 KOG1164|consensus               91.4    0.11 2.5E-06   40.4   1.7   36    9-61    140-175 (322)
391 cd08220 STKc_Nek8 Catalytic do  91.3     0.1 2.3E-06   37.5   1.3   16   11-26    121-136 (256)
392 cd05064 PTKc_EphR_A10 Catalyti  91.2    0.14   3E-06   37.8   1.9   17   11-27    127-143 (266)
393 KOG1035|consensus               91.0    0.14   3E-06   48.0   2.0   30   11-62    717-746 (1351)
394 KOG0660|consensus               90.9    0.12 2.5E-06   42.6   1.3   33   10-64    144-176 (359)
395 KOG0668|consensus               90.9    0.11 2.4E-06   41.6   1.1   37   11-68    152-188 (338)
396 cd06611 STKc_SLK_like Catalyti  90.8    0.13 2.7E-06   38.0   1.4   17   11-27    123-139 (280)
397 KOG0616|consensus               90.6    0.18   4E-06   41.2   2.2   29   11-61    164-192 (355)
398 cd06620 PKc_MAPKK_Byr1_like Ca  90.5    0.14   3E-06   38.0   1.3   17   11-27    124-140 (284)
399 PRK14705 glycogen branching en  90.4    0.21 4.5E-06   46.7   2.6   35    8-59    329-363 (1224)
400 COG5072 ALK1 Serine/threonine   90.1    0.13 2.9E-06   43.4   1.1   45    4-71    335-379 (488)
401 cd05078 PTK_Jak2_Jak3_rpt1 Pse  89.9    0.25 5.3E-06   36.1   2.2   17   11-27    120-136 (258)
402 KOG0659|consensus               89.7    0.21 4.6E-06   40.3   1.9   29   12-62    122-150 (318)
403 KOG0615|consensus               89.6    0.19 4.2E-06   42.4   1.6   18   10-27    295-312 (475)
404 cd07854 STKc_MAPK4_6 Catalytic  89.6    0.13 2.9E-06   39.7   0.6   16   11-26    134-149 (342)
405 KOG0032|consensus               89.5    0.22 4.8E-06   40.7   1.9   38   10-65    154-191 (382)
406 cd08227 PK_STRAD_alpha Pseudok  89.3    0.29 6.2E-06   37.4   2.3   17   11-27    121-137 (327)
407 KOG0595|consensus               89.2    0.38 8.3E-06   40.4   3.1   41   11-67    129-169 (429)
408 KOG0598|consensus               89.1    0.15 3.2E-06   42.0   0.6   18   10-27    144-161 (357)
409 PHA02988 hypothetical protein;  89.1    0.21 4.6E-06   37.6   1.5   15   13-27    145-159 (283)
410 COG2187 Uncharacterized protei  88.9    0.28   6E-06   39.9   2.0   20    7-26    206-225 (337)
411 KOG0578|consensus               88.9    0.35 7.7E-06   41.8   2.7   31   10-62    388-418 (550)
412 KOG0605|consensus               88.8    0.19 4.1E-06   43.3   1.0   32    8-61    258-289 (550)
413 cd08226 PK_STRAD_beta Pseudoki  88.7    0.25 5.5E-06   37.7   1.6   17   11-27    121-137 (328)
414 COG3231 Aph Aminoglycoside pho  88.7    0.52 1.1E-05   37.3   3.3   44    8-73    183-226 (266)
415 KOG0198|consensus               88.7    0.33 7.1E-06   39.0   2.3   16   11-26    137-152 (313)
416 KOG0665|consensus               88.5    0.27 5.7E-06   40.5   1.7   32    9-62    136-167 (369)
417 KOG0582|consensus               88.5    0.31 6.8E-06   41.6   2.1   17   11-27    146-162 (516)
418 KOG1187|consensus               87.8    0.34 7.4E-06   39.1   1.9   19   10-28    196-214 (361)
419 KOG0579|consensus               87.7    0.32 6.9E-06   43.9   1.8   17   11-27    150-166 (1187)
420 COG1718 RIO1 Serine/threonine   87.5    0.36 7.7E-06   38.3   1.8   27   11-60    187-213 (268)
421 cd05076 PTK_Tyk2_rpt1 Pseudoki  87.3    0.47   1E-05   35.3   2.3   17   11-27    137-153 (274)
422 KOG1167|consensus               87.0    0.38 8.3E-06   40.3   1.8   32   10-62    151-182 (418)
423 KOG0586|consensus               86.5    0.35 7.7E-06   42.1   1.4   31   10-62    174-204 (596)
424 KOG0604|consensus               86.3    0.37   8E-06   39.7   1.3   36   11-65    181-216 (400)
425 KOG0577|consensus               86.2    0.32 6.9E-06   43.4   1.0   33   11-65    146-178 (948)
426 KOG2268|consensus               85.6    0.61 1.3E-05   39.1   2.2   27   11-59    222-248 (465)
427 KOG4236|consensus               85.5    0.61 1.3E-05   41.2   2.3   33   11-62    684-716 (888)
428 KOG1151|consensus               85.1     0.8 1.7E-05   39.8   2.8   30   12-60    591-620 (775)
429 COG0515 SPS1 Serine/threonine   84.9    0.53 1.1E-05   32.9   1.4   28   12-61    122-150 (384)
430 KOG0663|consensus               84.2    0.71 1.5E-05   38.5   2.0   18   10-27    196-213 (419)
431 KOG0607|consensus               84.2    0.79 1.7E-05   38.3   2.3   32   11-61    196-227 (463)
432 KOG0192|consensus               83.6    0.82 1.8E-05   37.2   2.2   16   12-27    164-179 (362)
433 KOG0661|consensus               83.5     0.6 1.3E-05   40.1   1.4   17   10-26    129-145 (538)
434 KOG0666|consensus               83.5    0.97 2.1E-05   37.6   2.6   16   12-27    153-168 (438)
435 KOG0600|consensus               83.3    0.87 1.9E-05   39.4   2.3   29   11-61    238-266 (560)
436 KOG0671|consensus               83.2     1.2 2.6E-05   37.4   3.0   48   10-60    211-259 (415)
437 COG3001 Uncharacterized protei  83.1     0.8 1.7E-05   36.5   1.9   64    3-97    180-245 (286)
438 KOG0585|consensus               82.8    0.86 1.9E-05   39.4   2.1   17   11-27    230-246 (576)
439 KOG0612|consensus               82.0    0.81 1.7E-05   43.0   1.7   20    8-27    192-211 (1317)
440 PTZ00266 NIMA-related protein   81.8    0.79 1.7E-05   42.3   1.6   17   11-27    145-161 (1021)
441 KOG0664|consensus               81.6    0.93   2E-05   37.3   1.8   17   11-27    176-192 (449)
442 PF07714 Pkinase_Tyr:  Protein   81.3       1 2.2E-05   33.2   1.8   16   12-27    124-139 (259)
443 cd00142 PI3Kc_like Phosphoinos  81.2     1.3 2.9E-05   33.2   2.4   31   11-62    129-159 (219)
444 KOG1027|consensus               81.0    0.83 1.8E-05   41.5   1.4   18   10-27    625-642 (903)
445 KOG0907|consensus               80.7     3.9 8.4E-05   27.7   4.4   45   50-97     21-65  (106)
446 KOG0591|consensus               80.1     1.3 2.8E-05   36.3   2.1   17   11-27    148-164 (375)
447 smart00146 PI3Kc Phosphoinosit  79.9     1.6 3.5E-05   32.3   2.4   31   12-64    103-133 (202)
448 KOG0694|consensus               78.8       1 2.3E-05   39.9   1.3   44   11-76    488-531 (694)
449 KOG0574|consensus               78.6    0.64 1.4E-05   38.6  -0.1   15   13-27    151-165 (502)
450 KOG0590|consensus               78.1     1.7 3.8E-05   37.6   2.4   37    9-67    438-474 (601)
451 KOG1989|consensus               77.7     1.1 2.4E-05   40.0   1.2   34   12-67    167-200 (738)
452 PHA03111 Ser/Thr kinase; Provi  77.5     2.6 5.6E-05   35.4   3.2   21    7-27    299-319 (444)
453 PF10707 YrbL-PhoP_reg:  PhoP r  77.5     2.4 5.3E-05   31.7   2.8   27   13-57    140-166 (199)
454 KOG0193|consensus               77.1     1.3 2.8E-05   39.2   1.3   33   11-65    508-540 (678)
455 cd00892 PIKKc_ATR ATR (Ataxia   76.0     2.2 4.8E-05   32.6   2.3   30   11-61    140-169 (237)
456 PF05445 Pox_ser-thr_kin:  Poxv  76.0     2.9 6.2E-05   35.2   3.0   22    6-27    294-315 (434)
457 KOG0575|consensus               75.7     1.6 3.5E-05   38.1   1.6   18   10-27    137-154 (592)
458 cd05172 PIKKc_DNA-PK DNA-depen  75.5     2.9 6.3E-05   32.0   2.8   31   10-61    136-166 (235)
459 cd05168 PI4Kc_III_beta Phospho  74.5     2.3   5E-05   33.9   2.1   26   15-62    146-171 (293)
460 cd00893 PI4Kc_III Phosphoinosi  74.0     2.4 5.1E-05   33.8   2.0   30   15-66    144-173 (289)
461 KOG1236|consensus               73.5     1.9 4.1E-05   37.1   1.4   16   12-27    366-381 (565)
462 cd05169 PIKKc_TOR TOR (Target   73.3     2.6 5.7E-05   32.7   2.1   30   10-60    181-210 (280)
463 cd05167 PI4Kc_III_alpha Phosph  70.7     3.4 7.5E-05   33.2   2.3   29   12-62    162-190 (311)
464 KOG0670|consensus               70.7     3.1 6.8E-05   36.7   2.1   18   10-27    555-572 (752)
465 KOG0662|consensus               70.6     2.7 5.9E-05   32.8   1.6   25   14-60    124-148 (292)
466 cd05170 PIKKc_SMG1 Suppressor   70.1     3.9 8.6E-05   32.4   2.5   29   11-60    210-238 (307)
467 cd00891 PI3Kc Phosphoinositide  69.9       3 6.6E-05   34.0   1.8   26   14-61    207-232 (352)
468 cd05171 PIKKc_ATM Ataxia telan  69.4       4 8.6E-05   31.9   2.3   29   11-60    182-210 (279)
469 cd05164 PIKKc Phosphoinositide  69.2     3.8 8.2E-05   31.0   2.1   29   11-60    132-160 (222)
470 KOG0611|consensus               68.8     3.2 6.9E-05   35.8   1.8   42   12-76    174-215 (668)
471 PF00454 PI3_PI4_kinase:  Phosp  68.8     3.2   7E-05   30.7   1.7   27   15-62    139-165 (235)
472 PF14531 Kinase-like:  Kinase-l  68.5     3.3 7.2E-05   32.9   1.7   17   11-27    165-181 (288)
473 KOG3653|consensus               68.3     3.6 7.8E-05   35.5   2.0   20    8-27    333-352 (534)
474 cd05166 PI3Kc_II Phosphoinosit  67.1     4.7  0.0001   33.0   2.4   26   14-61    206-231 (353)
475 cd00896 PI3Kc_III Phosphoinosi  65.3     4.5 9.7E-05   33.0   1.9   27   14-62    206-232 (350)
476 COG2112 Predicted Ser/Thr prot  65.3     4.2 9.2E-05   31.1   1.7   32   11-65    125-158 (201)
477 KOG0201|consensus               65.3     4.8  0.0001   34.3   2.1   29   12-62    132-160 (467)
478 PF08207 EFP_N:  Elongation fac  65.3     7.2 0.00016   23.6   2.4   26   15-62      3-28  (58)
479 cd02986 DLP Dim1 family, Dim1-  65.1      15 0.00032   25.5   4.3   53   50-104    14-66  (114)
480 KOG1165|consensus               64.7     7.6 0.00017   32.6   3.2   34   12-62    145-178 (449)
481 KOG1152|consensus               63.5     5.9 0.00013   35.4   2.4   31   10-62    689-719 (772)
482 KOG0197|consensus               62.9     3.3 7.2E-05   35.3   0.8   29   11-61    323-351 (468)
483 KOG4158|consensus               62.7     5.2 0.00011   34.4   1.9   33   11-61    361-393 (598)
484 KOG2270|consensus               62.6     4.7  0.0001   34.5   1.6   26   11-59    285-310 (520)
485 cd05173 PI3Kc_IA_beta Phosphoi  62.1     5.7 0.00012   32.7   2.0   25   15-61    213-237 (362)
486 cd05165 PI3Kc_I Phosphoinositi  61.9     5.8 0.00012   32.7   2.0   25   15-61    217-241 (366)
487 KOG1240|consensus               59.7     3.3 7.1E-05   39.3   0.2   19    8-26    137-155 (1431)
488 KOG0587|consensus               59.2     8.8 0.00019   35.4   2.8   67    9-106   141-213 (953)
489 cd05177 PI3Kc_C2_gamma Phospho  58.5     7.2 0.00016   32.0   2.0   26   15-62    208-233 (354)
490 KOG0580|consensus               58.2     3.4 7.4E-05   33.0   0.1   16   12-27    145-160 (281)
491 KOG4721|consensus               57.8     5.2 0.00011   35.9   1.1   16   12-27    233-248 (904)
492 PF13575 DUF4135:  Domain of un  56.6     7.7 0.00017   31.2   1.9   26   15-63    153-178 (370)
493 KOG0914|consensus               56.5      13 0.00028   29.4   3.0   54   50-104   144-197 (265)
494 KOG0033|consensus               55.1     8.6 0.00019   31.3   1.9   17   11-27    130-146 (355)
495 cd05174 PI3Kc_IA_delta Phospho  54.7     9.1  0.0002   31.5   2.0   25   15-61    213-237 (361)
496 cd00894 PI3Kc_IB_gamma Phospho  54.6      11 0.00023   31.2   2.4   28   14-63    216-243 (365)
497 KOG0614|consensus               54.1     7.8 0.00017   34.3   1.6   28   11-60    540-567 (732)
498 KOG2464|consensus               53.6     4.6  0.0001   30.9   0.1   23    5-27    152-174 (246)
499 cd05176 PI3Kc_C2_alpha Phospho  53.4      11 0.00024   31.0   2.3   26   14-61    206-231 (353)
500 KOG0903|consensus               53.2      11 0.00024   34.2   2.4   27   17-65    702-728 (847)

No 1  
>KOG2686|consensus
Probab=99.96  E-value=1.5e-30  Score=209.75  Aligned_cols=80  Identities=50%  Similarity=0.757  Sum_probs=74.4

Q ss_pred             ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCC
Q psy15665          4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK   83 (107)
Q Consensus         4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~   83 (107)
                      +..++|+||||||||+||||+.++    +                 +.+++||||||+||||||||||||||||+||+.+
T Consensus       206 e~~~~~vvFcHNDlq~gNiL~~~~----t-----------------~~Lv~IDfEYasyN~r~fDlanHf~E~~~DY~~~  264 (366)
T KOG2686|consen  206 ELTKSPVVFCHNDLQYGNILLLNS----T-----------------KELVLIDFEYASYNPRGFDLANHFCEWAADYHTP  264 (366)
T ss_pred             hcCCCCeeeecccccccceeeecC----C-----------------CceeEEeeccccCCchhhhHHHHHHHhhccccCC
Confidence            347889999999999999999864    1                 5799999999999999999999999999999999


Q ss_pred             CCCceeecCCCCCCHHHHhhc
Q psy15665         84 HFPHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        84 ~~p~~~~~~~~~Pt~~~~~~~  104 (107)
                      ++|+++++.+.||++++|+.+
T Consensus       265 ~~P~~~~~~~~~p~~e~~~~F  285 (366)
T KOG2686|consen  265 TPPGLKINPDLYPGEEQRQRF  285 (366)
T ss_pred             CCCeeecchhhCCCcHHHHHH
Confidence            999999999999999999876


No 2  
>PTZ00296 choline kinase; Provisional
Probab=99.94  E-value=5.6e-27  Score=192.54  Aligned_cols=78  Identities=44%  Similarity=0.792  Sum_probs=72.7

Q ss_pred             ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCC
Q psy15665          4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK   83 (107)
Q Consensus         4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~   83 (107)
                      +..+.++||||||+++||||..+                       ++|.||||||||+|+|+||||||||||++||+.+
T Consensus       278 ~~~~~~~VfCHNDl~~~NiL~~~-----------------------~~l~LIDfEYAg~ndpafDIAn~f~E~~~dy~~~  334 (442)
T PTZ00296        278 DNLANDIVFCHNDLQENNIINTN-----------------------KCLRLIDFEYSGYNFLATDIANFFIETTIDYSVS  334 (442)
T ss_pred             ccccCCeeEEeCCCCccceeecC-----------------------CCEEEEeecccccccHHHHHHHHHHHHhhhcCCC
Confidence            35678999999999999999755                       5699999999999999999999999999999999


Q ss_pred             CCCceeecCCCCCCHHHHhhc
Q psy15665         84 HFPHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        84 ~~p~~~~~~~~~Pt~~~~~~~  104 (107)
                      +.|+|.++.++|||.++|+.+
T Consensus       335 ~~p~f~~d~~~yPs~e~q~~F  355 (442)
T PTZ00296        335 HYPFFAIDKKKYISYENRKLF  355 (442)
T ss_pred             CCCccccCcccCcCHHHHHHH
Confidence            999999999999999999876


No 3  
>PTZ00384 choline kinase; Provisional
Probab=99.93  E-value=1.3e-26  Score=187.45  Aligned_cols=76  Identities=30%  Similarity=0.450  Sum_probs=70.7

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCC
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFP   86 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p   86 (107)
                      ..++|||||||++||||..+                       +++.||||||||+|+|+||||||||||++||+.++.|
T Consensus       224 ~~~~VfCHNDL~~gNIL~~~-----------------------~~l~lID~EYA~~n~~~fDLAn~f~E~~~~y~~~~~~  280 (383)
T PTZ00384        224 TNSVLFCHNDLFFTNILDFN-----------------------QGIYFIDFDFAGFNYVGWEIANFFVKLYIVYDPPTPP  280 (383)
T ss_pred             ccceeeeeccCCcccEEecC-----------------------CCEEEEEeccccCCchHhHHHHHHHHHhcccCCCCCC
Confidence            45799999999999999755                       6799999999999999999999999999999999999


Q ss_pred             ceeecCCCCCCHHHHhhcc
Q psy15665         87 HYTVKRENYPSYSLRNSSW  105 (107)
Q Consensus        87 ~~~~~~~~~Pt~~~~~~~~  105 (107)
                      +|+++.+.||++++|+.+.
T Consensus       281 ~~~~~~~~~ps~e~~~~fi  299 (383)
T PTZ00384        281 YFNSDDSLALSEEMKTIFV  299 (383)
T ss_pred             ccccCCCCCCCHHHHHHHH
Confidence            9999999999999998763


No 4  
>PF01633 Choline_kinase:  Choline/ethanolamine kinase;  InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome.  Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=99.93  E-value=2.7e-27  Score=174.01  Aligned_cols=75  Identities=47%  Similarity=0.822  Sum_probs=59.9

Q ss_pred             cccCCCCeEEEecccCCCceee-ecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665          3 LLKIKSPVTFCHNDLQEGNILY-RESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS   81 (107)
Q Consensus         3 l~~~~~~~VfcHnDl~~gNiL~-~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~   81 (107)
                      +++..+|+|||||||++||||+ ...                      +++.||||||||+|+|+||||||||||++++.
T Consensus       136 l~~~~~~~v~cHnDl~~~Nil~~~~~----------------------~~~~lIDfEya~~n~~~fDia~~f~e~~~~~~  193 (211)
T PF01633_consen  136 LEKSNSPLVFCHNDLNPGNILINNKD----------------------GEVKLIDFEYAGYNDRAFDIANFFCEWNFDYE  193 (211)
T ss_dssp             HHTSCGGEEEE-S--SGGGEEETSSS----------------------SCEEE--GTT-EEEEHHHHHHHHHHHTTEETT
T ss_pred             hhccCCCceEeeccCccccEEeccCC----------------------CeEEEecHHHHhhccchhhHHHHHHHHcCchh
Confidence            4567889999999999999999 332                      78999999999999999999999999999999


Q ss_pred             CCCCCceeecCCCCCCHHH
Q psy15665         82 YKHFPHYTVKRENYPSYSL  100 (107)
Q Consensus        82 ~~~~p~~~~~~~~~Pt~~~  100 (107)
                      ..+. +++++.++|||++|
T Consensus       194 ~~~~-~~~~~~~~yp~~~~  211 (211)
T PF01633_consen  194 QEEF-FFKCDYSKYPTEEQ  211 (211)
T ss_dssp             HSST-STEE-GGGS--HHH
T ss_pred             hhhh-hhhhhHhhCCCccC
Confidence            9987 88999999999986


No 5  
>KOG4720|consensus
Probab=99.90  E-value=7.2e-25  Score=175.11  Aligned_cols=74  Identities=45%  Similarity=0.705  Sum_probs=64.5

Q ss_pred             ccccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665          2 HLLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS   81 (107)
Q Consensus         2 ~l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~   81 (107)
                      +|...++|+|||||||.+|||++++.                     .+.|.+||||||+|||++|||||||||++    
T Consensus       240 ~l~~L~sPVVFcHNDLL~~Niiy~~~---------------------~~~v~fIDYEYa~yNY~afDIgNHFnE~a----  294 (391)
T KOG4720|consen  240 MLSMLKSPVVFCHNDLLCGNIIYDSE---------------------KGSVEFIDYEYAGYNYQAFDIGNHFNEYA----  294 (391)
T ss_pred             HHHhhCCCeEEeecchhhcceeeccc---------------------cCcEEEEeecccccchhheehhhhHHhhc----
Confidence            46778999999999999999999884                     17899999999999999999999999997    


Q ss_pred             CCCCCceeecCCCCCCHHHHhhc
Q psy15665         82 YKHFPHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        82 ~~~~p~~~~~~~~~Pt~~~~~~~  104 (107)
                      .-+    .++.++||++++|.++
T Consensus       295 Gv~----evDYSlyp~rE~Q~qw  313 (391)
T KOG4720|consen  295 GVE----EVDYSLYPTREEQLQW  313 (391)
T ss_pred             CCC----ccchhcCCCHHHHHHH
Confidence            222    3556999999999765


No 6  
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=99.90  E-value=8.7e-24  Score=161.84  Aligned_cols=82  Identities=51%  Similarity=0.882  Sum_probs=72.0

Q ss_pred             CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCC
Q psy15665          6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF   85 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~   85 (107)
                      ...++||||||++++|||+.+++.+                  .+.+.||||||||+|+|+||||++||||+++|+....
T Consensus       175 ~~~~~~lcH~Dl~~~Nil~~~~~~~------------------~~~i~lIDwEya~~~~p~~DlA~~~~e~~~~~~~~~~  236 (302)
T cd05156         175 SGSPVVFCHNDLQEGNILLLNPSSE------------------TKKLVLIDFEYASYNYRGFDIANHFCEWMYDYHDPEP  236 (302)
T ss_pred             CCCCceEEecCCCcCeEEecCCCCC------------------CCcEEEEeeCCCCCCCcHHHHHHHHHHHHhhcCCCCC
Confidence            3588999999999999999863111                  1579999999999999999999999999999999888


Q ss_pred             CceeecCCCCCCHHHHhhcc
Q psy15665         86 PHYTVKRENYPSYSLRNSSW  105 (107)
Q Consensus        86 p~~~~~~~~~Pt~~~~~~~~  105 (107)
                      |++.++.+.||+.++|..+.
T Consensus       237 ~~~~~~~~~~p~~~~~~~f~  256 (302)
T cd05156         237 PFFKIHEDKYPTEEQRLNFI  256 (302)
T ss_pred             CccccChhhCcCHHHHHHHH
Confidence            89999999999998887653


No 7  
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=99.89  E-value=1.5e-23  Score=165.20  Aligned_cols=72  Identities=42%  Similarity=0.704  Sum_probs=60.4

Q ss_pred             ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCC
Q psy15665          4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYK   83 (107)
Q Consensus         4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~   83 (107)
                      ...+.|+|||||||++||||+.++  +                   +++.||||||||+|+|+||||||||||+      
T Consensus       176 ~~~~~~~v~CHnDl~~~NiL~~~~--~-------------------~~l~lID~EYag~nd~~fDIa~~f~E~~------  228 (330)
T PLN02421        176 DSLKAPVVFAHNDLLSGNLMLNED--E-------------------GKLYFIDFEYGSYSYRGYDIGNHFNEYA------  228 (330)
T ss_pred             ccCCCCeEEEECCCCcccEEEeCC--C-------------------CcEEEEcccccCCCccHHHHHHHHHHHc------
Confidence            445789999999999999999753  0                   5799999999999999999999999997      


Q ss_pred             CCCceeecCCCCCCHHHHhhcc
Q psy15665         84 HFPHYTVKRENYPSYSLRNSSW  105 (107)
Q Consensus        84 ~~p~~~~~~~~~Pt~~~~~~~~  105 (107)
                         .+.++.+.||+.++|..++
T Consensus       229 ---~~~~~~~~~p~~~~~~~fl  247 (330)
T PLN02421        229 ---GFDCDYSLYPSKEEQYHFF  247 (330)
T ss_pred             ---ccccCcccCcCHHHHHHHH
Confidence               2334558889998887653


No 8  
>PLN02236 choline kinase
Probab=99.84  E-value=3.9e-21  Score=152.57  Aligned_cols=77  Identities=43%  Similarity=0.717  Sum_probs=66.3

Q ss_pred             cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCC
Q psy15665          5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH   84 (107)
Q Consensus         5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~   84 (107)
                      ....++||||||++++|||+.++.                     +.+.+||||||++|+++||||+|||||+.+|..++
T Consensus       195 ~~~~~~~~cH~Dl~~~Nil~~~~~---------------------~~~~lID~Eya~~~~~~~Dia~~~~e~~~~y~~~~  253 (344)
T PLN02236        195 GDDQEIGFCHNDLQYGNIMIDEET---------------------RAITIIDYEYASYNPVAYDIANHFCEMAADYHSET  253 (344)
T ss_pred             ccCCCceEEeCCCCcCcEEEeCCC---------------------CcEEEEeehhccccchHHHHHHHHHHHHHhhcCCC
Confidence            346789999999999999998630                     56999999999999999999999999999998655


Q ss_pred             CCceeecCCCCCCHHHHhhc
Q psy15665         85 FPHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        85 ~p~~~~~~~~~Pt~~~~~~~  104 (107)
                       |.. ++.+.||+.++|+.+
T Consensus       254 -~~~-~~~~~~~~~~~~~~f  271 (344)
T PLN02236        254 -PHI-LDYSKYPGEEERRRF  271 (344)
T ss_pred             -ccc-CchhhCcCHHHHHHH
Confidence             444 788899999988765


No 9  
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=99.81  E-value=4.1e-20  Score=136.36  Aligned_cols=69  Identities=46%  Similarity=0.840  Sum_probs=59.0

Q ss_pred             CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCC
Q psy15665          6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF   85 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~   85 (107)
                      ...+.|+||||++++|||+.+.  .                   +.+.|||||||++++++||||++|+||+        
T Consensus       166 ~~~~~~l~H~Dl~~~Nil~~~~--~-------------------~~~~lIDwe~a~~~~~~~Dla~~~~e~~--------  216 (235)
T cd05157         166 LNSPIVFCHNDLLSGNIIYNEE--K-------------------NSVKFIDYEYAGYNYRAFDIANHFNEWA--------  216 (235)
T ss_pred             cCCCEEEEcCCCCcCcEEEeCC--C-------------------CCEEEEEcccCCcCchheeHHHHHHHHc--------
Confidence            3467999999999999999862  0                   5699999999999999999999999997        


Q ss_pred             CceeecCCCCCCHHHHhhc
Q psy15665         86 PHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        86 p~~~~~~~~~Pt~~~~~~~  104 (107)
                       .+.++..+||+.++|+.+
T Consensus       217 -~~~~~~~~~~~~~~~~~~  234 (235)
T cd05157         217 -GFDCDYYLYPPKEEQQAF  234 (235)
T ss_pred             -CccCChhhCcCHHHHHhh
Confidence             244445899999999875


No 10 
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=99.65  E-value=1.2e-16  Score=124.03  Aligned_cols=73  Identities=32%  Similarity=0.506  Sum_probs=58.2

Q ss_pred             cccCCCC-eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665          3 LLKIKSP-VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS   81 (107)
Q Consensus         3 l~~~~~~-~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~   81 (107)
                      +.....+ .|+||||++++|+|.+++                      ++|.||||||||+|+++||||+++.|++.++.
T Consensus       145 l~~~~~~~~v~cH~Dl~~~N~l~t~~----------------------~~l~LIDWEyAg~~D~~~DLA~~~~e~~~~~~  202 (269)
T COG0510         145 LEEVPKDDLVPCHNDLNPGNLLLTDK----------------------GGLFLIDWEYAGLNDPAFDLAALLSEYIFNHN  202 (269)
T ss_pred             hhhcCCCceeeecCCCCccceEEcCC----------------------CcEEEEecccCCCccHHHHHHHHHHHhccchh
Confidence            3445566 899999999999999985                      78999999999999999999999999998775


Q ss_pred             CCCCCceeecCCCCCCH
Q psy15665         82 YKHFPHYTVKRENYPSY   98 (107)
Q Consensus        82 ~~~~p~~~~~~~~~Pt~   98 (107)
                      ..+ -.+..+.+.++.+
T Consensus       203 ~~~-~~~~~~~~~~~~~  218 (269)
T COG0510         203 ELE-DLYSAYLEKYGFE  218 (269)
T ss_pred             HHH-HHHHHHHHhCCch
Confidence            311 1233455666665


No 11 
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=99.53  E-value=8.1e-15  Score=110.32  Aligned_cols=47  Identities=26%  Similarity=0.334  Sum_probs=43.0

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      ..+.|+||||+++||||+.+                       +++.|||||||++++++||||++++++
T Consensus       143 ~~~~~l~H~Dl~~~Nil~~~-----------------------~~~~lIDwE~a~~gdp~~DLa~~~~~~  189 (256)
T TIGR02721       143 PLPLAPLHMDVHAYNLVVTP-----------------------QGLKLIDWEYASDGDIALELAAIIRAN  189 (256)
T ss_pred             CCCCeeecCCCCcCcEEEeC-----------------------CCCEEEeccccCcCCHHHHHHHHHHhC
Confidence            35789999999999999987                       448999999999999999999999996


No 12 
>PRK10271 thiK thiamine kinase; Provisional
Probab=99.37  E-value=6.4e-13  Score=99.37  Aligned_cols=48  Identities=27%  Similarity=0.378  Sum_probs=43.5

Q ss_pred             cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665          5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE   75 (107)
Q Consensus         5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E   75 (107)
                      ..+.++|+||||++++|||+.+                       +++.+|||||||.+.+++|||..+++
T Consensus        72 ~~~l~~~p~H~D~~~~N~~~~~-----------------------~~~~lIDwe~a~~gDp~~DLa~~~~~  119 (188)
T PRK10271         72 PRPLRLAPLHMDVHAGNLVHSA-----------------------SGLRLIDWEYAGDGDIALELAAVWVE  119 (188)
T ss_pred             CCCCCeeeecCCCCCccEEEEC-----------------------CCEEEEeCCcccCCCHHHHHHHHHcC
Confidence            4566789999999999999987                       55999999999999999999999986


No 13 
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=99.36  E-value=2e-13  Score=95.01  Aligned_cols=47  Identities=43%  Similarity=0.669  Sum_probs=43.3

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhh
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVY   78 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~   78 (107)
                      +.++||+|++++|||+.+                       +++.+||||+|+++.+++|||.++.+|.+
T Consensus       106 ~~~~~HgD~~~~Nil~~~-----------------------~~~~liDf~~a~~~~~~~Dla~~~~~~~~  152 (170)
T cd05151         106 DLVPCHNDLLPGNFLLDD-----------------------GRLWLIDWEYAGMNDPLFDLANFFSEAKL  152 (170)
T ss_pred             CceeecCCCCcCcEEEEC-----------------------CeEEEEecccccCCChHHHHHHHHHhcCC
Confidence            678999999999999985                       67999999999999999999999999854


No 14 
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=99.30  E-value=2.9e-12  Score=91.80  Aligned_cols=49  Identities=20%  Similarity=0.297  Sum_probs=43.0

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      .+.++||+|++++|||+.++ ..                   +.+.|||||+++++++++|||.++.+|
T Consensus       172 ~~~~l~HgD~~~~Nil~~~~-~~-------------------~~~~iID~e~~~~g~~~~Dla~~~~~~  220 (223)
T cd05154         172 SRPGLVHGDYRLGNVLFHPD-EP-------------------RVVAVLDWELATLGDPLADLGWLLMYW  220 (223)
T ss_pred             CCcEEEECCCCcccEEEcCC-CC-------------------cEEEEEeccccccCChHHHHHHHHHhc
Confidence            57899999999999999872 00                   457899999999999999999999887


No 15 
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=99.23  E-value=6.8e-12  Score=94.65  Aligned_cols=72  Identities=19%  Similarity=0.171  Sum_probs=51.8

Q ss_pred             cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCC
Q psy15665          5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKH   84 (107)
Q Consensus         5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~   84 (107)
                      ....+.++||+|+++||||+.++                      + +.|||||+|+++++.+|||.++.=+.++-.   
T Consensus       148 ~~~~~~~~~HgD~~~~Nii~~~~----------------------~-~~iIDwe~a~~Gdp~~Dla~~~~~~~~~~~---  201 (226)
T TIGR02172       148 EVPDTSTCLHGDFQIGNLITSGK----------------------G-TYWIDLGDFGYGNPLFDLGLLFMFCHYLDD---  201 (226)
T ss_pred             hCCCCCceEecCCCCCcEEEcCC----------------------C-cEEEechhcCcCCHHHHHHHHHHhccCChh---
Confidence            34556778999999999999873                      4 899999999999999999998765543211   


Q ss_pred             CCceeecCCCCCCHHHHhhc
Q psy15665         85 FPHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        85 ~p~~~~~~~~~Pt~~~~~~~  104 (107)
                        .+..-...|-.++.+.|+
T Consensus       202 --~~~~~~~~y~~~~~~~~~  219 (226)
T TIGR02172       202 --DKLQAIFHMNAEQLKAHW  219 (226)
T ss_pred             --HHHHHHHhcCHHHHHHHH
Confidence              122223455555555543


No 16 
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=99.14  E-value=4e-11  Score=98.24  Aligned_cols=53  Identities=28%  Similarity=0.461  Sum_probs=47.1

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCC
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY   82 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~   82 (107)
                      ..+.+++|+|+++||||+.+                       ..+.|||||+|.+++++||||+++.++...|-.
T Consensus       220 ~~~~~l~HgDl~~gni~~~~-----------------------~~~~viD~E~a~~G~~~~Dlg~~lanl~~~~~~  272 (401)
T PRK09550        220 TKAEALLHGDLHTGSIFVTE-----------------------EETKVIDPEFAFYGPIGFDIGTFIANLLLNYCS  272 (401)
T ss_pred             cCCCceeeccCCcccEEeeC-----------------------CCcEEEeccccccCChHHHHHHHHHHHHHHHhc
Confidence            34678999999999999987                       568999999999999999999999999876644


No 17 
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=99.13  E-value=3.9e-11  Score=91.36  Aligned_cols=51  Identities=25%  Similarity=0.356  Sum_probs=44.4

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhc
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYD   79 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~d   79 (107)
                      ..|.++||+|++++|||+.++                      +.+.|||||+|+++++.+|||..+..|++.
T Consensus       172 ~~~~~l~HgD~~~~Nil~~~~----------------------~~~~iIDfe~a~~g~~~~Dla~~~~~~~~~  222 (296)
T cd05153         172 DLPRGVIHADLFRDNVLFDGD----------------------ELSGVIDFYFACTDAFLYDLAITLNDWCFD  222 (296)
T ss_pred             cCCCcCCccCcCcccEEEeCC----------------------ceEEEeehhhhcCchHHHHHHHHHHHHHhC
Confidence            457899999999999999873                      345799999999999999999999888753


No 18 
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=99.10  E-value=1.2e-10  Score=86.53  Aligned_cols=48  Identities=19%  Similarity=0.054  Sum_probs=41.4

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      ..+.||||+|+++||||+.++                      +.+.|||||+|+++++.+|||..+...
T Consensus       160 ~~~~~l~HgD~~~~Nil~~~~----------------------~~~~iIDwe~a~~gdp~~Dla~~~~~~  207 (244)
T cd05150         160 EEDLVVTHGDACLPNIIVDPG----------------------KFSGFIDLGRLGVADRYQDLALAVRSL  207 (244)
T ss_pred             cCceEEECCCCCCccEEEeCC----------------------cEEEEEEccccccccHHHHHHHHHHHh
Confidence            457899999999999999873                      446799999999999999999877543


No 19 
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
Probab=99.03  E-value=3.8e-10  Score=83.07  Aligned_cols=53  Identities=25%  Similarity=0.402  Sum_probs=43.3

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      .+.|+||+|++++|||+..+.++.                 ...+.+|||++|+++++++||+.+++-++
T Consensus       118 ~~~vl~HgD~~~~N~~~~~~~~~~-----------------~~~~~liDfq~~~~g~p~~Dl~~~l~~~~  170 (196)
T smart00587      118 EFNVLNHGDLWANNIMFKYDDEGK-----------------PEDVALIDFQLSHYGSPAEDLHYFLLTSL  170 (196)
T ss_pred             CceEEeeCCCCccceeeccCCCCC-----------------ccceEEEecccCCcCChHHHHHHHHHhCC
Confidence            468999999999999998632111                 14799999999999999999999987543


No 20 
>TIGR01767 MTRK 5-methylthioribose kinase. This enzyme is involved in the methionine salvage pathway in certain bacteria.
Probab=98.99  E-value=4e-10  Score=91.81  Aligned_cols=52  Identities=31%  Similarity=0.422  Sum_probs=46.0

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS   81 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~   81 (107)
                      .....++|+||++||||+.+                       .++.+||||+|.+++++||||+.+.+....|-
T Consensus       189 ~~~~~llHGDl~~gNi~~~~-----------------------~~~~~iD~e~~~~G~~~~Dlg~~ianL~l~~~  240 (370)
T TIGR01767       189 ASAETLLHGDLHSGSIFVSE-----------------------HETKVIDPEFAFYGPIGFDIGQFIANLFLNAL  240 (370)
T ss_pred             cCcceeeeccCCcccEEEcC-----------------------CCCEEEcCcccccCchHhhHHHHHHHHHHHHh
Confidence            34568999999999999977                       55889999999999999999999999887654


No 21 
>PF01636 APH:  Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.;  InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=98.97  E-value=2.8e-10  Score=81.34  Aligned_cols=49  Identities=33%  Similarity=0.478  Sum_probs=36.6

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      ..+.++||+|++++|||+.++  +                   +.+.|||||.++++++.+|+|..+.-+
T Consensus       163 ~~~~~~~HgD~~~~Nil~~~~--~-------------------~~i~iID~e~a~~~~~~~Dla~~~~~~  211 (239)
T PF01636_consen  163 PLPPVLIHGDLHPGNILVDPS--D-------------------GRIGIIDFEDAGWGDPAYDLARLLRHF  211 (239)
T ss_dssp             CSCEEEE-SS-SGGGEEEESS--T-------------------TEEEE--GTT-EEEETHHHHHHHHHHH
T ss_pred             CCCcEEEEeccccccceeeec--c-------------------ceeEEEecccceECCHHHHHHHHHHHh
Confidence            478999999999999999932  0                   455699999999999999999988433


No 22 
>PRK05231 homoserine kinase; Provisional
Probab=98.96  E-value=6.5e-10  Score=85.75  Aligned_cols=51  Identities=22%  Similarity=0.322  Sum_probs=44.1

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhcc
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDY   80 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy   80 (107)
                      .|..+||+|++++|||+.++                      +-..||||++|+++++.||||..+.-|+++.
T Consensus       185 lp~~liHgD~~~~Nil~~~~----------------------~~~~iIDf~~~~~~~~~~DlA~~~~~~~~~~  235 (319)
T PRK05231        185 LPRGVIHADLFRDNVLFEGD----------------------RLSGFIDFYFACNDKLLYDVAITLNDWCFEA  235 (319)
T ss_pred             CCcccCCCCCCCCcEEEECC----------------------ceEEEEecccccCCchHHHHHHHHHHHHccC
Confidence            57789999999999999862                      3347999999999999999999998888653


No 23 
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=98.95  E-value=4.2e-10  Score=83.85  Aligned_cols=72  Identities=24%  Similarity=0.275  Sum_probs=49.5

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCe-EEEeeecCCCCchhhhHHHHHHHhhhccCCCCCC
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDL-VVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFP   86 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p   86 (107)
                      .+.+|||+|++++|||+.+                       +++ .|||||+|+++++++|||...+.+.  -...+. 
T Consensus       162 ~~~~l~HGD~~~~Nvlv~~-----------------------~~i~giIDw~~a~~gDp~~Dla~~~~~~~--~~~~~~-  215 (235)
T cd05155         162 GPPVWFHGDLAPGNLLVQD-----------------------GRLSAVIDFGCLGVGDPACDLAIAWTLLD--EDSRAA-  215 (235)
T ss_pred             CCceEEeCCCCCCcEEEEC-----------------------CCEEEEEeCcccCcCChHHHHHHHHhcCC--HHHHHH-
Confidence            5789999999999999986                       455 5999999999999999997655332  110110 


Q ss_pred             ceeecCCCCCCHHHHhhccc
Q psy15665         87 HYTVKRENYPSYSLRNSSWV  106 (107)
Q Consensus        87 ~~~~~~~~~Pt~~~~~~~~~  106 (107)
                      ++..| ..+|-.-+|-.+|+
T Consensus       216 ~~~~y-~~~~~~~~~~~~~~  234 (235)
T cd05155         216 FRAAL-GVDDATWARGRGWA  234 (235)
T ss_pred             HHHHc-CCCHHHHHHhcccc
Confidence            12222 24554566666665


No 24 
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=98.95  E-value=6.6e-10  Score=84.70  Aligned_cols=75  Identities=23%  Similarity=0.382  Sum_probs=53.7

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh-h--ccCCC
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV-Y--DYSYK   83 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~-~--dy~~~   83 (107)
                      ..+.++||+|++++|||+.+                       +.+.|||||.|+++++.+|||..+..++ -  +++..
T Consensus       184 ~~~~~liHgD~~~~Nil~~~-----------------------~~i~lIDfd~~~~~~~~~Dla~~l~~~~~~~~~~d~~  240 (313)
T TIGR02906       184 KKIRGFCHQDYAYHNILLKD-----------------------NEVYVIDFDYCTIDLPVRDLRKLIIKLMKKNGVWDLE  240 (313)
T ss_pred             cCcCceEcCCCCcccEEEeC-----------------------CcEEEEECcccccCCcHHHHHHHHHHHHHhccCCCHH
Confidence            45688999999999999986                       5589999999999999999999988776 1  12211


Q ss_pred             C-CCceeecCCCCC-CHHHHhhc
Q psy15665         84 H-FPHYTVKRENYP-SYSLRNSS  104 (107)
Q Consensus        84 ~-~p~~~~~~~~~P-t~~~~~~~  104 (107)
                      . ...+.-|.+..| |++++..+
T Consensus       241 ~~~~~l~gY~~~~~L~~~e~~~l  263 (313)
T TIGR02906       241 KAKEIIEAYSSINPLSKEEKEVL  263 (313)
T ss_pred             HHHHHHHHhhccCCCCHHHHHHH
Confidence            1 113444555444 55555444


No 25 
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=98.94  E-value=8.5e-10  Score=85.26  Aligned_cols=50  Identities=28%  Similarity=0.385  Sum_probs=43.1

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhh
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVY   78 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~   78 (107)
                      ..|.++||+|++++|||+.++                      +.+.|||||+|+++++.+|||..+..|+.
T Consensus       184 ~~~~~l~HgD~~~~Nvl~~~~----------------------~~~~vIDfd~~~~~~~~~DLA~~~~~~~~  233 (307)
T TIGR00938       184 DLPRGVIHADLFPDNVLFDGD----------------------SVKGVIDFYFACTDARAYDLAITVNAWCF  233 (307)
T ss_pred             cCCCccCCCCCCcCcEEEECC----------------------ceEEEeecccccCcchHHHHHHHHHHHHc
Confidence            346899999999999999873                      33579999999999999999998777774


No 26 
>PRK12396 5-methylribose kinase; Reviewed
Probab=98.90  E-value=9.2e-10  Score=90.69  Aligned_cols=52  Identities=23%  Similarity=0.447  Sum_probs=46.7

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCC
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY   82 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~   82 (107)
                      ...+++|+||++||||+.+                       ++++|||.|+|-|+|.|||||+.+....+.|-.
T Consensus       225 ~~~aLlHGDlHtGSI~v~~-----------------------~~~kvIDpEFAfyGP~gFDiG~~lanll~ay~~  276 (409)
T PRK12396        225 NAQALIHGDLHTGSVFVKN-----------------------DSTKVIDPEFAFYGPMGYDIGNVMANLMFAWVN  276 (409)
T ss_pred             cchhhccCcCCCCCEEecC-----------------------CceEEEcccccccCCcHHHHHHHHHHHHHHHhc
Confidence            4568999999999999998                       679999999999999999999999988877643


No 27 
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=98.78  E-value=1.1e-08  Score=67.58  Aligned_cols=46  Identities=39%  Similarity=0.715  Sum_probs=41.6

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      .+++|+|++++|||+.+.                      +.+.+|||+.|.+.++++|++..++-|.
T Consensus       108 ~~i~H~Dl~~~Nil~~~~----------------------~~~~l~Df~~~~~~~~~~d~~~~~~~~~  153 (155)
T cd05120         108 LVLCHGDLHPGNILVDDG----------------------KILGIIDWEYAGYGPPAFDLAAALLFNL  153 (155)
T ss_pred             eEEEecCCCcceEEEECC----------------------cEEEEEecccccCCChHHHHHHHHHHhc
Confidence            579999999999999873                      6799999999999999999999987663


No 28 
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=98.76  E-value=6.3e-09  Score=80.74  Aligned_cols=50  Identities=26%  Similarity=0.323  Sum_probs=44.3

Q ss_pred             CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665          6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      ...+.++||+|+.++|+|+.++                      +.+.+||||+|+++++.+|||+++...+
T Consensus       192 ~~~~~~lcHgD~~~~Nvl~~~~----------------------~~~~iIDfd~~~~d~~~~DLa~~~~~~~  241 (309)
T TIGR02904       192 ESWRTVLVHGKLSLSHFLYDET----------------------RGGYFINFEKASFASPLTDLAAFFRRSF  241 (309)
T ss_pred             hhcceeeeCCCCcHHhEEEcCC----------------------CCEEEEEhhhcccCCcHHHHHHHHHHHH
Confidence            4468899999999999999774                      6789999999999999999998877755


No 29 
>PF02958 EcKinase:  Ecdysteroid kinase;  InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans.
Probab=98.72  E-value=1.3e-08  Score=77.79  Aligned_cols=55  Identities=31%  Similarity=0.560  Sum_probs=44.9

Q ss_pred             CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665          6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      ...+.|+||+|++.+|||+..+..+.                 ...+++|||..++++.++.||+.++.-..
T Consensus       211 ~~~~~vl~HGD~w~nNilf~~~~~g~-----------------~~~~~liDfQ~~~~g~p~~Dl~~fl~~s~  265 (294)
T PF02958_consen  211 KEPFNVLCHGDFWTNNILFKYDDDGK-----------------PIDVVLIDFQLARYGSPAIDLAYFLYTSL  265 (294)
T ss_pred             cCCceEEEcCccCHHhEeEccccccc-----------------cccceeeccccccCCCcHhHHHHHHHHCC
Confidence            44568999999999999998752221                 15799999999999999999999886543


No 30 
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported 
Probab=98.61  E-value=5.4e-08  Score=75.45  Aligned_cols=46  Identities=26%  Similarity=0.329  Sum_probs=38.1

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHH
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHF   73 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf   73 (107)
                      ..+.++||+|++++|||+.++  +                   +-.-|||||.|+.+.+++|||-.+
T Consensus       182 ~~~~~lvHGD~~~~Nilv~~~--~-------------------~~~gviDWe~a~iGDPa~Dla~~~  227 (276)
T cd05152         182 PRHTVLVHGDLHPGHILIDED--A-------------------RVTGLIDWTEAKVGDPARDFVLHY  227 (276)
T ss_pred             CCCCeeEeCCCCCCcEEEeCC--C-------------------CEEEEECcHhcccCCHHHHHHHHH
Confidence            456799999999999999863  0                   224599999999999999999653


No 31 
>PRK11768 serine/threonine protein kinase; Provisional
Probab=98.55  E-value=5.4e-08  Score=76.65  Aligned_cols=44  Identities=20%  Similarity=0.269  Sum_probs=38.2

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHH
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFV   74 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~   74 (107)
                      ..+.++||+|+++||||+.+                        .+.||||+.|+++++.+||+..+.
T Consensus       193 ~~~~~liHgD~h~~NvL~~d------------------------~~~iIDFDd~~~g~~i~DLa~~l~  236 (325)
T PRK11768        193 DVRLLRLHGDCHPGNILWRD------------------------GPHFVDLDDARMGPAVQDLWMLLS  236 (325)
T ss_pred             CCCccceecCCCchhccccC------------------------CcEEEeCCCCCCCCHHHHHHHHhc
Confidence            35788999999999999942                        367999999999999999998764


No 32 
>PLN02756 S-methyl-5-thioribose kinase
Probab=98.54  E-value=5.8e-08  Score=80.29  Aligned_cols=51  Identities=25%  Similarity=0.410  Sum_probs=44.6

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccC
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYS   81 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~   81 (107)
                      ....++|+||++||||+.+                       ++..+||.|+|-|+|++||||..+......|-
T Consensus       228 ~~~~L~HGDl~~g~i~~~~-----------------------~~~~~id~ef~~~g~~~~d~g~~~~~~~~~~~  278 (418)
T PLN02756        228 RAQALVHGDLHTGSVMVTP-----------------------DSTQVIDPEFAFYGPMGFDIGAFLGNLILAYF  278 (418)
T ss_pred             cccceeecCCCCCcEEEcC-----------------------CCceEecchhhccCchHHhHHHHHhhhHHHHh
Confidence            4578999999999999998                       55899999999999999999998877775553


No 33 
>PLN02876 acyl-CoA dehydrogenase
Probab=98.32  E-value=1.2e-06  Score=76.70  Aligned_cols=76  Identities=14%  Similarity=0.281  Sum_probs=53.2

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCC---
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHF---   85 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~---   85 (107)
                      +.++||+|++++|||+.++  +                  .+-.-|||||+|..+.+.+|||..+.-|+.+......   
T Consensus       224 ~~~LvHGD~~~~Nvl~~~~--~------------------~~v~aVLDWE~a~~GdPl~DLa~~~~~~~~~~~~~~~~~~  283 (822)
T PLN02876        224 GTGIVHGDFRIDNLVFHPT--E------------------DRVIGILDWELSTLGNQMCDVAYSCLPYIVDINLDNQQVG  283 (822)
T ss_pred             CcceEecCcccccEEEcCC--C------------------CeEEEEEeeeccccCChHHHHHHHhhhccccccCCccccc
Confidence            5789999999999999863  0                  0235799999999999999999888877755322111   


Q ss_pred             Cceeec--CCCCCCHHHHhhc
Q psy15665         86 PHYTVK--RENYPSYSLRNSS  104 (107)
Q Consensus        86 p~~~~~--~~~~Pt~~~~~~~  104 (107)
                      ..+...  ..-+||.++-...
T Consensus       284 ~~~~~~~~~~G~p~~~e~~~~  304 (822)
T PLN02876        284 KGFEFTGIPEGIPSLPEYLAE  304 (822)
T ss_pred             cccccCcCCCCCCCHHHHHHH
Confidence            111111  2467888876543


No 34 
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=98.27  E-value=9.7e-07  Score=70.88  Aligned_cols=43  Identities=26%  Similarity=0.455  Sum_probs=39.5

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCC-CeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNI-DLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      .||+|+.++||+++++                      . -..+|||+.|++++..+|||..+.-|
T Consensus       199 iIH~D~~~~NVl~d~~----------------------~~~~g~iDFdDa~~~~~i~DlAi~l~~~  242 (331)
T COG2334         199 IIHGDLHPDNVLFDDD----------------------TDVSGFIDFDDAGYGWFIYDLAIALNAW  242 (331)
T ss_pred             eeecCCCccceeEcCC----------------------CCeeeEEEccccccchHHHHHHHHHHHh
Confidence            8999999999999984                      3 27899999999999999999999887


No 35 
>PRK10593 hypothetical protein; Provisional
Probab=98.23  E-value=6.8e-07  Score=69.81  Aligned_cols=63  Identities=8%  Similarity=0.113  Sum_probs=46.0

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCC
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFP   86 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p   86 (107)
                      ..+.++||+|+++||||+.... .                   .-..+||+.-+.|++|.+|||..+.        ..++
T Consensus       190 ~~~psLlHGDlw~gNvl~~~~~-~-------------------~i~~liDPa~~~~g~rE~DLa~~~~--------~~f~  241 (297)
T PRK10593        190 NDNCVLVHGNFTLRSMLKDPRS-D-------------------QLLAMLNPGLMLWAPREYELFRLMD--------NGLA  241 (297)
T ss_pred             CCCCeeEeCCCCcccEEECCCC-C-------------------ceEEEECchHhCCCCHHHhHHHhhc--------CCcc
Confidence            4457999999999999997520 0                   2278999988999999999986641        1122


Q ss_pred             --ceeecCCCCCC
Q psy15665         87 --HYTVKRENYPS   97 (107)
Q Consensus        87 --~~~~~~~~~Pt   97 (107)
                        ++.-|.+.+|.
T Consensus       242 ~~f~~~Y~~~~pl  254 (297)
T PRK10593        242 EQLLWRYLQKAPV  254 (297)
T ss_pred             HHHHHHHHHhCCC
Confidence              56667777773


No 36 
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]
Probab=98.21  E-value=2e-06  Score=69.00  Aligned_cols=48  Identities=21%  Similarity=0.264  Sum_probs=43.5

Q ss_pred             CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665          6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      ...+.++.|+|+..||||+.++                      +.+-|||||-++.+.+..||+.++  |.
T Consensus       194 ~~~~~~lvHGD~~~gNlii~~~----------------------~~~gVlDwe~~~lGDP~~Dl~~~~--W~  241 (321)
T COG3173         194 WAGPPVLVHGDYRPGNLIIDPG----------------------RPTGVLDWELATLGDPLEDLAIIC--WT  241 (321)
T ss_pred             cCCCceeeeCCcccCCEEEeCC----------------------CeeEEEeccccccCCcHHHHHHHH--hc
Confidence            4567999999999999999996                      669999999999999999999987  65


No 37 
>COG4857 Predicted kinase [General function prediction only]
Probab=98.14  E-value=1.4e-06  Score=70.44  Aligned_cols=45  Identities=36%  Similarity=0.455  Sum_probs=40.5

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      ..+||+||+.|-|++++                       ....+||-|+|-|+|-+||||+.+...-
T Consensus       228 etLiHGDLHsGSIfvte-----------------------~etkvIDPEFaFYGPmafDiG~~iaNl~  272 (408)
T COG4857         228 ETLIHGDLHSGSIFVTE-----------------------KETKVIDPEFAFYGPMAFDIGMLIANLW  272 (408)
T ss_pred             HHHhccccccCcEEeec-----------------------CcceeeCccccccCcchhhHHHHHHHHH
Confidence            46899999999999998                       6789999999999999999999886643


No 38 
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=97.84  E-value=1.7e-05  Score=56.68  Aligned_cols=40  Identities=33%  Similarity=0.430  Sum_probs=34.5

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH   72 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh   72 (107)
                      ..++|+|++++|||+..                       +.+.+|||+.|....+..|++.-
T Consensus       109 ~gi~H~Dl~~~Nil~~~-----------------------~~~~liDfg~a~~~~~~~~~~~~  148 (199)
T TIGR03724       109 AGIVHGDLTTSNIIVRD-----------------------DKLYLIDFGLGKYSDEIEDKAVD  148 (199)
T ss_pred             CCeecCCCCcceEEEEC-----------------------CcEEEEECCCCcCCCcHHhhhch
Confidence            35799999999999983                       67999999999999888887643


No 39 
>PRK06148 hypothetical protein; Provisional
Probab=97.77  E-value=3e-05  Score=69.84  Aligned_cols=52  Identities=23%  Similarity=0.265  Sum_probs=41.9

Q ss_pred             CCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeE-EEeeecCCCCchhhhHHHHHHHhhh
Q psy15665          7 KSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLV-VIDFEYCSYNYRAFDIANHFVESVY   78 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~-lIDfEYa~~n~r~fDlanhf~E~~~   78 (107)
                      ..|..+||||++..|||+..+..                    +++. ||||+.|++.++.+|||-.+.-++.
T Consensus       200 ~Lp~~vIHgDln~~NiLv~~~~~--------------------~~isGiIDFgDa~~~~~v~DLAialay~~~  252 (1013)
T PRK06148        200 ALPAQVIHNDANDYNILVDADDG--------------------ERISGLIDFGDAVHAPRICEVAIAAAYAIL  252 (1013)
T ss_pred             cCCcceECCCCCcccEEEcCCCC--------------------cceEEEEECcccccccHHHHHHHHHHHHhc
Confidence            34667999999999999987410                    1455 9999999999999999998765554


No 40 
>PRK14879 serine/threonine protein kinase; Provisional
Probab=97.68  E-value=3.7e-05  Score=55.34  Aligned_cols=39  Identities=23%  Similarity=0.333  Sum_probs=33.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH   72 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh   72 (107)
                      .++|+|++++|||+..                       +.+.||||+.|....+..|.+.-
T Consensus       115 ~i~H~Dl~p~Nil~~~-----------------------~~~~liDf~~a~~~~~~~~~~~~  153 (211)
T PRK14879        115 GIIHGDLTTSNMILSG-----------------------GKIYLIDFGLAEFSKDLEDRAVD  153 (211)
T ss_pred             CcccCCCCcccEEEEC-----------------------CCEEEEECCcccCCCcHHhhhcc
Confidence            4789999999999984                       67999999999998888877643


No 41 
>PF07914 DUF1679:  Protein of unknown function (DUF1679);  InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in zinc finger-C4 and HLH domain-containing kinases. In fact, one member of this family (Q9GUC1 from SWISSPROT) is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (IPR000536 from INTERPRO, IPR008946 from INTERPRO, and IPR001628 from INTERPRO). 
Probab=97.59  E-value=1.1e-05  Score=66.41  Aligned_cols=54  Identities=22%  Similarity=0.302  Sum_probs=43.1

Q ss_pred             cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665          5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE   75 (107)
Q Consensus         5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E   75 (107)
                      ..+.+.|+||+||+..|||...+.+++.                 .=.-||||.-+..+.++.||+-.|+-
T Consensus       263 ~lG~~~VL~HGDLw~~NiLw~k~~~g~~-----------------~l~AIIDwQ~vh~G~~~eDl~Rll~~  316 (414)
T PF07914_consen  263 QLGIKPVLVHGDLWSSNILWDKDSDGKL-----------------KLKAIIDWQCVHRGSPAEDLARLLVS  316 (414)
T ss_pred             hcCCCcceecCCccHHheeeecCCchhH-----------------HHHHHHHHHHhhcCchHHHHHHHHHh
Confidence            4566899999999999999988532211                 23469999999999999999988753


No 42 
>COG3178 Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only]
Probab=97.56  E-value=7.5e-05  Score=60.47  Aligned_cols=52  Identities=19%  Similarity=0.385  Sum_probs=44.3

Q ss_pred             CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665          6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE   75 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E   75 (107)
                      ...|.||||+|.++.|||...+-.+.                  +++-+|||.-|-++|.+||++..+-.
T Consensus       196 ~~~~~vlvhRDfh~~NLmw~~~~~g~------------------~rvGvlDFQDA~iGP~aYDvasL~~D  247 (351)
T COG3178         196 LAQPKVLVHRDFHSRNLMWTADRAGA------------------DRVGVLDFQDALIGPIAYDVASLLRD  247 (351)
T ss_pred             hcCCceeeeccccCccceecCCccCC------------------CCCceeehhhhhcCcchhhHHHHHhh
Confidence            46789999999999999998853322                  57999999999999999999987743


No 43 
>PRK06149 hypothetical protein; Provisional
Probab=97.41  E-value=0.00015  Score=64.96  Aligned_cols=54  Identities=20%  Similarity=0.225  Sum_probs=43.0

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhh
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVY   78 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~   78 (107)
                      .|.-++|||++..|||+..+..+.                 ..-.-||||..++++++.+|||-.+..|+.
T Consensus       206 L~~g~IH~Dl~~~Nilv~~~~~~~-----------------~~v~giIDFgD~~~~~~i~DLAial~~~~~  259 (972)
T PRK06149        206 LPLQAVHLDITDDNVVGSRDADGR-----------------WQPDGVIDFGDLVRTWRVADLAVTCASLLH  259 (972)
T ss_pred             CcccccCCCCCcccEEEcCCCCCC-----------------cceeEEEEcccchhhhHHHHHHHHHHHHhc
Confidence            467899999999999998641110                 022479999999999999999998887764


No 44 
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=97.35  E-value=0.00018  Score=52.09  Aligned_cols=31  Identities=32%  Similarity=0.384  Sum_probs=26.8

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      ..+.|+|++|+|||+.+                       +.++||||..|..-
T Consensus       137 ~givHrDlkP~NIll~~-----------------------~~~~liDFG~a~~~  167 (190)
T cd05145         137 AGLVHGDLSEYNILYHD-----------------------GKPYIIDVSQAVEL  167 (190)
T ss_pred             CCEecCCCChhhEEEEC-----------------------CCEEEEEcccceec
Confidence            46899999999999983                       67999999988763


No 45 
>TIGR02905 spore_yutH spore coat protein YutH. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria.
Probab=97.25  E-value=0.00022  Score=55.97  Aligned_cols=45  Identities=27%  Similarity=0.348  Sum_probs=38.2

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      ...+|||+|+..+|+| .+                       +.+.+|+||++ +.++..||++++...+
T Consensus       187 ~~~~lCH~d~~~hn~l-~~-----------------------~~~~~i~~d~~-~D~~~~DL~~firk~~  231 (313)
T TIGR02905       187 DSGTICHERFGETTWL-ER-----------------------GGLIKPPTEWV-YDHPARDLAEWIRERY  231 (313)
T ss_pred             ccCccccCccCccccc-cC-----------------------CCeEecccccc-cccchhHHHHHHHHHH
Confidence            4679999999999987 33                       67899999954 9999999999988844


No 46 
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=97.21  E-value=0.0002  Score=59.74  Aligned_cols=41  Identities=29%  Similarity=0.367  Sum_probs=35.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHH
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFV   74 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~   74 (107)
                      .++|+|++|+|||+.+                       +.++||||+.|.......|++..+.
T Consensus       448 giiHrDlkp~NILl~~-----------------------~~~~liDFGla~~~~~~~d~a~~l~  488 (535)
T PRK09605        448 GIVHGDLTTSNFIVRD-----------------------DRLYLIDFGLGKYSDLIEDKAVDLH  488 (535)
T ss_pred             CCccCCCChHHEEEEC-----------------------CcEEEEeCcccccCCchHhhhhhHH
Confidence            4799999999999943                       6799999999999999999887553


No 47 
>PF06293 Kdo:  Lipopolysaccharide kinase (Kdo/WaaP) family;  InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=97.09  E-value=0.00035  Score=51.59  Aligned_cols=45  Identities=27%  Similarity=0.405  Sum_probs=33.8

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc-----hhhhHHHHH
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY-----RAFDIANHF   73 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----r~fDlanhf   73 (107)
                      ..++|+||.++|||+..+..                   ...+.+||||-+....     +.-||+-..
T Consensus       137 ~gi~H~Dl~~~NILv~~~~~-------------------~~~~~lIDld~~~~~~~~~~~~~~dL~~L~  186 (206)
T PF06293_consen  137 AGIYHGDLNPSNILVDPDDG-------------------QYRFYLIDLDRMRFRPSSRRWRAKDLARLL  186 (206)
T ss_pred             CcCCCCCCCcccEEEeCCCC-------------------ceeEEEEcchhceeCCCChHHHHHhHHHHH
Confidence            35899999999999998521                   1479999999888766     355655443


No 48 
>PF04655 APH_6_hur:  Aminoglycoside/hydroxyurea antibiotic resistance kinase;  InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties []. Aminoglycoside phosphotransferases achieve inactivation of these enzymes by phosphorylation, utilising ATP. Likewise, hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0006468 protein phosphorylation, 0019748 secondary metabolic process
Probab=97.07  E-value=0.00037  Score=54.15  Aligned_cols=50  Identities=24%  Similarity=0.268  Sum_probs=41.1

Q ss_pred             cCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665          5 KIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus         5 ~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      ....+.|+.|+|||.+|||-...                      ...+.||-.-.- +.++||+++.|+...
T Consensus       155 ~~~~~~~lLHGDLH~~NIL~~~~----------------------~~WlaIDPkgl~-Gdp~yd~a~~l~n~~  204 (253)
T PF04655_consen  155 ASPGEEVLLHGDLHHGNILAAGR----------------------RGWLAIDPKGLV-GDPAYDLAPLLRNPL  204 (253)
T ss_pred             cCCCcceeeccccchHhhhccCC----------------------CCceEeCCcccc-cccccCHHHHHhCcc
Confidence            34556789999999999997663                      678999987544 699999999998775


No 49 
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=96.98  E-value=0.00054  Score=50.17  Aligned_cols=28  Identities=36%  Similarity=0.549  Sum_probs=24.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -+.|+|++|+|||+.+                       +.+.||||--|.
T Consensus       138 giiHrDlkP~NIli~~-----------------------~~v~LiDFG~a~  165 (190)
T cd05147         138 RLVHADLSEYNLLYHD-----------------------GKLYIIDVSQSV  165 (190)
T ss_pred             CcccCCCCHHHEEEEC-----------------------CcEEEEEccccc
Confidence            5899999999999985                       669999999876


No 50 
>PRK12274 serine/threonine protein kinase; Provisional
Probab=96.98  E-value=0.00044  Score=53.07  Aligned_cols=33  Identities=36%  Similarity=0.460  Sum_probs=27.0

Q ss_pred             eEEEeccc-CCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665         10 VTFCHNDL-QEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY   64 (107)
Q Consensus        10 ~VfcHnDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   64 (107)
                      ..++|+|| +++|||+..+                      +.+.||||.-|....
T Consensus       110 ~GIvHrDL~kp~NILv~~~----------------------g~i~LIDFG~A~~~~  143 (218)
T PRK12274        110 CGVAHNDLAKEANWLVQED----------------------GSPAVIDFQLAVRGN  143 (218)
T ss_pred             CcCccCCCCCcceEEEcCC----------------------CCEEEEECCCceecC
Confidence            35899999 7999999763                      679999999887544


No 51 
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=96.87  E-value=0.00093  Score=51.48  Aligned_cols=44  Identities=23%  Similarity=0.242  Sum_probs=33.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC--chhhhHHHHHHHhhhc
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN--YRAFDIANHFVESVYD   79 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n--~r~fDlanhf~E~~~d   79 (107)
                      -+.|+|++|||||+++.                      + +.||||-.+...  ..+.|+  ++.|-.|+
T Consensus       155 gi~H~Dikp~Nili~~~----------------------g-i~liDfg~~~~~~e~~a~d~--~vler~y~  200 (232)
T PRK10359        155 GMVSGDPHKGNFIVSKN----------------------G-LRIIDLSGKRCTAQRKAKDR--IDLERHYG  200 (232)
T ss_pred             CCccCCCChHHEEEeCC----------------------C-EEEEECCCcccccchhhHHH--HHHHhHhc
Confidence            57899999999999873                      5 999998655443  446676  67777666


No 52 
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=96.85  E-value=0.00068  Score=51.44  Aligned_cols=32  Identities=28%  Similarity=0.357  Sum_probs=26.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY   64 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   64 (107)
                      .+.|+||+|+|||+..+                      +.+.||||+-+....
T Consensus       162 GI~HrDlkp~NILv~~~----------------------~~v~LIDfg~~~~~~  193 (239)
T PRK01723        162 GVYHADLNAHNILLDPD----------------------GKFWLIDFDRGELRT  193 (239)
T ss_pred             CCCCCCCCchhEEEcCC----------------------CCEEEEECCCcccCC
Confidence            47899999999999874                      579999999776653


No 53 
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=96.83  E-value=0.00075  Score=48.73  Aligned_cols=30  Identities=30%  Similarity=0.389  Sum_probs=25.8

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+|++|+|||+..+                      +.+.||||-.|.
T Consensus       144 ~gi~H~Dl~p~Nill~~~----------------------~~~~liDfg~~~  173 (198)
T cd05144         144 HGIIHGDLSEFNILVDDD----------------------EKIYIIDWPQMV  173 (198)
T ss_pred             CCCCcCCCCcccEEEcCC----------------------CcEEEEECCccc
Confidence            358999999999999864                      779999999873


No 54 
>smart00090 RIO RIO-like kinase.
Probab=96.81  E-value=0.00088  Score=50.84  Aligned_cols=29  Identities=34%  Similarity=0.414  Sum_probs=25.4

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      ++|+|++|+|||+..                       +.+.||||..|..-
T Consensus       170 iiH~Dikp~NIli~~-----------------------~~i~LiDFg~a~~~  198 (237)
T smart00090      170 LVHGDLSEYNILVHD-----------------------GKVVIIDVSQSVEL  198 (237)
T ss_pred             EEeCCCChhhEEEEC-----------------------CCEEEEEChhhhcc
Confidence            899999999999983                       67999999988843


No 55 
>PF01163 RIO1:  RIO1 family;  InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date.   Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=96.70  E-value=0.0011  Score=49.38  Aligned_cols=37  Identities=30%  Similarity=0.371  Sum_probs=25.8

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC--CCchhhhH
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS--YNYRAFDI   69 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~--~n~r~fDl   69 (107)
                      ..+.|+||.+.|||+.+                       +++++|||+-|-  -+|++.++
T Consensus       126 ~givHGDLs~~NIlv~~-----------------------~~~~iIDf~qav~~~~p~a~~~  164 (188)
T PF01163_consen  126 AGIVHGDLSEYNILVDD-----------------------GKVYIIDFGQAVDSSHPNAEEL  164 (188)
T ss_dssp             TTEEESS-STTSEEEET-----------------------TCEEE--GTTEEETTSTTHHHH
T ss_pred             cCceecCCChhhEEeec-----------------------ceEEEEecCcceecCCccHHHH
Confidence            45899999999999998                       679999998442  25555544


No 56 
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=96.69  E-value=0.001  Score=46.86  Aligned_cols=29  Identities=31%  Similarity=0.402  Sum_probs=25.0

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+|++|+|||+.+                       +.+.+|||.-|.
T Consensus       134 ~~ivH~Dl~p~Nili~~-----------------------~~~~liDfg~a~  162 (187)
T cd05119         134 AGLVHGDLSEYNILVDD-----------------------GKVYIIDVPQAV  162 (187)
T ss_pred             cCcCcCCCChhhEEEEC-----------------------CcEEEEECcccc
Confidence            45789999999999993                       679999998775


No 57 
>PF03881 Fructosamin_kin:  Fructosamine kinase;  InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []. Ketosamine-3-kinases (KT3K), of which fructosamine-3-kinase (FN3K) is the best-known example, catalyse the phosphorylation of the ketosamine moiety of glycated proteins. The instability of a phosphorylated ketosamine leads to its degradation, and KT3K is thus thought to be involved in protein repair []. The function of the prokaryotic members of this group has not been established. However, several lines of evidence indicate that they may function as fructosamine-3-kinases (FN3K). First, they are similar to characterised FN3K from mouse and human. Second, the Escherichia coli members are found in close proximity on the genome to fructose-6-phosphate kinase (PfkB). Last, FN3K activity has been found in a Anacystis montana (Gloeocapsa montana Kutzing 1843) [], indicating such activity-directly demonstrated in eukaryotes-is nonetheless not confined to eukaryotes. This family includes eukaryotic fructosamine-3-kinase enzymes [] which may initiate a process leading to the deglycation of fructoselysine and of glycated proteins and in the phosphorylation of 1-deoxy-1-morpholinofructose, fructoselysine, fructoseglycine, fructose and glycated lysozyme. The family also includes bacterial members that have not been characterised but probably have a similar or identical function. For additional information please see [].; PDB: 3JR1_B 3F7W_A.
Probab=96.59  E-value=0.0014  Score=51.68  Aligned_cols=44  Identities=27%  Similarity=0.430  Sum_probs=28.2

Q ss_pred             CCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665          6 IKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH   72 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh   72 (107)
                      ...+-+++|+||+.||++...+                      ++.+|||== +-|+.|.+|||..
T Consensus       184 ~~~~PsLlHGDLW~GN~~~~~~----------------------g~p~l~DPa-~yygh~E~DLam~  227 (288)
T PF03881_consen  184 REPKPSLLHGDLWSGNVGFDAD----------------------GEPVLFDPA-CYYGHREVDLAMT  227 (288)
T ss_dssp             S----EEE-SS-SGGGEEEETT----------------------E-EEE-S----EEE-CHHHHHHH
T ss_pred             CCCCceeeEcCccccceeecCC----------------------CCceeeccc-cccCchHhhhhhh
Confidence            3445699999999999999984                      568999986 7789999999963


No 58 
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=96.53  E-value=0.0017  Score=53.57  Aligned_cols=33  Identities=27%  Similarity=0.446  Sum_probs=27.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      .++|+|++||||++.++                      +.+.+|||-.++.-.+
T Consensus       277 g~~H~D~hPgNilv~~~----------------------g~i~liDfG~~~~l~~  309 (437)
T TIGR01982       277 GFFHADLHPGNIFVLKD----------------------GKIIALDFGIVGRLSE  309 (437)
T ss_pred             CceeCCCCcccEEECCC----------------------CcEEEEeCCCeeECCH
Confidence            47999999999999774                      6799999998876543


No 59 
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=96.48  E-value=0.0016  Score=48.94  Aligned_cols=28  Identities=29%  Similarity=0.443  Sum_probs=24.4

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .-++|+||.+-|||+.+                       ++++||||.-|
T Consensus       144 ~glVHGDLs~~NIL~~~-----------------------~~v~iIDF~qa  171 (197)
T cd05146         144 CNLVHADLSEYNMLWHD-----------------------GKVWFIDVSQS  171 (197)
T ss_pred             CCeecCCCCHHHEEEEC-----------------------CcEEEEECCCc
Confidence            46899999999999986                       67999999854


No 60 
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=96.30  E-value=0.0025  Score=43.26  Aligned_cols=34  Identities=24%  Similarity=0.290  Sum_probs=28.7

Q ss_pred             EEEecccCCCceeeec-CCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchh
Q psy15665         11 TFCHNDLQEGNILYRE-SPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRA   66 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~-~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~   66 (107)
                      .++|+|++++||++.. .                      +.+.+|||+++......
T Consensus       112 ~~~H~dl~~~ni~~~~~~----------------------~~~~l~d~~~~~~~~~~  146 (215)
T cd00180         112 GIIHRDLKPENILLDSDN----------------------GKVKLADFGLSKLLTSD  146 (215)
T ss_pred             CeeccCCCHhhEEEeCCC----------------------CcEEEecCCceEEccCC
Confidence            6899999999999987 3                      67999999988765443


No 61 
>PF06176 WaaY:  Lipopolysaccharide core biosynthesis protein (WaaY);  InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system [].; GO: 0009244 lipopolysaccharide core region biosynthetic process
Probab=96.28  E-value=0.0029  Score=48.99  Aligned_cols=29  Identities=28%  Similarity=0.350  Sum_probs=24.8

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..+-|+|+||||+|+.+                       +++.+||+.-.+
T Consensus       154 ~G~~HGD~hpgNFlv~~-----------------------~~i~iID~~~k~  182 (229)
T PF06176_consen  154 HGFYHGDPHPGNFLVSN-----------------------NGIRIIDTQGKR  182 (229)
T ss_pred             cCCccCCCCcCcEEEEC-----------------------CcEEEEECcccc
Confidence            46889999999999997                       679999997543


No 62 
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=96.14  E-value=0.0022  Score=46.31  Aligned_cols=29  Identities=31%  Similarity=0.485  Sum_probs=25.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+...                      +.+.||||..+.
T Consensus       118 ~i~H~dikp~NIl~~~~----------------------~~~~l~Dfg~~~  146 (260)
T PF00069_consen  118 GIVHRDIKPENILLDEN----------------------GEVKLIDFGSSV  146 (260)
T ss_dssp             TEEESSBSGGGEEESTT----------------------SEEEESSGTTTE
T ss_pred             ccccccccccccccccc----------------------cccccccccccc
Confidence            47999999999999964                      678999998875


No 63 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=96.12  E-value=0.0031  Score=48.34  Aligned_cols=30  Identities=30%  Similarity=0.473  Sum_probs=25.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|..
T Consensus       116 givH~Dlkp~NIll~~~----------------------~~~kL~DfG~~~~  145 (325)
T cd05604         116 NIVYRDLKPENILLDSQ----------------------GHVVLTDFGLCKE  145 (325)
T ss_pred             CeeecCCCHHHeEECCC----------------------CCEEEeecCCccc
Confidence            48999999999999874                      6799999987653


No 64 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=96.00  E-value=0.004  Score=48.51  Aligned_cols=29  Identities=28%  Similarity=0.575  Sum_probs=25.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..|.
T Consensus       121 givHrDLkp~NIli~~~----------------------~~vkL~DfG~~~  149 (360)
T cd05627         121 GFIHRDIKPDNLLLDAK----------------------GHVKLSDFGLCT  149 (360)
T ss_pred             CeEccCCCHHHEEECCC----------------------CCEEEeeccCCc
Confidence            47899999999999764                      779999998775


No 65 
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=95.99  E-value=0.0043  Score=52.94  Aligned_cols=37  Identities=27%  Similarity=0.482  Sum_probs=28.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      .|.|.|+|||||++..+...                  .+++++|||=-+|.-.+
T Consensus       280 GffHaDpHPGNIlv~~~g~~------------------~~~i~llDFGivg~l~~  316 (537)
T PRK04750        280 GFFHADMHPGNIFVSYDPPE------------------NPRYIALDFGIVGSLNK  316 (537)
T ss_pred             CeeeCCCChHHeEEecCCCC------------------CCeEEEEecceEEECCH
Confidence            58999999999999874111                  14899999987775444


No 66 
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=95.95  E-value=0.0062  Score=46.65  Aligned_cols=30  Identities=20%  Similarity=0.406  Sum_probs=25.1

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+||++.|||+..+                      +.++|+||..|.
T Consensus       115 ~~ivHrDikp~NIll~~~----------------------~~~kL~Dfg~~~  144 (325)
T cd05594         115 KNVVYRDLKLENLMLDKD----------------------GHIKITDFGLCK  144 (325)
T ss_pred             CCEEecCCCCCeEEECCC----------------------CCEEEecCCCCe
Confidence            458999999999999874                      678999997654


No 67 
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=95.93  E-value=0.0038  Score=47.69  Aligned_cols=29  Identities=31%  Similarity=0.508  Sum_probs=24.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       116 ~ivH~Dlkp~NIll~~~----------------------~~~kl~Dfg~~~  144 (321)
T cd05603         116 NIIYRDLKPENILLDSQ----------------------GHVVLTDFGLCK  144 (321)
T ss_pred             CeEeccCCHHHeEECCC----------------------CCEEEccCCCCc
Confidence            47999999999999874                      678999998664


No 68 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=95.91  E-value=0.0046  Score=48.94  Aligned_cols=29  Identities=28%  Similarity=0.495  Sum_probs=24.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..|.
T Consensus       162 ~IvHrDLKp~NILl~~~----------------------~~~kL~DFG~a~  190 (370)
T cd05621         162 GLIHRDVKPDNMLLDKH----------------------GHLKLADFGTCM  190 (370)
T ss_pred             CeEecCCCHHHEEECCC----------------------CCEEEEecccce
Confidence            58999999999999764                      679999998664


No 69 
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=95.91  E-value=0.0052  Score=44.22  Aligned_cols=29  Identities=31%  Similarity=0.477  Sum_probs=23.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|++++||++..+                      +.+.++||.++.
T Consensus       123 ~~~h~dl~~~nil~~~~----------------------~~~~l~dfg~~~  151 (258)
T smart00219      123 NFIHRDLAARNCLVGEN----------------------LVVKISDFGLSR  151 (258)
T ss_pred             CeeecccccceEEEccC----------------------CeEEEcccCCce
Confidence            57999999999999874                      568888887764


No 70 
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=95.90  E-value=0.0046  Score=47.11  Aligned_cols=30  Identities=27%  Similarity=0.418  Sum_probs=25.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      -++|+||++.|||+..+                      +.+.|+||..|..
T Consensus       113 ~i~HrDlkp~Nili~~~----------------------~~~kl~Dfg~~~~  142 (312)
T cd05585         113 NVIYRDLKPENILLDYQ----------------------GHIALCDFGLCKL  142 (312)
T ss_pred             CeEeCCCCHHHeEECCC----------------------CcEEEEECccccc
Confidence            47999999999999764                      6789999987654


No 71 
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=95.89  E-value=0.0051  Score=44.99  Aligned_cols=17  Identities=35%  Similarity=0.620  Sum_probs=15.2

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++...
T Consensus       123 ~i~H~dl~p~Nil~~~~  139 (261)
T cd05068         123 NYIHRDLAARNVLVGEN  139 (261)
T ss_pred             CeeeccCCcceEEEcCC
Confidence            48999999999999874


No 72 
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=95.89  E-value=0.0051  Score=44.88  Aligned_cols=29  Identities=34%  Similarity=0.444  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++.++                      +.+.++||..+.
T Consensus       122 ~i~H~dlkp~nil~~~~----------------------~~~kl~dfg~~~  150 (256)
T cd05082         122 NFVHRDLAARNVLVSED----------------------NVAKVSDFGLTK  150 (256)
T ss_pred             CEeccccchheEEEcCC----------------------CcEEecCCccce
Confidence            48999999999999874                      667888886544


No 73 
>KOG0667|consensus
Probab=95.89  E-value=0.0053  Score=53.08  Aligned_cols=34  Identities=29%  Similarity=0.503  Sum_probs=27.0

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .+.+.|+||+|.|||+.+..                    +..|.||||-=|++
T Consensus       307 ~l~IIHcDLKPENILL~~~~--------------------r~~vKVIDFGSSc~  340 (586)
T KOG0667|consen  307 ELGIIHCDLKPENILLKDPK--------------------RSRIKVIDFGSSCF  340 (586)
T ss_pred             hCCeeeccCChhheeeccCC--------------------cCceeEEecccccc
Confidence            45689999999999998741                    15799999976654


No 74 
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=95.87  E-value=0.0045  Score=47.47  Aligned_cols=30  Identities=23%  Similarity=0.328  Sum_probs=25.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      -++|+||++.|||+...                      +.+.|+||..+..
T Consensus       116 ~ivHrDlkp~Nili~~~----------------------~~~kl~Dfg~a~~  145 (330)
T cd05586         116 DIVYRDLKPENILLDAT----------------------GHIALCDFGLSKA  145 (330)
T ss_pred             CeEeccCCHHHeEECCC----------------------CCEEEecCCcCcC
Confidence            48999999999999874                      6789999987754


No 75 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=95.86  E-value=0.0043  Score=47.49  Aligned_cols=29  Identities=24%  Similarity=0.331  Sum_probs=24.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.++|+||..+.
T Consensus       125 ~ivHrDlkp~Nili~~~----------------------~~~kl~DfG~~~  153 (332)
T cd05614         125 GIVYRDIKLENILLDSE----------------------GHVVLTDFGLSK  153 (332)
T ss_pred             CcEecCCCHHHeEECCC----------------------CCEEEeeCcCCc
Confidence            47999999999999874                      678899997654


No 76 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=95.86  E-value=0.0054  Score=44.94  Aligned_cols=29  Identities=28%  Similarity=0.518  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||+++||++.++                      ..+.++||..+.
T Consensus       122 ~i~H~dl~~~Nill~~~----------------------~~~~l~dfg~~~  150 (260)
T cd05069         122 NYIHRDLRAANILVGDN----------------------LVCKIADFGLAR  150 (260)
T ss_pred             CEeecccCcceEEEcCC----------------------CeEEECCCccce
Confidence            48999999999999874                      567777877664


No 77 
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=95.85  E-value=0.004  Score=46.08  Aligned_cols=28  Identities=29%  Similarity=0.426  Sum_probs=22.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+|+++.|||+..+                      +.+.|+||..+
T Consensus       128 ~ivH~dikp~Nili~~~----------------------~~~kl~dfg~~  155 (288)
T cd07863         128 CIVHRDLKPENILVTSG----------------------GQVKLADFGLA  155 (288)
T ss_pred             CeecCCCCHHHEEECCC----------------------CCEEECccCcc
Confidence            47899999999999874                      56788888655


No 78 
>PHA02882 putative serine/threonine kinase; Provisional
Probab=95.85  E-value=0.0056  Score=46.28  Aligned_cols=28  Identities=21%  Similarity=0.367  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -+.|+||+|.|||+...                      ..++|+||-.|
T Consensus       146 ~iiHrDiKp~Nill~~~----------------------~~~~l~DFGla  173 (294)
T PHA02882        146 GISHGDIKPENIMVDGN----------------------NRGYIIDYGIA  173 (294)
T ss_pred             CeecCCCCHHHEEEcCC----------------------CcEEEEEcCCc
Confidence            47899999999999764                      56788888765


No 79 
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=95.81  E-value=0.005  Score=44.88  Aligned_cols=29  Identities=34%  Similarity=0.381  Sum_probs=23.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|++++|||+...                      +.+.|+||..+.
T Consensus       120 ~~~H~dl~p~nili~~~----------------------~~~kl~Dfg~~~  148 (254)
T cd05083         120 KLVHRDLAARNILVSED----------------------GVAKVSDFGLAR  148 (254)
T ss_pred             CeeccccCcceEEEcCC----------------------CcEEECCCccce
Confidence            57999999999999774                      567888887554


No 80 
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=95.79  E-value=0.0051  Score=47.04  Aligned_cols=29  Identities=21%  Similarity=0.442  Sum_probs=24.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..|.
T Consensus       122 ~i~H~Dlkp~NIll~~~----------------------~~~kL~Dfg~a~  150 (330)
T cd05601         122 GYVHRDIKPENVLIDRT----------------------GHIKLADFGSAA  150 (330)
T ss_pred             CeEcccCchHheEECCC----------------------CCEEeccCCCCe
Confidence            47999999999999874                      678999998664


No 81 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=95.79  E-value=0.0048  Score=47.26  Aligned_cols=31  Identities=29%  Similarity=0.551  Sum_probs=26.2

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ..++|+||++.|||+...                      +.+.|+||..|..
T Consensus       120 ~giiH~Dlkp~NIll~~~----------------------~~~kL~Dfg~~~~  150 (350)
T cd05573         120 LGFIHRDIKPDNILIDAD----------------------GHIKLADFGLCKK  150 (350)
T ss_pred             CCeeccCCCHHHeEECCC----------------------CCEEeecCCCCcc
Confidence            358999999999999874                      6799999987753


No 82 
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=95.77  E-value=0.0057  Score=44.51  Aligned_cols=30  Identities=33%  Similarity=0.472  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||++.||++..+                      +.+.++||..+..
T Consensus       122 ~i~H~di~p~Nili~~~----------------------~~~~l~d~g~~~~  151 (256)
T cd05039         122 NFVHRDLAARNVLVSED----------------------LVAKVSDFGLAKE  151 (256)
T ss_pred             CccchhcccceEEEeCC----------------------CCEEEcccccccc
Confidence            57999999999999874                      5677888875543


No 83 
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=95.77  E-value=0.0057  Score=47.17  Aligned_cols=28  Identities=25%  Similarity=0.593  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+||++.|||+..+                      +.+.|+||..|
T Consensus       122 ~ivH~dlkp~Nill~~~----------------------~~~kl~Dfg~~  149 (331)
T cd05597         122 GYVHRDIKPDNVLLDKN----------------------GHIRLADFGSC  149 (331)
T ss_pred             CeEECCCCHHHEEECCC----------------------CCEEEEECCce
Confidence            37899999999999764                      67899999764


No 84 
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=95.76  E-value=0.0067  Score=49.76  Aligned_cols=29  Identities=24%  Similarity=0.385  Sum_probs=24.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+...                      +.+.|+||..|.
T Consensus       189 ~ivHrDlkp~NIll~~~----------------------~~~kL~DFgla~  217 (478)
T PTZ00267        189 KMMHRDLKSANIFLMPT----------------------GIIKLGDFGFSK  217 (478)
T ss_pred             CEEECCcCHHhEEECCC----------------------CcEEEEeCcCce
Confidence            47999999999999874                      678999998664


No 85 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=95.75  E-value=0.0058  Score=47.77  Aligned_cols=29  Identities=31%  Similarity=0.615  Sum_probs=25.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||-.|.
T Consensus       121 ~ivHrDlkp~Nill~~~----------------------~~ikL~DFG~a~  149 (376)
T cd05598         121 GFIHRDIKPDNILIDRD----------------------GHIKLTDFGLCT  149 (376)
T ss_pred             CeEeCCCCHHHEEECCC----------------------CCEEEEeCCCCc
Confidence            47899999999999874                      679999998764


No 86 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=95.75  E-value=0.0059  Score=47.68  Aligned_cols=30  Identities=27%  Similarity=0.514  Sum_probs=25.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||++.|||+...                      +.+.|+||..|..
T Consensus       121 givHrDlKp~NILi~~~----------------------~~vkL~DFGla~~  150 (363)
T cd05628         121 GFIHRDIKPDNLLLDSK----------------------GHVKLSDFGLCTG  150 (363)
T ss_pred             CeEecCCCHHHeEECCC----------------------CCEEEeeccCccc
Confidence            57899999999999774                      6799999987753


No 87 
>KOG0594|consensus
Probab=95.72  E-value=0.007  Score=49.01  Aligned_cols=27  Identities=33%  Similarity=0.420  Sum_probs=22.5

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      +.|+||+|.|||++++                      +.+.++||--|
T Consensus       141 IlHRDLKPQNlLi~~~----------------------G~lKlaDFGlA  167 (323)
T KOG0594|consen  141 ILHRDLKPQNLLISSS----------------------GVLKLADFGLA  167 (323)
T ss_pred             eecccCCcceEEECCC----------------------CcEeeeccchH
Confidence            5799999999999985                      77888888544


No 88 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=95.70  E-value=0.0059  Score=45.20  Aligned_cols=17  Identities=29%  Similarity=0.563  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+.+.
T Consensus       129 ~iiH~dlkp~Nil~~~~  145 (279)
T cd05109         129 RLVHRDLAARNVLVKSP  145 (279)
T ss_pred             CeeccccccceEEEcCC
Confidence            47899999999999764


No 89 
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=95.70  E-value=0.0062  Score=46.67  Aligned_cols=29  Identities=21%  Similarity=0.410  Sum_probs=24.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       121 ~ivH~dlkp~Nill~~~----------------------~~~kL~Dfg~~~  149 (324)
T cd05587         121 GIIYRDLKLDNVMLDAE----------------------GHIKIADFGMCK  149 (324)
T ss_pred             CeEecCCCHHHeEEcCC----------------------CCEEEeecCcce
Confidence            48999999999999874                      668889987653


No 90 
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=95.70  E-value=0.0058  Score=46.88  Aligned_cols=29  Identities=28%  Similarity=0.429  Sum_probs=24.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+...                      +.++|+||..+.
T Consensus       120 ~ivH~dlkp~Nil~~~~----------------------~~~kl~Dfg~~~  148 (323)
T cd05584         120 GIIYRDLKPENILLDAQ----------------------GHVKLTDFGLCK  148 (323)
T ss_pred             CeecCCCCHHHeEECCC----------------------CCEEEeeCcCCe
Confidence            47999999999999774                      678899987653


No 91 
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=95.68  E-value=0.0088  Score=43.31  Aligned_cols=28  Identities=21%  Similarity=0.291  Sum_probs=22.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+|+++.||++..+                      +.+.++||..+
T Consensus       122 ~i~H~di~p~nil~~~~----------------------~~~~l~df~~~  149 (257)
T cd08223         122 HILHRDLKTQNVFLTRT----------------------NIIKVGDLGIA  149 (257)
T ss_pred             CeeccCCCchhEEEecC----------------------CcEEEecccce
Confidence            47999999999999874                      56778887755


No 92 
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=95.66  E-value=0.0056  Score=46.91  Aligned_cols=29  Identities=31%  Similarity=0.532  Sum_probs=24.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       116 giiHrDlkp~Nili~~~----------------------~~~kl~DfG~a~  144 (325)
T cd05602         116 NIVYRDLKPENILLDSQ----------------------GHIVLTDFGLCK  144 (325)
T ss_pred             CeEecCCCHHHeEECCC----------------------CCEEEccCCCCc
Confidence            58999999999999764                      678899987654


No 93 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=95.65  E-value=0.0068  Score=46.71  Aligned_cols=29  Identities=24%  Similarity=0.387  Sum_probs=24.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..+.
T Consensus       138 ~ivH~dlkp~NIll~~~----------------------~~~kl~Dfg~~~  166 (329)
T PTZ00263        138 DIIYRDLKPENLLLDNK----------------------GHVKVTDFGFAK  166 (329)
T ss_pred             CeeecCCCHHHEEECCC----------------------CCEEEeeccCce
Confidence            47999999999999874                      678999998664


No 94 
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=95.64  E-value=0.0061  Score=44.26  Aligned_cols=17  Identities=35%  Similarity=0.407  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+..+
T Consensus       114 ~i~H~dl~p~nil~~~~  130 (252)
T cd05084         114 HCIHRDLAARNCLVTEK  130 (252)
T ss_pred             CccccccchheEEEcCC
Confidence            37899999999999764


No 95 
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=95.63  E-value=0.007  Score=46.43  Aligned_cols=29  Identities=21%  Similarity=0.433  Sum_probs=24.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       115 ~ivHrDlkp~NIll~~~----------------------~~~kl~DfG~a~  143 (323)
T cd05571         115 DVVYRDLKLENLMLDKD----------------------GHIKITDFGLCK  143 (323)
T ss_pred             CeEeCCCCHHHEEECCC----------------------CCEEEeeCCCCc
Confidence            48999999999999774                      678899997654


No 96 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=95.63  E-value=0.0055  Score=46.36  Aligned_cols=17  Identities=35%  Similarity=0.536  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       124 ~ivH~dlkp~Nill~~~  140 (309)
T cd07872         124 KVLHRDLKPQNLLINER  140 (309)
T ss_pred             CeecCCCCHHHEEECCC
Confidence            47999999999999874


No 97 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=95.63  E-value=0.0051  Score=46.40  Aligned_cols=17  Identities=29%  Similarity=0.520  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       123 ~ivH~dlkp~Nill~~~  139 (303)
T cd07869         123 YILHRDLKPQNLLISDT  139 (303)
T ss_pred             CeecCCCCHHHEEECCC
Confidence            47999999999999764


No 98 
>COG3570 StrB Streptomycin 6-kinase [Defense mechanisms]
Probab=95.63  E-value=0.0057  Score=47.93  Aligned_cols=51  Identities=33%  Similarity=0.420  Sum_probs=39.8

Q ss_pred             ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhh
Q psy15665          4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESV   77 (107)
Q Consensus         4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~   77 (107)
                      -.....++.-|+||+-||||-.+.                      ..-++||=-=. .+.||||.||.||.-.
T Consensus       155 L~~p~di~pLHGDlHH~Nild~~~----------------------rGWlvIDPkgl-~Gdrg~D~ANlf~Np~  205 (274)
T COG3570         155 LDTPRDIRPLHGDLHHGNILDGDR----------------------RGWLVIDPKGL-IGDRGFDYANLFCNPL  205 (274)
T ss_pred             hcCccccccCcccccccccccCCc----------------------CceEEEccccc-cCccccchHhhhcCCc
Confidence            345566888999999999996553                      57889997533 3689999999999754


No 99 
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=95.62  E-value=0.0067  Score=46.45  Aligned_cols=29  Identities=31%  Similarity=0.508  Sum_probs=24.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..+.
T Consensus       116 givH~dikp~NIll~~~----------------------~~~kl~Dfg~~~  144 (323)
T cd05575         116 NIIYRDLKPENILLDSQ----------------------GHVVLTDFGLCK  144 (323)
T ss_pred             CeEeCCCCHHHeEECCC----------------------CcEEEeccCCCc
Confidence            47899999999999774                      678899997664


No 100
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=95.60  E-value=0.0068  Score=43.66  Aligned_cols=32  Identities=25%  Similarity=0.333  Sum_probs=25.6

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ...++|+|+++.||++.++                      +.+.++||..+..
T Consensus       128 ~~~i~h~dl~p~nili~~~----------------------~~~kl~d~g~~~~  159 (265)
T cd08217         128 GNTVLHRDLKPANIFLDAN----------------------NNVKLGDFGLAKI  159 (265)
T ss_pred             cCcceecCCCHHHEEEecC----------------------CCEEEeccccccc
Confidence            4568999999999999874                      6678888876553


No 101
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=95.60  E-value=0.013  Score=44.75  Aligned_cols=38  Identities=26%  Similarity=0.351  Sum_probs=30.8

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHH
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIA   70 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDla   70 (107)
                      -.++|+||...||++..                       +++.+|||-.+-++--.=|.|
T Consensus       111 ~givHGDLTtsNiIl~~-----------------------~~i~~IDfGLg~~s~~~Ed~a  148 (204)
T COG3642         111 AGIVHGDLTTSNIILSG-----------------------GRIYFIDFGLGEFSDEVEDKA  148 (204)
T ss_pred             cCeecCCCccceEEEeC-----------------------CcEEEEECCcccccccHHhhh
Confidence            45899999999999998                       669999998888776544443


No 102
>PRK09188 serine/threonine protein kinase; Provisional
Probab=95.60  E-value=0.0091  Score=48.60  Aligned_cols=38  Identities=32%  Similarity=0.322  Sum_probs=29.4

Q ss_pred             EEEeccc-CCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHH
Q psy15665         11 TFCHNDL-QEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIA   70 (107)
Q Consensus        11 VfcHnDl-~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDla   70 (107)
                      .++|+|| +|+|||+..+                      +.+.||||.-|..-.+.-.++
T Consensus       131 gIiHrDL~KP~NILv~~~----------------------~~ikLiDFGlA~~~~~~~~~~  169 (365)
T PRK09188        131 GITHNDLAKPQNWLMGPD----------------------GEAAVIDFQLASVFRRRGALY  169 (365)
T ss_pred             CCeeCCCCCcceEEEcCC----------------------CCEEEEECccceecccCcchh
Confidence            5799999 8999999653                      679999999888655543333


No 103
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=95.60  E-value=0.0078  Score=45.45  Aligned_cols=30  Identities=30%  Similarity=0.427  Sum_probs=25.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      -++|+||++.||++..+                      +.++|+||+.+..
T Consensus       123 ~i~H~dlkp~Nili~~~----------------------~~~~l~dfg~~~~  152 (316)
T cd05574         123 GIVYRDLKPENILLHES----------------------GHIMLSDFDLSKQ  152 (316)
T ss_pred             CeeccCCChHHeEEcCC----------------------CCEEEeecchhhc
Confidence            47999999999999874                      6799999998764


No 104
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=95.59  E-value=0.0076  Score=46.47  Aligned_cols=29  Identities=24%  Similarity=0.566  Sum_probs=23.9

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .-++|+||++.|||+...                      +.+.|+||..|
T Consensus       121 ~~iiHrDlkp~Nill~~~----------------------~~~kl~DfG~a  149 (331)
T cd05624         121 LHYVHRDIKPDNVLLDMN----------------------GHIRLADFGSC  149 (331)
T ss_pred             CCeeeccCchHHEEEcCC----------------------CCEEEEeccce
Confidence            347899999999999764                      67899999654


No 105
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=95.58  E-value=0.0064  Score=46.57  Aligned_cols=29  Identities=21%  Similarity=0.413  Sum_probs=24.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       121 ~ivHrDlkp~Nill~~~----------------------~~~kL~DfG~~~  149 (323)
T cd05616         121 GIIYRDLKLDNVMLDSE----------------------GHIKIADFGMCK  149 (323)
T ss_pred             CEEecCCCHHHeEECCC----------------------CcEEEccCCCce
Confidence            48999999999999874                      678888887653


No 106
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=95.57  E-value=0.0078  Score=51.26  Aligned_cols=34  Identities=32%  Similarity=0.411  Sum_probs=28.4

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      -.|-|.|+|||||++..+                      +.++++||--.|.=..
T Consensus       284 dgffHaDpHpGNi~v~~~----------------------g~i~~lDfGi~g~l~~  317 (517)
T COG0661         284 DGFFHADPHPGNILVRSD----------------------GRIVLLDFGIVGRLDP  317 (517)
T ss_pred             cCccccCCCccceEEecC----------------------CcEEEEcCcceecCCH
Confidence            358899999999999985                      7899999987775444


No 107
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=95.57  E-value=0.0086  Score=43.95  Aligned_cols=17  Identities=41%  Similarity=0.575  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+.+.
T Consensus       124 ~i~H~dlkp~nil~~~~  140 (263)
T cd05052         124 NFIHRDLAARNCLVGEN  140 (263)
T ss_pred             CEeecccCcceEEEcCC
Confidence            47999999999999764


No 108
>TIGR02457 TreS_Cterm trehalose synthase-fused probable maltokinase. Three pathways for the biosynthesis of trehalose, an osmoprotectant that in some species is also a precursor of certain cell wall glycolipids. Trehalose synthase, TreS, can interconvert maltose and trehalose, but while the equilibrium may favor trehalose, physiological concentrations of trehalose may be much greater than that of maltose and TreS may act largely in its degradation. This model describes a domain found only as a C-terminal fusion to TreS proteins. The most closely related proteins outside this family, Pep2 of Streptomyces coelicolor and Mak1 of Actinoplanes missouriensis, have known maltokinase activity. We suggest this domain acts as a maltokinase and helps drive conversion of trehalose to maltose.
Probab=95.57  E-value=0.008  Score=51.33  Aligned_cols=45  Identities=27%  Similarity=0.230  Sum_probs=30.9

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC---------CchhhhHHHHHHHh
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY---------NYRAFDIANHFVES   76 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~---------n~r~fDlanhf~E~   76 (107)
                      ..+=||+|+|.||+|+..                       +..+|||||==-.         ..+.=|+|--+..+
T Consensus       378 ~k~RiHGD~HLgqvL~t~-----------------------~d~~IiDFEGEP~Rpl~ERR~k~sPLRDVAGMLRSf  431 (528)
T TIGR02457       378 LKIRIHGDFHLGQVLVVQ-----------------------DDAVLIDFEGEPARPLAERRAKRSPLRDVAGMLRSF  431 (528)
T ss_pred             ceEeEecCcchhcEEEeC-----------------------CCeEEEcCCCCCCCChHHhccCCChHHHHHHHHHHH
Confidence            345599999999999987                       5678999984221         22345666555544


No 109
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=95.57  E-value=0.0069  Score=46.75  Aligned_cols=29  Identities=21%  Similarity=0.445  Sum_probs=24.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.++|+||..|.
T Consensus       115 ~ivHrDikp~NIll~~~----------------------~~~kL~DfG~~~  143 (328)
T cd05593         115 KIVYRDLKLENLMLDKD----------------------GHIKITDFGLCK  143 (328)
T ss_pred             CeEecccCHHHeEECCC----------------------CcEEEecCcCCc
Confidence            47999999999999874                      678888887654


No 110
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=95.55  E-value=0.0081  Score=45.65  Aligned_cols=29  Identities=24%  Similarity=0.472  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+..+                      +.+.|+||..+.
T Consensus       129 ~iiH~dlkp~Nill~~~----------------------~~~kl~DfG~a~  157 (316)
T cd05108         129 RLVHRDLAARNVLVKTP----------------------QHVKITDFGLAK  157 (316)
T ss_pred             CeeccccchhheEecCC----------------------CcEEEccccccc
Confidence            37999999999999774                      557777776654


No 111
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=95.55  E-value=0.0061  Score=46.78  Aligned_cols=29  Identities=28%  Similarity=0.431  Sum_probs=24.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       121 ~ivH~dlkp~Nil~~~~----------------------~~~kL~Dfg~a~  149 (333)
T cd05600         121 GYIHRDLKPENFLIDAS----------------------GHIKLTDFGLSK  149 (333)
T ss_pred             CccccCCCHHHEEECCC----------------------CCEEEEeCcCCc
Confidence            37899999999999764                      679999998665


No 112
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=95.54  E-value=0.0046  Score=46.39  Aligned_cols=17  Identities=35%  Similarity=0.559  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+|.|||+..+
T Consensus       123 ~ivH~dlkp~Nil~~~~  139 (288)
T cd07871         123 KILHRDLKPQNLLINEK  139 (288)
T ss_pred             CcccCCCCHHHEEECCC
Confidence            47899999999999774


No 113
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=95.54  E-value=0.008  Score=45.26  Aligned_cols=29  Identities=24%  Similarity=0.410  Sum_probs=24.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..+.
T Consensus       121 ~i~H~dlkp~NIli~~~----------------------~~~kl~Dfg~~~  149 (291)
T cd05612         121 EIVYRDLKPENILLDKE----------------------GHIKLTDFGFAK  149 (291)
T ss_pred             CeeecCCCHHHeEECCC----------------------CCEEEEecCcch
Confidence            47899999999999764                      678999997654


No 114
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=95.53  E-value=0.0081  Score=43.07  Aligned_cols=18  Identities=39%  Similarity=0.517  Sum_probs=15.7

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+|+++.||++...
T Consensus       124 ~~i~H~di~p~nili~~~  141 (262)
T cd00192         124 KKFVHRDLAARNCLVGED  141 (262)
T ss_pred             CCcccCccCcceEEECCC
Confidence            357999999999999885


No 115
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=95.53  E-value=0.006  Score=46.90  Aligned_cols=29  Identities=17%  Similarity=0.419  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+..+                      +.++|+||..|.
T Consensus       115 ~ivH~Dlkp~NIll~~~----------------------~~~kL~Dfg~~~  143 (323)
T cd05595         115 DVVYRDIKLENLMLDKD----------------------GHIKITDFGLCK  143 (323)
T ss_pred             CeEecCCCHHHEEEcCC----------------------CCEEecccHHhc
Confidence            48999999999999874                      567788886543


No 116
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=95.53  E-value=0.0064  Score=45.15  Aligned_cols=28  Identities=32%  Similarity=0.450  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+||++.|||+..+                      +.+.|+||..|
T Consensus       130 ~iiH~dlkp~Nil~~~~----------------------~~~kl~Dfg~~  157 (290)
T cd07862         130 RVVHRDLKPQNILVTSS----------------------GQIKLADFGLA  157 (290)
T ss_pred             CeeeCCCCHHHEEEcCC----------------------CCEEEccccce
Confidence            47999999999999874                      66888888654


No 117
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=95.52  E-value=0.0068  Score=47.08  Aligned_cols=17  Identities=24%  Similarity=0.538  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       188 ~ivHrDlkp~NIll~~~  204 (353)
T PLN00034        188 HIVHRDIKPSNLLINSA  204 (353)
T ss_pred             CEeecCCCHHHEEEcCC
Confidence            47999999999999874


No 118
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=95.51  E-value=0.0087  Score=42.46  Aligned_cols=32  Identities=25%  Similarity=0.378  Sum_probs=25.5

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      ..++|+|+++.||++.++                      +.+.|+||..+...
T Consensus       117 ~~i~h~dl~p~ni~i~~~----------------------~~~~l~d~~~~~~~  148 (253)
T cd05122         117 NGIIHRDIKAANILLTSD----------------------GEVKLIDFGLSAQL  148 (253)
T ss_pred             CCEecCCCCHHHEEEccC----------------------CeEEEeeccccccc
Confidence            347999999999999874                      67888888766543


No 119
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=95.51  E-value=0.0081  Score=47.06  Aligned_cols=29  Identities=28%  Similarity=0.470  Sum_probs=25.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+...                      +.+.++||..|.
T Consensus       121 givHrDlkp~NIll~~~----------------------~~~kl~DfGla~  149 (377)
T cd05629         121 GFIHRDIKPDNILIDRG----------------------GHIKLSDFGLST  149 (377)
T ss_pred             CeeccCCCHHHEEECCC----------------------CCEEEeeccccc
Confidence            48999999999999764                      679999998774


No 120
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=95.49  E-value=0.0069  Score=45.04  Aligned_cols=29  Identities=28%  Similarity=0.406  Sum_probs=23.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+.++                      +.+.++||..+.
T Consensus       152 ~ivH~dlkp~Nil~~~~----------------------~~~kL~Dfg~~~  180 (293)
T cd05053         152 KCIHRDLAARNVLVTED----------------------HVMKIADFGLAR  180 (293)
T ss_pred             CccccccceeeEEEcCC----------------------CeEEeCcccccc
Confidence            47999999999999874                      667888887653


No 121
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=95.48  E-value=0.0054  Score=46.33  Aligned_cols=29  Identities=28%  Similarity=0.573  Sum_probs=23.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.++||..+.
T Consensus       135 ~i~H~dL~p~Nili~~~----------------------~~~~l~Dfg~~~  163 (297)
T cd06656         135 QVIHRDIKSDNILLGMD----------------------GSVKLTDFGFCA  163 (297)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEECcCccce
Confidence            47999999999999764                      668888887553


No 122
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=95.47  E-value=0.0079  Score=46.80  Aligned_cols=29  Identities=28%  Similarity=0.523  Sum_probs=24.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       146 ~ivH~Dlkp~NIll~~~----------------------~~~kL~DfG~a~  174 (364)
T cd07875         146 GIIHRDLKPSNIVVKSD----------------------CTLKILDFGLAR  174 (364)
T ss_pred             CeecCCCCHHHEEECCC----------------------CcEEEEeCCCcc
Confidence            57999999999999874                      678899987664


No 123
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=95.46  E-value=0.0084  Score=45.87  Aligned_cols=29  Identities=28%  Similarity=0.360  Sum_probs=24.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..|.
T Consensus       116 ~ivHrDikp~Nill~~~----------------------~~~kL~Dfg~~~  144 (321)
T cd05591         116 GVIYRDLKLDNILLDAE----------------------GHCKLADFGMCK  144 (321)
T ss_pred             CeeccCCCHHHeEECCC----------------------CCEEEeecccce
Confidence            47999999999999774                      678999997553


No 124
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=95.46  E-value=0.0083  Score=46.05  Aligned_cols=29  Identities=24%  Similarity=0.364  Sum_probs=23.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..+.
T Consensus       116 ~ivH~dlkp~NIli~~~----------------------~~~kL~DfG~~~  144 (320)
T cd05590         116 GIIYRDLKLDNVLLDHE----------------------GHCKLADFGMCK  144 (320)
T ss_pred             CeEeCCCCHHHeEECCC----------------------CcEEEeeCCCCe
Confidence            47999999999999874                      678888987544


No 125
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=95.46  E-value=0.0093  Score=45.93  Aligned_cols=28  Identities=29%  Similarity=0.573  Sum_probs=23.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|
T Consensus       122 ~iiHrDlkp~Nili~~~----------------------~~~kL~DfG~a  149 (332)
T cd05623         122 HYVHRDIKPDNILMDMN----------------------GHIRLADFGSC  149 (332)
T ss_pred             CeEecCCCHHHEEECCC----------------------CCEEEeecchh
Confidence            47899999999999764                      67889999765


No 126
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=95.45  E-value=0.0082  Score=46.23  Aligned_cols=28  Identities=21%  Similarity=0.406  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|
T Consensus       116 ~ivHrDlkp~Nili~~~----------------------~~~kl~Dfg~~  143 (327)
T cd05617         116 GIIYRDLKLDNVLLDAD----------------------GHIKLTDYGMC  143 (327)
T ss_pred             CeeccCCCHHHEEEeCC----------------------CCEEEeccccc
Confidence            47999999999999874                      66888888655


No 127
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=95.44  E-value=0.0084  Score=43.82  Aligned_cols=29  Identities=28%  Similarity=0.515  Sum_probs=23.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|+++.|||+.++                      +.+.++||..+.
T Consensus       122 ~i~H~di~p~Nili~~~----------------------~~~~l~dfg~~~  150 (260)
T cd05070         122 NYIHRDLRSANILVGDG----------------------LVCKIADFGLAR  150 (260)
T ss_pred             CcccCCCccceEEEeCC----------------------ceEEeCCceeee
Confidence            47999999999999874                      567788887764


No 128
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=95.43  E-value=0.0072  Score=46.32  Aligned_cols=29  Identities=21%  Similarity=0.418  Sum_probs=23.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..+.
T Consensus       116 ~ivHrDlkp~Nil~~~~----------------------~~~kl~Dfg~~~  144 (316)
T cd05620         116 GIIYRDLKLDNVMLDRD----------------------GHIKIADFGMCK  144 (316)
T ss_pred             CeEecCCCHHHeEECCC----------------------CCEEeCccCCCe
Confidence            58999999999999874                      568888887553


No 129
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=95.43  E-value=0.0067  Score=44.14  Aligned_cols=31  Identities=23%  Similarity=0.336  Sum_probs=26.0

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      +..++|+||+++||++..+                      +.+.|+||..+.
T Consensus       119 ~~~i~H~dl~~~ni~~~~~----------------------~~~~l~d~g~~~  149 (265)
T cd06605         119 KHKIIHRDVKPSNILVNSR----------------------GQIKLCDFGVSG  149 (265)
T ss_pred             CCCeecCCCCHHHEEECCC----------------------CCEEEeecccch
Confidence            3578999999999999874                      679999997653


No 130
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=95.43  E-value=0.0074  Score=46.70  Aligned_cols=29  Identities=28%  Similarity=0.523  Sum_probs=23.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||+++|||+..+                      +.+.|+||..|.
T Consensus       139 givHrDikp~Nill~~~----------------------~~~kl~Dfg~~~  167 (355)
T cd07874         139 GIIHRDLKPSNIVVKSD----------------------CTLKILDFGLAR  167 (355)
T ss_pred             CcccCCCChHHEEECCC----------------------CCEEEeeCcccc
Confidence            47899999999999874                      568888887654


No 131
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=95.42  E-value=0.0081  Score=46.94  Aligned_cols=29  Identities=21%  Similarity=0.348  Sum_probs=24.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       151 ~ivHrDLkp~NILl~~~----------------------~~ikL~DFG~a~  179 (340)
T PTZ00426        151 NIVYRDLKPENLLLDKD----------------------GFIKMTDFGFAK  179 (340)
T ss_pred             CeEccCCCHHHEEECCC----------------------CCEEEecCCCCe
Confidence            47999999999999764                      678899998764


No 132
>PRK10345 hypothetical protein; Provisional
Probab=95.42  E-value=0.013  Score=44.11  Aligned_cols=32  Identities=25%  Similarity=0.174  Sum_probs=23.0

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ++|+||+|.|||+.....+                  ...++|||+=-+.
T Consensus       126 IvhrDlKp~NILl~~~~~~------------------~~~~~LiDg~G~~  157 (210)
T PRK10345        126 IVTMELKPQNILCQRISES------------------EVIPVVCDNIGES  157 (210)
T ss_pred             EeecCCCHHHEEEeccCCC------------------CCcEEEEECCCCc
Confidence            6799999999999753111                  1579999964443


No 133
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=95.41  E-value=0.0085  Score=46.69  Aligned_cols=50  Identities=20%  Similarity=0.294  Sum_probs=34.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC------CchhhhHHHHHHH
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY------NYRAFDIANHFVE   75 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~------n~r~fDlanhf~E   75 (107)
                      .+.|+||.++|||+..++..+               .....+.|||||=+..      ..+.-||+-....
T Consensus       158 Gi~HgDL~~~NiLl~~~~~~~---------------~~~~~~~LIDl~r~~~~~~~~~~~r~~dL~~L~~s  213 (268)
T PRK15123        158 GINHRDCYICHFLLHLPFPGR---------------EEDLKLSVIDLHRAQIRARVPRRWRDKDLAGLYFS  213 (268)
T ss_pred             cCccCCCChhhEEEeccccCC---------------CCCceEEEEECCcccccCCCChHHHHHHHHHHHHH
Confidence            479999999999998621000               0115799999997732      3556788876544


No 134
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=95.41  E-value=0.0087  Score=46.97  Aligned_cols=29  Identities=31%  Similarity=0.615  Sum_probs=25.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       121 ~ivHrDlKp~NILl~~~----------------------g~~kL~DFGla~  149 (382)
T cd05625         121 GFIHRDIKPDNILIDRD----------------------GHIKLTDFGLCT  149 (382)
T ss_pred             CeecCCCCHHHEEECCC----------------------CCEEEeECCCCc
Confidence            47999999999999774                      679999998764


No 135
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=95.39  E-value=0.009  Score=43.21  Aligned_cols=17  Identities=35%  Similarity=0.423  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++..+
T Consensus       113 ~~~H~dl~p~nili~~~  129 (250)
T cd05085         113 NCIHRDLAARNCLVGEN  129 (250)
T ss_pred             CeeecccChheEEEcCC
Confidence            47999999999999764


No 136
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=95.39  E-value=0.0081  Score=44.44  Aligned_cols=29  Identities=21%  Similarity=0.400  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|++|.|||+.+.                      ..+.|+||..+.
T Consensus       144 gi~H~dlkp~Nil~~~~----------------------~~~kl~Dfg~~~  172 (283)
T cd05091         144 HVVHKDLATRNVLVFDK----------------------LNVKISDLGLFR  172 (283)
T ss_pred             CccccccchhheEecCC----------------------CceEeccccccc
Confidence            36899999999999874                      567888887543


No 137
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=95.38  E-value=0.0084  Score=45.94  Aligned_cols=29  Identities=24%  Similarity=0.441  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       116 ~ivH~dlkp~Nill~~~----------------------~~~kL~Dfg~a~  144 (316)
T cd05592         116 GIIYRDLKLDNVLLDKD----------------------GHIKIADFGMCK  144 (316)
T ss_pred             CEEeCCCCHHHeEECCC----------------------CCEEEccCcCCe
Confidence            47999999999999774                      668888887654


No 138
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=95.38  E-value=0.0091  Score=46.27  Aligned_cols=29  Identities=24%  Similarity=0.565  Sum_probs=24.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+...                      +.+.|+||..+.
T Consensus       121 ~ivH~Dlkp~NIl~~~~----------------------~~~kl~Dfg~~~  149 (364)
T cd05599         121 GYIHRDIKPDNLLLDAK----------------------GHIKLSDFGLCT  149 (364)
T ss_pred             CeEeccCCHHHeEECCC----------------------CCEEEeecccce
Confidence            47899999999999874                      679999998774


No 139
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=95.37  E-value=0.0099  Score=45.69  Aligned_cols=17  Identities=29%  Similarity=0.475  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       138 ~ivHrdikp~Nil~~~~  154 (343)
T cd07878         138 GIIHRDLKPSNVAVNED  154 (343)
T ss_pred             CeecccCChhhEEECCC
Confidence            47999999999999874


No 140
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=95.36  E-value=0.012  Score=43.56  Aligned_cols=29  Identities=24%  Similarity=0.384  Sum_probs=23.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+..+                      +.+.++||..+.
T Consensus       127 ~i~H~dlkp~Nili~~~----------------------~~~~l~dfg~~~  155 (283)
T cd05080         127 HYIHRDLAARNVLLDND----------------------RLVKIGDFGLAK  155 (283)
T ss_pred             CeeccccChheEEEcCC----------------------CcEEEeeccccc
Confidence            47999999999999764                      567778887654


No 141
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=95.34  E-value=0.0073  Score=46.91  Aligned_cols=29  Identities=28%  Similarity=0.523  Sum_probs=23.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       143 ~ivHrDlkp~NIl~~~~----------------------~~~kl~Dfg~a~  171 (359)
T cd07876         143 GIIHRDLKPSNIVVKSD----------------------CTLKILDFGLAR  171 (359)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEEecCCCcc
Confidence            47899999999999874                      668888887653


No 142
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=95.34  E-value=0.011  Score=44.62  Aligned_cols=16  Identities=38%  Similarity=0.414  Sum_probs=14.2

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||++.|||+..
T Consensus       128 ~ivHrDlkp~Nil~~~  143 (317)
T cd07868         128 WVLHRDLKPANILVMG  143 (317)
T ss_pred             CEEcCCCCHHHEEEec
Confidence            4899999999999965


No 143
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=95.34  E-value=0.011  Score=43.42  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||+++||++..+
T Consensus       120 ~i~H~dl~p~nili~~~  136 (256)
T cd05113         120 QFIHRDLAARNCLVDDQ  136 (256)
T ss_pred             CeeccccCcceEEEcCC
Confidence            47999999999999764


No 144
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=95.34  E-value=0.011  Score=44.38  Aligned_cols=17  Identities=29%  Similarity=0.428  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       122 ~iiH~dikp~Nill~~~  138 (285)
T cd05631         122 RIVYRDLKPENILLDDR  138 (285)
T ss_pred             CEEeCCCCHHHEEECCC
Confidence            47999999999999764


No 145
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=95.34  E-value=0.0092  Score=43.88  Aligned_cols=17  Identities=35%  Similarity=0.587  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       126 ~i~h~dlkp~nili~~~  142 (267)
T cd05066         126 GYVHRDLAARNILVNSN  142 (267)
T ss_pred             CEeehhhchhcEEECCC
Confidence            47899999999999764


No 146
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=95.34  E-value=0.0094  Score=43.93  Aligned_cols=17  Identities=41%  Similarity=0.722  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++.+.
T Consensus       122 ~i~H~dl~p~Nill~~~  138 (262)
T cd05071         122 NYVHRDLRAANILVGEN  138 (262)
T ss_pred             CccccccCcccEEEcCC
Confidence            46899999999999874


No 147
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=95.32  E-value=0.014  Score=44.68  Aligned_cols=17  Identities=41%  Similarity=0.552  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       194 ~ivHrDiKp~Nil~~~~  210 (338)
T cd05102         194 KCIHRDLAARNILLSEN  210 (338)
T ss_pred             CEECCCCccceEEEcCC
Confidence            48999999999999764


No 148
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=95.30  E-value=0.01  Score=45.79  Aligned_cols=29  Identities=21%  Similarity=0.392  Sum_probs=23.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|.
T Consensus       116 ~ivH~Dikp~Nili~~~----------------------~~~kL~DfG~~~  144 (329)
T cd05618         116 GIIYRDLKLDNVLLDSE----------------------GHIKLTDYGMCK  144 (329)
T ss_pred             CeeeCCCCHHHEEECCC----------------------CCEEEeeCCccc
Confidence            47899999999999874                      678888987653


No 149
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=95.29  E-value=0.0083  Score=45.52  Aligned_cols=17  Identities=35%  Similarity=0.493  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+..+
T Consensus       123 ~ivH~dlkp~NIll~~~  139 (338)
T cd07859         123 NVFHRDLKPKNILANAD  139 (338)
T ss_pred             CeecCCCCHHHeEECCC
Confidence            47999999999999774


No 150
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=95.29  E-value=0.0088  Score=43.80  Aligned_cols=17  Identities=35%  Similarity=0.618  Sum_probs=14.7

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       132 ~i~H~dlkp~Nil~~~~  148 (272)
T cd05075         132 SFIHRDLAARNCMLNEN  148 (272)
T ss_pred             CeeccccchhheEEcCC
Confidence            37899999999999764


No 151
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.29  E-value=0.013  Score=45.39  Aligned_cols=29  Identities=24%  Similarity=0.411  Sum_probs=23.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..+.
T Consensus       124 ~ivH~dlkp~Nili~~~----------------------~~~kL~Dfg~~~  152 (333)
T cd06650         124 KIMHRDVKPSNILVNSR----------------------GEIKLCDFGVSG  152 (333)
T ss_pred             CEEecCCChhhEEEcCC----------------------CCEEEeeCCcch
Confidence            47899999999999764                      568888987653


No 152
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.28  E-value=0.012  Score=45.29  Aligned_cols=29  Identities=24%  Similarity=0.410  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+...                      +.+.|+||..+.
T Consensus       124 ~ivH~dlkp~Nil~~~~----------------------~~~kl~Dfg~~~  152 (331)
T cd06649         124 QIMHRDVKPSNILVNSR----------------------GEIKLCDFGVSG  152 (331)
T ss_pred             CEEcCCCChhhEEEcCC----------------------CcEEEccCcccc
Confidence            47999999999999874                      568888887653


No 153
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=95.28  E-value=0.0078  Score=45.23  Aligned_cols=17  Identities=35%  Similarity=0.536  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++|||+..+
T Consensus       124 ~i~H~dlkp~Nil~~~~  140 (301)
T cd07873         124 KVLHRDLKPQNLLINER  140 (301)
T ss_pred             CeeCCCCCHHHEEECCC
Confidence            47999999999999874


No 154
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=95.27  E-value=0.011  Score=43.38  Aligned_cols=30  Identities=27%  Similarity=0.448  Sum_probs=24.5

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+|+++.||++..+                      +.+.++||..+.
T Consensus       133 ~~i~H~dl~~~nil~~~~----------------------~~~~l~dfg~~~  162 (269)
T cd08528         133 KRIVHRDLTPNNIMLGED----------------------DKVTITDFGLAK  162 (269)
T ss_pred             CceeecCCCHHHEEECCC----------------------CcEEEeccccee
Confidence            357999999999999774                      668888888664


No 155
>PHA03212 serine/threonine kinase US3; Provisional
Probab=95.27  E-value=0.011  Score=47.44  Aligned_cols=28  Identities=25%  Similarity=0.393  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -+.|+||+|.|||+...                      +.+.|+||..|
T Consensus       202 ~IvHrDiKP~NIll~~~----------------------~~vkL~DFG~a  229 (391)
T PHA03212        202 RIIHRDIKAENIFINHP----------------------GDVCLGDFGAA  229 (391)
T ss_pred             CcccCCCChHhEEEcCC----------------------CCEEEEeCCcc
Confidence            47899999999999874                      66889998765


No 156
>KOG0583|consensus
Probab=95.27  E-value=0.0063  Score=49.35  Aligned_cols=45  Identities=24%  Similarity=0.301  Sum_probs=33.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      .++|+||+++|||+....                     ..+.|+||..+....+.-++-..+|-.
T Consensus       140 gi~HRDLK~ENilld~~~---------------------~~~Kl~DFG~s~~~~~~~~~l~t~cGs  184 (370)
T KOG0583|consen  140 GIVHRDLKPENILLDGNE---------------------GNLKLSDFGLSAISPGEDGLLKTFCGS  184 (370)
T ss_pred             CEeeCCCCHHHEEecCCC---------------------CCEEEeccccccccCCCCCcccCCCCC
Confidence            579999999999998831                     569999999998765444454445443


No 157
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=95.27  E-value=0.011  Score=46.62  Aligned_cols=28  Identities=36%  Similarity=0.617  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+..+                      +.+.|+||-.|
T Consensus       162 ~ivHrDLkp~NIll~~~----------------------~~ikL~DfG~a  189 (371)
T cd05622         162 GFIHRDVKPDNMLLDKS----------------------GHLKLADFGTC  189 (371)
T ss_pred             CEEeCCCCHHHEEECCC----------------------CCEEEEeCCce
Confidence            58999999999999764                      67889998755


No 158
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=95.25  E-value=0.011  Score=45.09  Aligned_cols=29  Identities=28%  Similarity=0.351  Sum_probs=24.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..+.
T Consensus       118 ~i~H~dlkp~Nil~~~~----------------------~~~kL~Dfg~~~  146 (318)
T cd05582         118 GIIYRDLKPENILLDEE----------------------GHIKLTDFGLSK  146 (318)
T ss_pred             CEecCCCCHHHeEECCC----------------------CcEEEeeccCCc
Confidence            47999999999999874                      679999997664


No 159
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=95.23  E-value=0.011  Score=43.31  Aligned_cols=17  Identities=29%  Similarity=0.372  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+.|+||++.|||+..+
T Consensus       120 ~ivH~dlkp~Nill~~~  136 (269)
T cd05042         120 DFIHSDLALRNCQLTAD  136 (269)
T ss_pred             CEecccccHhheEecCC
Confidence            46899999999999874


No 160
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=95.22  E-value=0.013  Score=42.58  Aligned_cols=28  Identities=25%  Similarity=0.362  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -+.|+||++.||++...                      +.+.|+||..+
T Consensus       124 ~i~H~dl~p~nilv~~~----------------------~~~~l~dfg~~  151 (263)
T cd06625         124 MIVHRDIKGANILRDSA----------------------GNVKLGDFGAS  151 (263)
T ss_pred             CeecCCCCHHHEEEcCC----------------------CCEEEeecccc
Confidence            46899999999999764                      56888888765


No 161
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=95.22  E-value=0.011  Score=42.32  Aligned_cols=30  Identities=20%  Similarity=0.249  Sum_probs=24.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||.+.||++.++                      +.++++||..+..
T Consensus       123 ~~~H~dl~~~nil~~~~----------------------~~~~l~d~~~~~~  152 (258)
T cd08215         123 KILHRDIKPQNIFLTSN----------------------GLVKLGDFGISKV  152 (258)
T ss_pred             CEecccCChHHeEEcCC----------------------CcEEECCccceee
Confidence            68999999999999874                      6688888876543


No 162
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=95.22  E-value=0.011  Score=43.93  Aligned_cols=28  Identities=25%  Similarity=0.337  Sum_probs=23.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+||++.|||+..+                      +.+.|+||..+
T Consensus       125 ~i~H~dl~p~nil~~~~----------------------~~~kl~dfg~~  152 (290)
T cd05613         125 GIIYRDIKLENILLDSN----------------------GHVVLTDFGLS  152 (290)
T ss_pred             CeeccCCCHHHeEECCC----------------------CCEEEeeCccc
Confidence            47999999999999874                      56888888654


No 163
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=95.22  E-value=0.012  Score=43.50  Aligned_cols=30  Identities=20%  Similarity=0.321  Sum_probs=24.5

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+||++.||++...                      +.+.++||..+.
T Consensus       122 ~~i~H~dl~p~nil~~~~----------------------~~~~l~dfg~~~  151 (286)
T cd06622         122 HNIIHRDVKPTNVLVNGN----------------------GQVKLCDFGVSG  151 (286)
T ss_pred             CCEeeCCCCHHHEEECCC----------------------CCEEEeecCCcc
Confidence            358999999999999874                      668888887653


No 164
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=95.18  E-value=0.015  Score=42.42  Aligned_cols=29  Identities=28%  Similarity=0.436  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.|+||..+.
T Consensus       115 ~i~H~di~p~nili~~~----------------------~~~kl~df~~~~  143 (257)
T cd05060         115 HFVHRDLAARNVLLVNR----------------------HQAKISDFGMSR  143 (257)
T ss_pred             CeeccCcccceEEEcCC----------------------CcEEeccccccc
Confidence            47999999999999774                      567788886553


No 165
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=95.17  E-value=0.011  Score=42.36  Aligned_cols=29  Identities=24%  Similarity=0.353  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+|++++||++..+                      +.+.++||.++.
T Consensus       119 ~i~H~dl~p~ni~i~~~----------------------~~~~l~d~~~~~  147 (254)
T cd06627         119 GVIHRDIKAANILTTKD----------------------GVVKLADFGVAT  147 (254)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEEeccccce
Confidence            46899999999999874                      668888887655


No 166
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.16  E-value=0.014  Score=44.30  Aligned_cols=29  Identities=28%  Similarity=0.395  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.++||..+.
T Consensus       154 gi~H~dlkp~Nill~~~----------------------~~~kL~Dfg~~~  182 (314)
T cd05099         154 RCIHRDLAARNVLVTED----------------------NVMKIADFGLAR  182 (314)
T ss_pred             CeeeccccceeEEEcCC----------------------CcEEEccccccc
Confidence            57999999999999764                      567788877663


No 167
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=95.14  E-value=0.011  Score=45.66  Aligned_cols=29  Identities=21%  Similarity=0.390  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..|.
T Consensus       116 ~ivH~dlkp~Nili~~~----------------------~~~kL~Dfg~~~  144 (329)
T cd05588         116 GIIYRDLKLDNVLLDAE----------------------GHIKLTDYGMCK  144 (329)
T ss_pred             CeEecCCCHHHeEECCC----------------------CCEEECcCcccc
Confidence            48999999999999774                      568888887553


No 168
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=95.11  E-value=0.01  Score=44.69  Aligned_cols=17  Identities=41%  Similarity=0.595  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+...
T Consensus       158 ~ivH~dlkp~Nill~~~  174 (304)
T cd05096         158 NFVHRDLATRNCLVGEN  174 (304)
T ss_pred             CccccCcchhheEEcCC
Confidence            37899999999999874


No 169
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=95.10  E-value=0.018  Score=42.96  Aligned_cols=28  Identities=14%  Similarity=0.250  Sum_probs=22.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .+.|+||++.|||+...                      +.+.|+||..+
T Consensus       115 ~ivH~dikp~Nili~~~----------------------~~~~l~Dfg~~  142 (277)
T cd05607         115 DIVYRDMKPENVLLDDQ----------------------GNCRLSDLGLA  142 (277)
T ss_pred             CEEEccCChHhEEEcCC----------------------CCEEEeeceee
Confidence            47899999999999874                      56788888754


No 170
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=95.10  E-value=0.0082  Score=46.04  Aligned_cols=17  Identities=35%  Similarity=0.628  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++|||+...
T Consensus       125 givH~dlkp~Nili~~~  141 (332)
T cd07857         125 NVLHRDLKPGNLLVNAD  141 (332)
T ss_pred             CcccCCCCHHHeEEcCC
Confidence            47899999999999774


No 171
>PHA03209 serine/threonine kinase US3; Provisional
Probab=95.09  E-value=0.012  Score=45.96  Aligned_cols=29  Identities=17%  Similarity=0.302  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+...                      +.+.|+||..+.
T Consensus       177 ~ivHrDlkp~Nill~~~----------------------~~~kl~DfG~a~  205 (357)
T PHA03209        177 RIIHRDVKTENIFINDV----------------------DQVCIGDLGAAQ  205 (357)
T ss_pred             CeecCCCCHHHEEECCC----------------------CCEEEecCcccc
Confidence            47899999999999874                      567888887664


No 172
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=95.09  E-value=0.014  Score=42.42  Aligned_cols=29  Identities=21%  Similarity=0.320  Sum_probs=24.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+.++                      +.+.++||..+.
T Consensus       120 ~i~H~dl~p~nili~~~----------------------~~~~l~dfg~~~  148 (255)
T cd08219         120 RVLHRDIKSKNIFLTQN----------------------GKVKLGDFGSAR  148 (255)
T ss_pred             CcccCCCCcceEEECCC----------------------CcEEEcccCcce
Confidence            57999999999999774                      668888887654


No 173
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=95.09  E-value=0.012  Score=42.72  Aligned_cols=17  Identities=41%  Similarity=0.616  Sum_probs=15.2

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.||++...
T Consensus       117 ~i~H~di~p~nil~~~~  133 (257)
T cd05040         117 RFIHRDLAARNILLASD  133 (257)
T ss_pred             CccccccCcccEEEecC
Confidence            57999999999999874


No 174
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=95.08  E-value=0.011  Score=43.74  Aligned_cols=28  Identities=25%  Similarity=0.393  Sum_probs=22.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||+++||++...                      +.+.++||..+
T Consensus       144 ~i~H~dlkp~nili~~~----------------------~~~kl~dfg~~  171 (286)
T cd06638         144 KTIHRDVKGNNILLTTE----------------------GGVKLVDFGVS  171 (286)
T ss_pred             CccccCCCHHhEEECCC----------------------CCEEEccCCce
Confidence            47999999999999874                      55778888754


No 175
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=95.08  E-value=0.014  Score=42.91  Aligned_cols=17  Identities=29%  Similarity=0.505  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++...
T Consensus       119 ~i~H~dl~p~ni~~~~~  135 (286)
T cd07832         119 GIMHRDLKPANLLISAD  135 (286)
T ss_pred             CeecCCcCHHHEEEcCC
Confidence            47999999999999874


No 176
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=95.08  E-value=0.013  Score=46.20  Aligned_cols=28  Identities=36%  Similarity=0.617  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+...                      +.+.|+||..|
T Consensus       162 ~ivHrDLkp~NILl~~~----------------------~~~kL~DfG~~  189 (370)
T cd05596         162 GFIHRDVKPDNMLLDKS----------------------GHLKLADFGTC  189 (370)
T ss_pred             CeeccCCCHHHEEEcCC----------------------CCEEEEeccce
Confidence            47899999999999874                      67889998765


No 177
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=95.07  E-value=0.011  Score=45.24  Aligned_cols=29  Identities=24%  Similarity=0.380  Sum_probs=24.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+..+                      +.++|+||..|.
T Consensus       121 ~ivHrdlkp~Nill~~~----------------------~~~kL~Dfg~~~  149 (324)
T cd05589         121 KIVYRDLKLDNLLLDTE----------------------GFVKIADFGLCK  149 (324)
T ss_pred             CeEecCCCHHHeEECCC----------------------CcEEeCcccCCc
Confidence            47899999999999874                      678888987654


No 178
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=95.05  E-value=0.011  Score=43.71  Aligned_cols=17  Identities=35%  Similarity=0.565  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       139 ~~vH~dlkp~Nil~~~~  155 (277)
T cd05062         139 KFVHRDLAARNCMVAED  155 (277)
T ss_pred             CcccCCcchheEEEcCC
Confidence            47999999999999874


No 179
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=95.05  E-value=0.013  Score=43.48  Aligned_cols=28  Identities=25%  Similarity=0.329  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.||++..+                      +.+.++||..+
T Consensus       125 ~~~H~dl~p~nil~~~~----------------------~~~~l~dfg~~  152 (288)
T cd05583         125 GIIYRDIKLENILLDSE----------------------GHVVLTDFGLS  152 (288)
T ss_pred             CeeccCCCHHHeEECCC----------------------CCEEEEECccc
Confidence            58999999999999764                      56888888654


No 180
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=95.04  E-value=0.012  Score=45.14  Aligned_cols=29  Identities=21%  Similarity=0.413  Sum_probs=23.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||+++|||+..+                      +.+.|+||..|.
T Consensus       121 ~ivHrDikp~Nill~~~----------------------~~ikL~Dfg~~~  149 (323)
T cd05615         121 GIIYRDLKLDNVMLDSE----------------------GHIKIADFGMCK  149 (323)
T ss_pred             CeeccCCCHHHeEECCC----------------------CCEEEecccccc
Confidence            47999999999999874                      568888886543


No 181
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=95.04  E-value=0.013  Score=44.20  Aligned_cols=29  Identities=24%  Similarity=0.390  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||+++||++...                      +.+.++||..+.
T Consensus       121 ~i~H~dl~p~NIll~~~----------------------~~~~l~dfg~~~  149 (305)
T cd05609         121 GIVHRDLKPDNLLITSM----------------------GHIKLTDFGLSK  149 (305)
T ss_pred             CccccCCchHHEEECCC----------------------CCEEEeeCCCcc
Confidence            47899999999999774                      568888887654


No 182
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=95.03  E-value=0.015  Score=42.59  Aligned_cols=30  Identities=27%  Similarity=0.369  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+|+++.|||+...                      +.+.++||..+..
T Consensus       129 ~i~H~dl~p~nil~~~~----------------------~~~~l~dfg~~~~  158 (284)
T cd05038         129 RYIHRDLAARNILVESE----------------------DLVKISDFGLAKV  158 (284)
T ss_pred             CeecCCCCHHhEEEcCC----------------------CCEEEcccccccc
Confidence            58999999999999874                      5677777765543


No 183
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=95.03  E-value=0.015  Score=42.10  Aligned_cols=17  Identities=24%  Similarity=0.331  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+..+
T Consensus       121 ~i~H~dlkp~Nill~~~  137 (259)
T cd05037         121 KLVHGNVCGKNILVARY  137 (259)
T ss_pred             CeecccCccceEEEecC
Confidence            47999999999999874


No 184
>KOG2345|consensus
Probab=95.02  E-value=0.017  Score=46.12  Aligned_cols=72  Identities=18%  Similarity=0.222  Sum_probs=43.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch---hhhHHHHHHHhhhc-cCCCC-C
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR---AFDIANHFVESVYD-YSYKH-F   85 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r---~fDlanhf~E~~~d-y~~~~-~   85 (107)
                      -+.|+|++|+|||+.++                      +..+++||-=+...+-   +=-=|-.+.||+-+ ++-+- .
T Consensus       149 ~yAH~DiKP~NILls~~----------------------~~~vl~D~GS~~~a~i~i~~~~~a~~lQe~a~e~Ct~pyRA  206 (302)
T KOG2345|consen  149 PYAHRDIKPANILLSDS----------------------GLPVLMDLGSATQAPIQIEGSRQALRLQEWAEERCTIPYRA  206 (302)
T ss_pred             cccccCCCcceeEecCC----------------------CceEEEeccCccccceEeechHHHHHHHHHHHHhCCCcccC
Confidence            48999999999999985                      6789999976654432   11124456677632 22111 2


Q ss_pred             C-ceeecCCCCCCHHHHhhccc
Q psy15665         86 P-HYTVKRENYPSYSLRNSSWV  106 (107)
Q Consensus        86 p-~~~~~~~~~Pt~~~~~~~~~  106 (107)
                      | .|  +-..+-|-.+|.-+|.
T Consensus       207 PELf--~vk~~~ti~ertDIWS  226 (302)
T KOG2345|consen  207 PELF--NVKSHCTITERTDIWS  226 (302)
T ss_pred             chhe--ecccCcccccccchhh
Confidence            2 23  3344556666666664


No 185
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=95.02  E-value=0.014  Score=43.34  Aligned_cols=17  Identities=29%  Similarity=0.579  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       129 gi~H~dlkp~Nil~~~~  145 (284)
T cd05079         129 QYVHRDLAARNVLVESE  145 (284)
T ss_pred             CeeecccchheEEEcCC
Confidence            47999999999999764


No 186
>PHA03207 serine/threonine kinase US3; Provisional
Probab=95.01  E-value=0.0096  Score=47.23  Aligned_cols=28  Identities=29%  Similarity=0.405  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+...                      +.++|+||..|
T Consensus       205 givHrDlkp~Nill~~~----------------------~~~~l~DfG~a  232 (392)
T PHA03207        205 GIIHRDVKTENIFLDEP----------------------ENAVLGDFGAA  232 (392)
T ss_pred             CccccCCCHHHEEEcCC----------------------CCEEEccCccc
Confidence            47999999999999874                      66888888754


No 187
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=95.01  E-value=0.014  Score=43.57  Aligned_cols=31  Identities=19%  Similarity=0.344  Sum_probs=25.2

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ..++|+||++.|||+...                      +.+.|+||..+..
T Consensus       120 ~~i~H~dl~p~nili~~~----------------------~~~kl~dfg~~~~  150 (290)
T cd05580         120 LDIVYRDLKPENLLLDSD----------------------GYIKITDFGFAKR  150 (290)
T ss_pred             CCEecCCCCHHHEEECCC----------------------CCEEEeeCCCccc
Confidence            347999999999999874                      6688888876653


No 188
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=94.99  E-value=0.013  Score=45.81  Aligned_cols=28  Identities=29%  Similarity=0.506  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+..+                      +.+.|+||..|
T Consensus       123 ~ivH~dlkp~Nili~~~----------------------~~~kL~Dfg~a  150 (372)
T cd07853         123 GILHRDIKPGNLLVNSN----------------------CVLKICDFGLA  150 (372)
T ss_pred             CeeCCCCChHHEEECCC----------------------CCEEeccccce
Confidence            47999999999999874                      56788888655


No 189
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=94.98  E-value=0.018  Score=41.70  Aligned_cols=29  Identities=31%  Similarity=0.346  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|+++.|||+..+                      +.+.|+||..+.
T Consensus       113 ~i~h~di~p~nili~~~----------------------~~~~l~d~g~~~  141 (251)
T cd05041         113 NCIHRDLAARNCLVGEN----------------------NVLKISDFGMSR  141 (251)
T ss_pred             CEehhhcCcceEEEcCC----------------------CcEEEeeccccc
Confidence            47899999999999764                      567788876543


No 190
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=94.98  E-value=0.014  Score=45.87  Aligned_cols=29  Identities=31%  Similarity=0.579  Sum_probs=24.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+...                      +.+.|+||..|.
T Consensus       121 givHrDlKp~Nili~~~----------------------~~~kL~DFGl~~  149 (381)
T cd05626         121 GFIHRDIKPDNILIDLD----------------------GHIKLTDFGLCT  149 (381)
T ss_pred             CeeecCCcHHHEEECCC----------------------CCEEEeeCcCCc
Confidence            47999999999999764                      679999998764


No 191
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=94.98  E-value=0.012  Score=43.97  Aligned_cols=28  Identities=18%  Similarity=0.286  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+...                      +.+.++||..+
T Consensus       117 ~i~H~dlkp~Nili~~~----------------------~~~~l~dfg~~  144 (280)
T cd05608         117 RIIYRDLKPENVLLDND----------------------GNVRISDLGLA  144 (280)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEEeeCccc
Confidence            47999999999999764                      56888888655


No 192
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=94.98  E-value=0.017  Score=42.78  Aligned_cols=18  Identities=28%  Similarity=0.495  Sum_probs=15.4

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+|+++.|||+...
T Consensus       128 ~~i~H~di~p~nil~~~~  145 (279)
T cd05057         128 KRLVHRDLAARNVLVKTP  145 (279)
T ss_pred             CCEEecccCcceEEEcCC
Confidence            357999999999999764


No 193
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=94.97  E-value=0.017  Score=42.29  Aligned_cols=29  Identities=28%  Similarity=0.358  Sum_probs=24.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++..+                      +.+.++||..+.
T Consensus       118 ~i~H~dl~p~nili~~~----------------------~~~~l~df~~~~  146 (283)
T cd05118         118 GILHRDLKPENLLINTE----------------------GVLKLADFGLAR  146 (283)
T ss_pred             CeeecCcCHHHEEECCC----------------------CcEEEeeeeeeE
Confidence            47999999999999874                      678899997653


No 194
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=94.96  E-value=0.01  Score=44.40  Aligned_cols=16  Identities=38%  Similarity=0.486  Sum_probs=14.3

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      ++|+|+++.|||+...
T Consensus       118 ivH~dikp~Nil~~~~  133 (279)
T cd05633         118 VVYRDLKPANILLDEH  133 (279)
T ss_pred             cCCCCCCHHHEEECCC
Confidence            7899999999999764


No 195
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=94.95  E-value=0.017  Score=43.44  Aligned_cols=16  Identities=38%  Similarity=0.414  Sum_probs=14.2

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||++.|||+..
T Consensus       128 ~ivH~Dlkp~Nil~~~  143 (317)
T cd07867         128 WVLHRDLKPANILVMG  143 (317)
T ss_pred             CEEcCCCCHHHEEEcc
Confidence            4899999999999964


No 196
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=94.94  E-value=0.012  Score=43.09  Aligned_cols=28  Identities=25%  Similarity=0.345  Sum_probs=22.5

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ++|+||++.|||+..+                      +.+.|+||.++.
T Consensus       127 i~H~dl~p~nil~~~~----------------------~~~~l~Dfg~~~  154 (265)
T cd06652         127 IVHRDIKGANILRDSV----------------------GNVKLGDFGASK  154 (265)
T ss_pred             EecCCCCHHHEEecCC----------------------CCEEECcCcccc
Confidence            7899999999999864                      567788886553


No 197
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=94.94  E-value=0.012  Score=44.77  Aligned_cols=17  Identities=35%  Similarity=0.550  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||+++|||+...
T Consensus       123 gi~H~dlkp~nili~~~  139 (330)
T cd07834         123 NVIHRDLKPSNILVNSN  139 (330)
T ss_pred             CeecCCCCHHHEEEcCC
Confidence            47999999999999874


No 198
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=94.93  E-value=0.015  Score=43.62  Aligned_cols=28  Identities=21%  Similarity=0.263  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+|+++.|||+...                      ..+.++||..+
T Consensus       122 ~iiH~dikp~Nili~~~----------------------~~~kl~Dfg~~  149 (285)
T cd05632         122 NTVYRDLKPENILLDDY----------------------GHIRISDLGLA  149 (285)
T ss_pred             CeeecCCCHHHEEECCC----------------------CCEEEecCCcc
Confidence            47899999999999764                      56788888766


No 199
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=94.93  E-value=0.017  Score=43.11  Aligned_cols=17  Identities=41%  Similarity=0.579  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+|.|||+.++
T Consensus       140 ~i~H~dlkp~Nili~~~  156 (288)
T cd05093         140 HFVHRDLATRNCLVGEN  156 (288)
T ss_pred             CeeecccCcceEEEccC
Confidence            47999999999999874


No 200
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=94.92  E-value=0.014  Score=42.39  Aligned_cols=28  Identities=32%  Similarity=0.511  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+|+++.||++..+                      +.+.++||..+
T Consensus       123 ~i~h~di~p~nili~~~----------------------~~~~l~d~g~~  150 (261)
T cd05034         123 NYIHRDLAARNILVGEN----------------------LVCKIADFGLA  150 (261)
T ss_pred             CcccCCcchheEEEcCC----------------------CCEEECccccc
Confidence            47899999999999875                      66888888654


No 201
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=94.92  E-value=0.013  Score=42.44  Aligned_cols=17  Identities=35%  Similarity=0.440  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.||++..+
T Consensus       120 ~i~h~dl~p~ni~i~~~  136 (256)
T cd05112         120 NVIHRDLAARNCLVGEN  136 (256)
T ss_pred             CccccccccceEEEcCC
Confidence            47999999999999764


No 202
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=94.91  E-value=0.02  Score=44.46  Aligned_cols=29  Identities=31%  Similarity=0.411  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+.+.                      +.+.|+||-.+.
T Consensus       193 ~ivHrDikp~Nill~~~----------------------~~vkL~DfG~a~  221 (337)
T cd05054         193 KCIHRDLAARNILLSEN----------------------NVVKICDFGLAR  221 (337)
T ss_pred             CeecCCCCcceEEEeCC----------------------CcEEEeccccch
Confidence            47999999999999874                      567888887553


No 203
>KOG4250|consensus
Probab=94.89  E-value=0.018  Score=50.79  Aligned_cols=18  Identities=33%  Similarity=0.571  Sum_probs=15.6

Q ss_pred             EEEecccCCCceeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESP   28 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~   28 (107)
                      .+||+||+||||++..+-
T Consensus       140 ~IvHRDlKP~NIvl~~Ge  157 (732)
T KOG4250|consen  140 GIVHRDLKPGNIVLQIGE  157 (732)
T ss_pred             CceeccCCCCcEEEeecC
Confidence            479999999999998753


No 204
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=94.89  E-value=0.015  Score=43.03  Aligned_cols=17  Identities=24%  Similarity=0.511  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       120 ~i~H~dlkp~Nill~~~  136 (287)
T cd07848         120 DIVHRDIKPENLLISHN  136 (287)
T ss_pred             CeecCCCCHHHEEEcCC
Confidence            47899999999999764


No 205
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=94.88  E-value=0.012  Score=43.81  Aligned_cols=17  Identities=29%  Similarity=0.528  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++|||+...
T Consensus       135 ~i~H~dl~p~nil~~~~  151 (311)
T cd07866         135 HILHRDIKAANILIDNQ  151 (311)
T ss_pred             CeecCCCCHHHEEECCC
Confidence            47999999999999874


No 206
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=94.88  E-value=0.018  Score=43.72  Aligned_cols=17  Identities=29%  Similarity=0.499  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+..+
T Consensus       120 ~i~H~dl~p~nil~~~~  136 (308)
T cd06615         120 KIMHRDVKPSNILVNSR  136 (308)
T ss_pred             CEEECCCChHHEEEecC
Confidence            58999999999999774


No 207
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=94.87  E-value=0.015  Score=42.65  Aligned_cols=17  Identities=35%  Similarity=0.618  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+|+++.|||+.++
T Consensus       126 ~i~H~di~p~nili~~~  142 (266)
T cd05033         126 NYVHRDLAARNILVNSN  142 (266)
T ss_pred             CcccCCCCcceEEEcCC
Confidence            47999999999999874


No 208
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=94.86  E-value=0.015  Score=42.46  Aligned_cols=29  Identities=31%  Similarity=0.376  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++..+                      ..+.++||+++.
T Consensus       120 ~i~H~dl~p~ni~i~~~----------------------~~~kl~d~g~~~  148 (256)
T cd05114         120 SFIHRDLAARNCLVSST----------------------GVVKVSDFGMTR  148 (256)
T ss_pred             CccccccCcceEEEcCC----------------------CeEEECCCCCcc
Confidence            37999999999999874                      557777777654


No 209
>KOG0984|consensus
Probab=94.86  E-value=0.0063  Score=47.75  Aligned_cols=37  Identities=24%  Similarity=0.376  Sum_probs=30.9

Q ss_pred             ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665          4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus         4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ...++.+-+.|+|++|+|||++-.                      +++.+-||--+|+
T Consensus       162 ~~L~~kL~vIHRDvKPsNiLIn~~----------------------GqVKiCDFGIsG~  198 (282)
T KOG0984|consen  162 EFLHSKLSVIHRDVKPSNILINYD----------------------GQVKICDFGISGY  198 (282)
T ss_pred             HHHHHHhhhhhccCCcceEEEccC----------------------CcEEEccccccee
Confidence            445667778999999999999885                      8899999988775


No 210
>PHA03210 serine/threonine kinase US3; Provisional
Probab=94.85  E-value=0.015  Score=48.20  Aligned_cols=28  Identities=25%  Similarity=0.350  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+..+                      +.++|+||..|
T Consensus       287 gIiHrDLKP~NILl~~~----------------------~~vkL~DFGla  314 (501)
T PHA03210        287 KLIHRDIKLENIFLNCD----------------------GKIVLGDFGTA  314 (501)
T ss_pred             CeecCCCCHHHEEECCC----------------------CCEEEEeCCCc
Confidence            47899999999999874                      67888888655


No 211
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=94.83  E-value=0.019  Score=42.18  Aligned_cols=17  Identities=29%  Similarity=0.581  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       127 ~~~H~dl~p~nili~~~  143 (270)
T cd05056         127 RFVHRDIAARNVLVSSP  143 (270)
T ss_pred             CeeccccChheEEEecC
Confidence            47999999999999874


No 212
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=94.83  E-value=0.018  Score=43.20  Aligned_cols=17  Identities=35%  Similarity=0.520  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+.|+||+|.|||+..+
T Consensus       149 ~i~H~dlkp~Nill~~~  165 (295)
T cd05097         149 NFVHRDLATRNCLVGNH  165 (295)
T ss_pred             CeeccccChhhEEEcCC
Confidence            46899999999999864


No 213
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=94.83  E-value=0.02  Score=42.65  Aligned_cols=17  Identities=29%  Similarity=0.440  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       122 ~i~H~dl~p~nill~~~  138 (298)
T cd07841         122 WILHRDLKPNNLLIASD  138 (298)
T ss_pred             CeeecCCChhhEEEcCC
Confidence            37999999999999874


No 214
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=94.80  E-value=0.016  Score=43.20  Aligned_cols=17  Identities=29%  Similarity=0.376  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+..+
T Consensus       123 ~i~H~dlkp~Nil~~~~  139 (291)
T cd07870         123 HILHRDLKPQNLLISYL  139 (291)
T ss_pred             CcccCCCChHHEEEcCC
Confidence            48999999999999764


No 215
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=94.79  E-value=0.014  Score=43.06  Aligned_cols=17  Identities=29%  Similarity=0.518  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++..+
T Consensus       119 ~i~H~dl~~~nil~~~~  135 (284)
T cd07839         119 NVLHRDLKPQNLLINKN  135 (284)
T ss_pred             CEecCCCCHHHEEEcCC
Confidence            47999999999999874


No 216
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=94.78  E-value=0.019  Score=41.70  Aligned_cols=29  Identities=34%  Similarity=0.400  Sum_probs=24.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|+++.||++..+                      +.+.++||+++.
T Consensus       124 ~i~h~dl~~~nilv~~~----------------------~~~kl~d~g~~~  152 (261)
T cd05148         124 NSIHRDLAARNILVGED----------------------LVCKVADFGLAR  152 (261)
T ss_pred             CeeccccCcceEEEcCC----------------------ceEEEccccchh
Confidence            37999999999999874                      567888887764


No 217
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=94.76  E-value=0.012  Score=44.48  Aligned_cols=29  Identities=28%  Similarity=0.573  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.++||..+.
T Consensus       136 gi~H~dLkp~Nill~~~----------------------~~~kl~dfg~~~  164 (296)
T cd06654         136 QVIHRDIKSDNILLGMD----------------------GSVKLTDFGFCA  164 (296)
T ss_pred             CcccCCCCHHHEEEcCC----------------------CCEEECccccch
Confidence            47899999999999764                      567788877543


No 218
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=94.75  E-value=0.015  Score=42.54  Aligned_cols=28  Identities=36%  Similarity=0.425  Sum_probs=22.6

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ++|+|+++.||++..+                      +.+.++||..+.
T Consensus       121 i~H~dl~p~ni~i~~~----------------------~~~kl~dfg~~~  148 (256)
T cd05059         121 FIHRDLAARNCLVGED----------------------NVVKVSDFGLAR  148 (256)
T ss_pred             cccccccHhhEEECCC----------------------CcEEECCcccce
Confidence            7899999999999874                      567788877553


No 219
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=94.75  E-value=0.019  Score=42.22  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=15.5

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+||++.|||+...
T Consensus       123 ~~i~h~dlkp~nil~~~~  140 (283)
T cd06617         123 LSVIHRDVKPSNVLINRN  140 (283)
T ss_pred             CCeecCCCCHHHEEECCC
Confidence            357899999999999764


No 220
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=94.75  E-value=0.019  Score=42.89  Aligned_cols=17  Identities=35%  Similarity=0.509  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       143 ~i~H~dlkp~Nil~~~~  159 (291)
T cd05094         143 HFVHRDLATRNCLVGAN  159 (291)
T ss_pred             CeeecccCcceEEEccC
Confidence            47999999999999874


No 221
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=94.74  E-value=0.018  Score=42.08  Aligned_cols=17  Identities=35%  Similarity=0.595  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|++|.|||+..+
T Consensus       115 ~i~H~dlkp~nill~~~  131 (257)
T cd05116         115 NFVHRDLAARNVLLVTQ  131 (257)
T ss_pred             CEeecccchhhEEEcCC
Confidence            37899999999999874


No 222
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=94.74  E-value=0.024  Score=42.62  Aligned_cols=17  Identities=24%  Similarity=0.471  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||+++|||+..+
T Consensus       121 ~ivH~dlk~~Nili~~~  137 (314)
T cd08216         121 GFIHRSVKASHILLSGD  137 (314)
T ss_pred             CeecCCCCcceEEEecC
Confidence            47999999999999874


No 223
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=94.72  E-value=0.019  Score=41.54  Aligned_cols=17  Identities=35%  Similarity=0.495  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++..+
T Consensus       121 ~i~h~dl~p~ni~i~~~  137 (262)
T cd06613         121 GKIHRDIKGANILLTED  137 (262)
T ss_pred             CceecCCChhhEEECCC
Confidence            47999999999999874


No 224
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=94.72  E-value=0.019  Score=41.87  Aligned_cols=29  Identities=34%  Similarity=0.604  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+|+++.||++...                      ..++|+||..+.
T Consensus       133 ~i~H~dlkp~Nil~~~~----------------------~~~kl~dfg~~~  161 (273)
T cd05035         133 NFIHRDLAARNCMLRED----------------------MTVCVADFGLSK  161 (273)
T ss_pred             CeeccccchheEEECCC----------------------CeEEECCcccee
Confidence            47899999999999774                      567788876653


No 225
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=94.72  E-value=0.019  Score=42.37  Aligned_cols=17  Identities=41%  Similarity=0.571  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+.++
T Consensus       144 ~i~H~dlkp~Nil~~~~  160 (283)
T cd05048         144 HFVHRDLAARNCLVGEG  160 (283)
T ss_pred             CeeccccccceEEEcCC
Confidence            47999999999999874


No 226
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=94.71  E-value=0.012  Score=43.03  Aligned_cols=29  Identities=24%  Similarity=0.526  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|+++.||++.+.                      +.+.++||..+.
T Consensus       131 ~ivh~dl~~~nili~~~----------------------~~~~l~Dfg~~~  159 (272)
T cd06637         131 KVIHRDIKGQNVLLTEN----------------------AEVKLVDFGVSA  159 (272)
T ss_pred             CCccCCCCHHHEEECCC----------------------CCEEEccCCCce
Confidence            47899999999999874                      567888887653


No 227
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=94.69  E-value=0.017  Score=42.07  Aligned_cols=17  Identities=41%  Similarity=0.724  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+|+++.||++..+
T Consensus       123 ~i~H~dl~p~nili~~~  139 (261)
T cd05072         123 NYIHRDLRAANVLVSES  139 (261)
T ss_pred             CeeccccchhhEEecCC
Confidence            37899999999999874


No 228
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=94.67  E-value=0.019  Score=41.78  Aligned_cols=30  Identities=27%  Similarity=0.434  Sum_probs=24.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||++.||++...                      +.+.++||+.+..
T Consensus       120 ~i~h~dl~~~nil~~~~----------------------~~~~l~d~~~~~~  149 (258)
T cd05578         120 GIIHRDIKPDNILLDEQ----------------------GHVHITDFNIATK  149 (258)
T ss_pred             CeeccCCCHHHeEEcCC----------------------CCEEEeecccccc
Confidence            47999999999999874                      6788899876643


No 229
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=94.66  E-value=0.023  Score=42.33  Aligned_cols=16  Identities=31%  Similarity=0.586  Sum_probs=14.5

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      +.|+||++.|||+..+
T Consensus       130 iiH~dlkp~nili~~~  145 (279)
T cd05111         130 MVHRNLAARNILLKSD  145 (279)
T ss_pred             EeccccCcceEEEcCC
Confidence            7999999999999764


No 230
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=94.66  E-value=0.017  Score=42.68  Aligned_cols=17  Identities=35%  Similarity=0.591  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       128 ~i~H~dlkp~nili~~~  144 (284)
T cd05081         128 RYVHRDLATRNILVESE  144 (284)
T ss_pred             CceeccCCHhhEEECCC
Confidence            47999999999999764


No 231
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=94.66  E-value=0.022  Score=43.34  Aligned_cols=28  Identities=32%  Similarity=0.542  Sum_probs=22.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.||++..+                      +.+.++||..+
T Consensus       145 ~i~H~dL~p~Nil~~~~----------------------~~~kl~dfg~~  172 (317)
T cd06635         145 NMIHRDIKAGNILLTEP----------------------GQVKLADFGSA  172 (317)
T ss_pred             CcccCCCCcccEEECCC----------------------CCEEEecCCCc
Confidence            46999999999999764                      56888888654


No 232
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=94.66  E-value=0.016  Score=42.31  Aligned_cols=29  Identities=28%  Similarity=0.499  Sum_probs=24.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+|+.+.||++..+                      +.+.++||..+.
T Consensus       122 ~~~H~dl~~~ni~i~~~----------------------~~~~l~df~~~~  150 (280)
T cd05581         122 GIIHRDLKPENILLDKD----------------------MHIKITDFGTAK  150 (280)
T ss_pred             CeeecCCCHHHeEECCC----------------------CCEEecCCcccc
Confidence            48999999999999874                      678888888654


No 233
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=94.65  E-value=0.022  Score=41.92  Aligned_cols=17  Identities=35%  Similarity=0.491  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+..+
T Consensus       120 ~i~H~dlkp~nil~~~~  136 (269)
T cd05087         120 NFIHSDLALRNCLLTAD  136 (269)
T ss_pred             CEeccccCcceEEEcCC
Confidence            48999999999999874


No 234
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=94.62  E-value=0.025  Score=42.20  Aligned_cols=18  Identities=33%  Similarity=0.613  Sum_probs=15.2

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+||++.||++..+
T Consensus       129 ~~i~H~dlkp~Nili~~~  146 (292)
T cd06644         129 MKIIHRDLKAGNVLLTLD  146 (292)
T ss_pred             CCeeecCCCcceEEEcCC
Confidence            357899999999999763


No 235
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=94.62  E-value=0.022  Score=42.05  Aligned_cols=18  Identities=44%  Similarity=0.597  Sum_probs=15.5

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+|+++.|||+...
T Consensus       131 ~~i~H~dikp~nili~~~  148 (270)
T cd05047         131 KQFIHRDLAARNILVGEN  148 (270)
T ss_pred             CCEeecccccceEEEcCC
Confidence            357999999999999874


No 236
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=94.60  E-value=0.017  Score=43.72  Aligned_cols=29  Identities=34%  Similarity=0.449  Sum_probs=23.7

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      ..++|+||++.|||+..+                      +.+.|+||..+
T Consensus       143 ~gi~H~dlkp~Nili~~~----------------------~~~kl~dfg~~  171 (303)
T cd05088         143 KQFIHRDLAARNILVGEN----------------------YVAKIADFGLS  171 (303)
T ss_pred             CCccccccchheEEecCC----------------------CcEEeCccccC
Confidence            357999999999999764                      56788888765


No 237
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=94.59  E-value=0.021  Score=41.06  Aligned_cols=30  Identities=30%  Similarity=0.391  Sum_probs=24.4

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+|+.+.||++.++                      +.+.++||..+.
T Consensus       112 ~~i~H~di~~~nil~~~~----------------------~~~~l~dfg~~~  141 (265)
T cd05579         112 NGIIHRDLKPDNILIDSN----------------------GHLKLTDFGLSK  141 (265)
T ss_pred             cCeecCCCCHHHeEEcCC----------------------CCEEEEecccch
Confidence            358999999999999874                      668888887554


No 238
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=94.58  E-value=0.026  Score=41.52  Aligned_cols=30  Identities=33%  Similarity=0.450  Sum_probs=24.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||++.||++..+                      +.+.|+||..+..
T Consensus       120 ~i~H~dl~~~ni~~~~~----------------------~~~kl~d~g~~~~  149 (288)
T cd07833         120 NIIHRDIKPENILVSES----------------------GVLKLCDFGFARA  149 (288)
T ss_pred             CeecCCCCHHHeEECCC----------------------CCEEEEeeecccc
Confidence            47999999999999874                      6688888876443


No 239
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=94.58  E-value=0.023  Score=42.33  Aligned_cols=29  Identities=24%  Similarity=0.425  Sum_probs=23.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||+++||++..+                      +.+.|+||..+.
T Consensus       148 ~ivH~dlkp~nili~~~----------------------~~~kl~dfg~~~  176 (291)
T cd06639         148 RIIHRDVKGNNILLTTE----------------------GGVKLVDFGVSA  176 (291)
T ss_pred             CeeccCCCHHHEEEcCC----------------------CCEEEeecccch
Confidence            47999999999999774                      567888886543


No 240
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=94.58  E-value=0.018  Score=40.35  Aligned_cols=31  Identities=29%  Similarity=0.357  Sum_probs=25.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      .++|+|+.+.||++.+.                      +.+.++||..+..-
T Consensus       107 ~i~h~~i~~~ni~~~~~----------------------~~~~l~d~~~~~~~  137 (244)
T smart00220      107 GIIHRDLKPENILLDED----------------------GHVKLADFGLARQL  137 (244)
T ss_pred             CeecCCcCHHHeEECCC----------------------CcEEEccccceeee
Confidence            57999999999999874                      66888888776543


No 241
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=94.57  E-value=0.019  Score=44.09  Aligned_cols=28  Identities=29%  Similarity=0.464  Sum_probs=22.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+...                      +.+.|+||..|
T Consensus       116 ~ivHrdikp~Nil~~~~----------------------~~~kl~Dfg~~  143 (316)
T cd05619         116 GIVYRDLKLDNILLDTD----------------------GHIKIADFGMC  143 (316)
T ss_pred             CeEeCCCCHHHEEECCC----------------------CCEEEccCCcc
Confidence            47999999999999874                      56788888654


No 242
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=94.56  E-value=0.018  Score=43.15  Aligned_cols=29  Identities=28%  Similarity=0.403  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++...                      +.+.|+||..+.
T Consensus       135 ~i~H~dl~p~nill~~~----------------------~~~kL~dfg~~~  163 (296)
T cd06618         135 GVIHRDVKPSNILLDAS----------------------GNVKLCDFGISG  163 (296)
T ss_pred             CEecCCCcHHHEEEcCC----------------------CCEEECccccch
Confidence            58999999999999764                      567888886553


No 243
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=94.55  E-value=0.023  Score=41.71  Aligned_cols=17  Identities=35%  Similarity=0.448  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       142 ~i~h~dlkp~nili~~~  158 (280)
T cd05049         142 HFVHRDLATRNCLVGYD  158 (280)
T ss_pred             CeeccccccceEEEcCC
Confidence            47899999999999874


No 244
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=94.55  E-value=0.02  Score=41.67  Aligned_cols=17  Identities=41%  Similarity=0.626  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+.++
T Consensus       118 ~i~H~dlk~~nili~~~  134 (262)
T cd05058         118 KFVHRDLAARNCMLDES  134 (262)
T ss_pred             CccccccCcceEEEcCC
Confidence            57999999999999874


No 245
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=94.55  E-value=0.031  Score=40.18  Aligned_cols=30  Identities=23%  Similarity=0.327  Sum_probs=23.8

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+|+++.||++...                      +.+.++||..+.
T Consensus       112 ~~~~H~~l~p~ni~~~~~----------------------~~~~l~d~~~~~  141 (250)
T cd05123         112 LGIIYRDLKPENILLDAD----------------------GHIKLTDFGLAK  141 (250)
T ss_pred             CCceecCCCcceEEEcCC----------------------CcEEEeecCcce
Confidence            347999999999999874                      567888887553


No 246
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=94.53  E-value=0.024  Score=42.46  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+...
T Consensus       150 ~i~H~dlkp~Nili~~~  166 (296)
T cd05095         150 NFVHRDLATRNCLVGKN  166 (296)
T ss_pred             CeecccCChheEEEcCC
Confidence            48999999999999764


No 247
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=94.53  E-value=0.021  Score=42.80  Aligned_cols=29  Identities=21%  Similarity=0.272  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+.+.                      +.+.++||..+.
T Consensus       122 ~ivH~dlkp~Nil~~~~----------------------~~~~l~Dfg~~~  150 (285)
T cd05605         122 RIVYRDLKPENILLDDY----------------------GHIRISDLGLAV  150 (285)
T ss_pred             CcEecCCCHHHEEECCC----------------------CCEEEeeCCCce
Confidence            47999999999999764                      567788876554


No 248
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=94.52  E-value=0.017  Score=42.91  Aligned_cols=17  Identities=35%  Similarity=0.520  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       123 ~i~H~dl~p~nil~~~~  139 (291)
T cd07844         123 RVLHRDLKPQNLLISER  139 (291)
T ss_pred             CeecccCCHHHEEEcCC
Confidence            47999999999999874


No 249
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=94.51  E-value=0.017  Score=43.63  Aligned_cols=17  Identities=29%  Similarity=0.509  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++...
T Consensus       128 ~i~H~dl~p~nil~~~~  144 (309)
T cd07845         128 FIIHRDLKVSNLLLTDK  144 (309)
T ss_pred             CeecCCCCHHHEEECCC
Confidence            37999999999999874


No 250
>PTZ00036 glycogen synthase kinase; Provisional
Probab=94.51  E-value=0.022  Score=46.33  Aligned_cols=16  Identities=38%  Similarity=0.717  Sum_probs=14.5

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||++.|||+..
T Consensus       190 ~IiHrDLKp~NILl~~  205 (440)
T PTZ00036        190 FICHRDLKPQNLLIDP  205 (440)
T ss_pred             CEecCCcCHHHEEEcC
Confidence            4899999999999975


No 251
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=94.50  E-value=0.025  Score=42.57  Aligned_cols=17  Identities=35%  Similarity=0.513  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+...
T Consensus       157 givH~dlkp~Nili~~~  173 (304)
T cd05101         157 KCIHRDLAARNVLVTEN  173 (304)
T ss_pred             CeeecccccceEEEcCC
Confidence            47999999999999864


No 252
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=94.50  E-value=0.021  Score=41.85  Aligned_cols=17  Identities=35%  Similarity=0.565  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+...
T Consensus       139 ~i~H~di~p~nill~~~  155 (277)
T cd05032         139 KFVHRDLAARNCMVAED  155 (277)
T ss_pred             CccccccChheEEEcCC
Confidence            47999999999999874


No 253
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=94.47  E-value=0.019  Score=44.44  Aligned_cols=17  Identities=29%  Similarity=0.532  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       138 gi~H~dlkp~Nil~~~~  154 (353)
T cd07850         138 GIIHRDLKPSNIVVKSD  154 (353)
T ss_pred             CeeeCCCCHHHEEECCC
Confidence            47999999999999874


No 254
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=94.47  E-value=0.031  Score=41.41  Aligned_cols=29  Identities=34%  Similarity=0.584  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+...                      +.+.++||..+.
T Consensus       123 ~i~H~dlkp~nili~~~----------------------~~~kl~dfg~~~  151 (282)
T cd06643         123 KIIHRDLKAGNILFTLD----------------------GDIKLADFGVSA  151 (282)
T ss_pred             CeeecCCCcccEEEccC----------------------CCEEEccccccc
Confidence            47899999999999764                      568888887653


No 255
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=94.46  E-value=0.023  Score=41.55  Aligned_cols=34  Identities=26%  Similarity=0.337  Sum_probs=24.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||++.|||+.......                 ...+.++||..+.
T Consensus       126 ~i~H~dl~p~nil~~~~~~~~-----------------~~~~~l~dfg~~~  159 (269)
T cd05044         126 HFIHRDLAARNCLVSEKGYDA-----------------DRVVKIGDFGLAR  159 (269)
T ss_pred             CcccCCCChheEEEecCCCCC-----------------CcceEECCccccc
Confidence            479999999999998742111                 1367888887653


No 256
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=94.46  E-value=0.02  Score=41.50  Aligned_cols=17  Identities=24%  Similarity=0.415  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.||++..+
T Consensus       121 ~i~h~dl~p~ni~~~~~  137 (256)
T cd08221         121 GILHRDIKTLNIFLTKA  137 (256)
T ss_pred             CccccCCChHhEEEeCC
Confidence            47899999999999874


No 257
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=94.46  E-value=0.021  Score=41.70  Aligned_cols=17  Identities=18%  Similarity=0.467  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+..+
T Consensus       126 ~i~H~dl~~~nil~~~~  142 (267)
T cd08228         126 RVMHRDIKPANVFITAT  142 (267)
T ss_pred             CeeCCCCCHHHEEEcCC
Confidence            57999999999999764


No 258
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=94.46  E-value=0.025  Score=42.73  Aligned_cols=17  Identities=29%  Similarity=0.563  Sum_probs=14.7

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+...
T Consensus       129 ~ivH~dikp~Nill~~~  145 (303)
T cd05110         129 RLVHRDLAARNVLVKSP  145 (303)
T ss_pred             CeeccccccceeeecCC
Confidence            46899999999999764


No 259
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=94.45  E-value=0.02  Score=41.96  Aligned_cols=17  Identities=41%  Similarity=0.671  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.||++...
T Consensus       122 ~i~H~dl~p~ni~i~~~  138 (260)
T cd05073         122 NYIHRDLRAANILVSAS  138 (260)
T ss_pred             CccccccCcceEEEcCC
Confidence            47999999999999774


No 260
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=94.44  E-value=0.024  Score=41.97  Aligned_cols=17  Identities=47%  Similarity=0.647  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+..+
T Consensus       144 ~i~H~dlkp~nili~~~  160 (283)
T cd05090         144 FFVHKDLAARNILIGEQ  160 (283)
T ss_pred             CeehhccccceEEEcCC
Confidence            47999999999999874


No 261
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=94.42  E-value=0.026  Score=42.38  Aligned_cols=29  Identities=21%  Similarity=0.291  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+|+++.||++...                      +.+.++||..+.
T Consensus       122 ~iiH~dikp~Nil~~~~----------------------~~~~l~Dfg~~~  150 (285)
T cd05630         122 RIVYRDLKPENILLDDH----------------------GHIRISDLGLAV  150 (285)
T ss_pred             CEEeCCCCHHHEEECCC----------------------CCEEEeecccee
Confidence            47899999999999874                      668899987653


No 262
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=94.42  E-value=0.027  Score=41.23  Aligned_cols=17  Identities=35%  Similarity=0.599  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.||++...
T Consensus       133 ~i~H~dikp~nili~~~  149 (273)
T cd05074         133 NFIHRDLAARNCMLNEN  149 (273)
T ss_pred             CEeecccchhhEEEcCC
Confidence            47999999999999764


No 263
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=94.41  E-value=0.025  Score=41.95  Aligned_cols=30  Identities=23%  Similarity=0.463  Sum_probs=24.2

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .-++|+||++.||++...                      +.++|+||.++.
T Consensus       135 ~gi~H~dl~p~ni~i~~~----------------------~~~~l~d~~~~~  164 (286)
T cd06614         135 QNVIHRDIKSDNILLSKD----------------------GSVKLADFGFAA  164 (286)
T ss_pred             CCeeeCCCChhhEEEcCC----------------------CCEEECccchhh
Confidence            357999999999999864                      568888887554


No 264
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=94.40  E-value=0.027  Score=41.67  Aligned_cols=30  Identities=23%  Similarity=0.376  Sum_probs=24.2

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+||+++||++..+                      +.+.++||..+.
T Consensus       120 ~~i~h~dl~p~Ni~i~~~----------------------~~~~l~dfg~~~  149 (277)
T cd06641         120 EKKIHRDIKAANVLLSEH----------------------GEVKLADFGVAG  149 (277)
T ss_pred             CCeecCCCCHHhEEECCC----------------------CCEEEeecccce
Confidence            457999999999999764                      568888887653


No 265
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=94.38  E-value=0.019  Score=42.00  Aligned_cols=17  Identities=29%  Similarity=0.489  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|++++||++...
T Consensus       126 ~i~H~dl~p~nill~~~  142 (267)
T cd06646         126 GKMHRDIKGANILLTDN  142 (267)
T ss_pred             CccccCCCHHHEEECCC
Confidence            57999999999999764


No 266
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=94.37  E-value=0.026  Score=41.93  Aligned_cols=17  Identities=24%  Similarity=0.452  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       115 ~i~H~dlkp~Nill~~~  131 (279)
T cd06619         115 KILHRDVKPSNMLVNTR  131 (279)
T ss_pred             CEeeCCCCHHHEEECCC
Confidence            57999999999999774


No 267
>PHA03211 serine/threonine kinase US3; Provisional
Probab=94.37  E-value=0.023  Score=47.11  Aligned_cols=28  Identities=25%  Similarity=0.408  Sum_probs=22.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+||++.|||+...                      +.++|+||..|
T Consensus       280 gIvHrDLKP~NILl~~~----------------------~~vkL~DFGla  307 (461)
T PHA03211        280 GIIHRDIKTENVLVNGP----------------------EDICLGDFGAA  307 (461)
T ss_pred             CEEECcCCHHHEEECCC----------------------CCEEEcccCCc
Confidence            47899999999999874                      56778888654


No 268
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=94.36  E-value=0.021  Score=42.42  Aligned_cols=18  Identities=39%  Similarity=0.517  Sum_probs=15.5

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+||++.|||+..+
T Consensus       149 ~~i~H~dl~p~nil~~~~  166 (288)
T cd05050         149 RKFVHRDLATRNCLVGEN  166 (288)
T ss_pred             CCeecccccHhheEecCC
Confidence            358999999999999764


No 269
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=94.35  E-value=0.03  Score=40.38  Aligned_cols=18  Identities=17%  Similarity=0.287  Sum_probs=15.7

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+||++.||++...
T Consensus       120 ~~i~h~dl~~~nili~~~  137 (256)
T cd08529         120 KKILHRDIKSLNLFLDAY  137 (256)
T ss_pred             CCcccCCCCcceEEEeCC
Confidence            358999999999999874


No 270
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=94.35  E-value=0.028  Score=43.15  Aligned_cols=17  Identities=35%  Similarity=0.505  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+.|+||++.|||+..+
T Consensus       154 givH~dlkp~Nill~~~  170 (334)
T cd05100         154 KCIHRDLAARNVLVTED  170 (334)
T ss_pred             CeeccccccceEEEcCC
Confidence            47999999999999864


No 271
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=94.33  E-value=0.021  Score=41.74  Aligned_cols=17  Identities=29%  Similarity=0.489  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++...
T Consensus       126 ~i~H~dlkp~nili~~~  142 (267)
T cd06645         126 GKMHRDIKGANILLTDN  142 (267)
T ss_pred             CeecCCCCHHHEEECCC
Confidence            47899999999999764


No 272
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=94.31  E-value=0.024  Score=42.56  Aligned_cols=17  Identities=41%  Similarity=0.647  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       139 ~ivH~dlkp~Nill~~~  155 (297)
T cd05089         139 QFIHRDLAARNVLVGEN  155 (297)
T ss_pred             CcccCcCCcceEEECCC
Confidence            57999999999999764


No 273
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=94.30  E-value=0.027  Score=41.47  Aligned_cols=29  Identities=28%  Similarity=0.444  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++..+                      +.++|+||..+.
T Consensus       120 ~i~h~~l~p~ni~~~~~----------------------~~~~l~dfg~~~  148 (286)
T cd07846         120 NIIHRDIKPENILVSQS----------------------GVVKLCDFGFAR  148 (286)
T ss_pred             CccccCCCHHHEEECCC----------------------CcEEEEeeeeee
Confidence            47899999999999774                      567888887543


No 274
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=94.30  E-value=0.024  Score=39.65  Aligned_cols=32  Identities=25%  Similarity=0.296  Sum_probs=26.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY   64 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   64 (107)
                      .+.|+|+.+.||++...                      ..++++||+.+....
T Consensus       118 ~i~h~di~~~ni~v~~~----------------------~~~~l~d~g~~~~~~  149 (225)
T smart00221      118 GIVHRDLKPENILLGMD----------------------GLVKLADFGLARFIH  149 (225)
T ss_pred             CeecCCCCHHHEEEcCC----------------------CCEEEeeCceeeEec
Confidence            67999999999999874                      678999998766543


No 275
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=94.29  E-value=0.033  Score=41.12  Aligned_cols=17  Identities=29%  Similarity=0.448  Sum_probs=14.6

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+|+++.|||+...
T Consensus       119 ~i~H~dikp~nil~~~~  135 (268)
T cd05086         119 NFLHSDLALRNCFLTSD  135 (268)
T ss_pred             CeeccCCccceEEEcCC
Confidence            36899999999999764


No 276
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=94.27  E-value=0.025  Score=41.92  Aligned_cols=18  Identities=28%  Similarity=0.534  Sum_probs=15.5

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+||++.|||+...
T Consensus       127 ~~i~H~dlkp~Nil~~~~  144 (288)
T cd06616         127 LKIIHRDVKPSNILLDRN  144 (288)
T ss_pred             CCeeccCCCHHHEEEccC
Confidence            358999999999999764


No 277
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=94.23  E-value=0.035  Score=40.72  Aligned_cols=17  Identities=29%  Similarity=0.485  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++..+
T Consensus       128 ~i~H~dl~~~nil~~~~  144 (272)
T cd06629         128 GILHRDLKADNLLVDAD  144 (272)
T ss_pred             CeeecCCChhhEEEcCC
Confidence            47999999999999764


No 278
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=94.23  E-value=0.031  Score=40.54  Aligned_cols=17  Identities=18%  Similarity=0.485  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.||++...
T Consensus       126 ~i~h~dl~p~nil~~~~  142 (267)
T cd08224         126 RIMHRDIKPANVFITAT  142 (267)
T ss_pred             CEecCCcChhhEEECCC
Confidence            57899999999999764


No 279
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=94.23  E-value=0.021  Score=43.18  Aligned_cols=29  Identities=24%  Similarity=0.563  Sum_probs=22.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++..+                      +.+.++||..+.
T Consensus       135 ~i~H~dL~p~Nili~~~----------------------~~~kl~dfg~~~  163 (296)
T cd06655         135 QVIHRDIKSDNVLLGMD----------------------GSVKLTDFGFCA  163 (296)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEEccCccch
Confidence            47899999999999764                      567788876543


No 280
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=94.22  E-value=0.027  Score=41.20  Aligned_cols=17  Identities=35%  Similarity=0.618  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.||++..+
T Consensus       127 ~i~H~dlkp~Nili~~~  143 (268)
T cd05063         127 NYVHRDLAARNILVNSN  143 (268)
T ss_pred             CeeccccchhhEEEcCC
Confidence            47899999999999764


No 281
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=94.20  E-value=0.043  Score=42.51  Aligned_cols=29  Identities=31%  Similarity=0.411  Sum_probs=24.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+...                      +.+.++||..+.
T Consensus       199 ~i~H~dikp~Nil~~~~----------------------~~~kl~dfg~~~  227 (343)
T cd05103         199 KCIHRDLAARNILLSEN----------------------NVVKICDFGLAR  227 (343)
T ss_pred             CeecCCCccCeEEEcCC----------------------CcEEEEeccccc
Confidence            57999999999999864                      668888887654


No 282
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=94.20  E-value=0.028  Score=41.43  Aligned_cols=17  Identities=29%  Similarity=0.464  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.||++..+
T Consensus       119 ~~~H~dl~p~nil~~~~  135 (283)
T cd07835         119 RVLHRDLKPQNLLIDRE  135 (283)
T ss_pred             CeeCCCCCHHHEEEcCC
Confidence            57999999999999874


No 283
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=94.19  E-value=0.031  Score=40.31  Aligned_cols=17  Identities=41%  Similarity=0.657  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|++++||++..+
T Consensus       119 ~i~H~dl~~~ni~~~~~  135 (256)
T cd06612         119 KKIHRDIKAGNILLNEE  135 (256)
T ss_pred             CcccCCCCcceEEECCC
Confidence            47899999999999874


No 284
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=94.19  E-value=0.027  Score=41.12  Aligned_cols=17  Identities=41%  Similarity=0.728  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.||++..+
T Consensus       122 ~i~H~dl~p~ni~i~~~  138 (260)
T cd05067         122 NYIHRDLRAANILVSET  138 (260)
T ss_pred             CeecccccHHhEEEcCC
Confidence            47999999999999874


No 285
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=94.18  E-value=0.024  Score=43.77  Aligned_cols=29  Identities=31%  Similarity=0.588  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.++|+||..+.
T Consensus       137 ~i~H~dlkp~NIll~~~----------------------~~~kL~dfg~~~  165 (342)
T cd07879         137 GIIHRDLKPGNLAVNED----------------------CELKILDFGLAR  165 (342)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEEeeCCCCc
Confidence            46899999999999874                      668888887553


No 286
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=94.17  E-value=0.03  Score=47.62  Aligned_cols=30  Identities=23%  Similarity=0.465  Sum_probs=24.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||+|.|||+..+                     .+.++|+||-.|.
T Consensus       275 gIiHRDLKP~NILl~~~---------------------~~~~KL~DFGlA~  304 (566)
T PLN03225        275 GIVHRDVKPQNIIFSEG---------------------SGSFKIIDLGAAA  304 (566)
T ss_pred             CEEeCcCCHHHEEEeCC---------------------CCcEEEEeCCCcc
Confidence            48999999999999852                     0568999998774


No 287
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=94.17  E-value=0.034  Score=40.93  Aligned_cols=17  Identities=35%  Similarity=0.614  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+.|+||++.|||+..+
T Consensus       115 ~i~H~dlkp~nil~~~~  131 (257)
T cd05115         115 NFVHRDLAARNVLLVNQ  131 (257)
T ss_pred             CeeecccchheEEEcCC
Confidence            47999999999999764


No 288
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=94.16  E-value=0.025  Score=42.63  Aligned_cols=28  Identities=25%  Similarity=0.557  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -+.|+||++.||++..+                      +.+.++||+.+
T Consensus       138 ~ivH~dlkp~Nill~~~----------------------~~~kL~dfg~~  165 (292)
T cd06658         138 GVIHRDIKSDSILLTSD----------------------GRIKLSDFGFC  165 (292)
T ss_pred             CEeecCCCHHHEEEcCC----------------------CCEEEccCcch
Confidence            36799999999999764                      56888888765


No 289
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=94.16  E-value=0.041  Score=43.52  Aligned_cols=28  Identities=21%  Similarity=0.349  Sum_probs=22.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+.++                      ..+.|+||..|
T Consensus       232 giiHrDLkp~Nil~~~~----------------------~~~kL~DfGla  259 (374)
T cd05106         232 NCIHRDVAARNVLLTDG----------------------RVAKICDFGLA  259 (374)
T ss_pred             CEEeccCchheEEEeCC----------------------CeEEEeeceee
Confidence            37899999999999874                      56788888654


No 290
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=94.16  E-value=0.024  Score=41.84  Aligned_cols=29  Identities=24%  Similarity=0.526  Sum_probs=24.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|+++.||++.+.                      +.+.++||..+.
T Consensus       141 ~ivH~dl~~~nili~~~----------------------~~~~l~dfg~~~  169 (282)
T cd06636         141 KVIHRDIKGQNVLLTEN----------------------AEVKLVDFGVSA  169 (282)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEEeeCcchh
Confidence            47999999999999874                      668899987654


No 291
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=94.14  E-value=0.033  Score=40.37  Aligned_cols=29  Identities=21%  Similarity=0.344  Sum_probs=24.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      ..+.++||+.+.
T Consensus       121 ~i~h~~l~~~nil~~~~----------------------~~~~l~d~~~~~  149 (256)
T cd08218         121 KILHRDIKSQNIFLTKD----------------------GTIKLGDFGIAR  149 (256)
T ss_pred             CEecCCCCHHHEEEcCC----------------------CCEEEeecccee
Confidence            48999999999999774                      668899998764


No 292
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=94.14  E-value=0.025  Score=41.98  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.||++...
T Consensus       150 ~i~H~dlkp~Nili~~~  166 (296)
T cd05051         150 NFVHRDLATRNCLVGKN  166 (296)
T ss_pred             CccccccchhceeecCC
Confidence            46899999999999875


No 293
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=94.14  E-value=0.027  Score=41.08  Aligned_cols=17  Identities=18%  Similarity=0.467  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++..+
T Consensus       126 ~i~H~dl~p~nili~~~  142 (267)
T cd08229         126 RVMHRDIKPANVFITAT  142 (267)
T ss_pred             CeecCCCCHHHEEEcCC
Confidence            47999999999999764


No 294
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=94.13  E-value=0.037  Score=42.12  Aligned_cols=29  Identities=34%  Similarity=0.549  Sum_probs=23.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++...                      +.+.++||..+.
T Consensus       141 gi~H~dl~p~nili~~~----------------------~~~kL~dfg~~~  169 (313)
T cd06633         141 NMIHRDIKAGNILLTEP----------------------GQVKLADFGSAS  169 (313)
T ss_pred             CeecCCCChhhEEECCC----------------------CCEEEeecCCCc
Confidence            47899999999999764                      567888886544


No 295
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=94.11  E-value=0.031  Score=41.86  Aligned_cols=28  Identities=25%  Similarity=0.545  Sum_probs=22.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+||++.||++..+                      +.+.++||..+
T Consensus       135 ~i~H~dl~p~Nil~~~~----------------------~~~~l~d~g~~  162 (285)
T cd06648         135 GVIHRDIKSDSILLTSD----------------------GRVKLSDFGFC  162 (285)
T ss_pred             CeecCCCChhhEEEcCC----------------------CcEEEcccccc
Confidence            47899999999999874                      56778888654


No 296
>KOG0603|consensus
Probab=94.09  E-value=0.045  Score=47.67  Aligned_cols=35  Identities=31%  Similarity=0.374  Sum_probs=28.5

Q ss_pred             eEEEecccCCCceeee-cCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchh
Q psy15665         10 VTFCHNDLQEGNILYR-ESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRA   66 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~-~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~   66 (107)
                      -.+.|+||+|+|||+. +.                      +.|.++||=.+....+.
T Consensus       434 ~gvvhRDLkp~NIL~~~~~----------------------g~lrltyFG~a~~~~~~  469 (612)
T KOG0603|consen  434 QGVVHRDLKPGNILLDGSA----------------------GHLRLTYFGFWSELERS  469 (612)
T ss_pred             cCeeecCCChhheeecCCC----------------------CcEEEEEechhhhCchh
Confidence            3468999999999995 32                      67999999888776665


No 297
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=94.08  E-value=0.024  Score=41.74  Aligned_cols=17  Identities=29%  Similarity=0.471  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+..+
T Consensus       121 ~i~H~dl~p~nil~~~~  137 (285)
T cd07861         121 RVLHRDLKPQNLLIDNK  137 (285)
T ss_pred             CeeecCCCHHHEEEcCC
Confidence            47899999999999774


No 298
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=94.08  E-value=0.027  Score=42.67  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+...
T Consensus       161 ~ivH~dlkp~Nil~~~~  177 (302)
T cd05055         161 NCIHRDLAARNVLLTHG  177 (302)
T ss_pred             CeehhhhccceEEEcCC
Confidence            47999999999999764


No 299
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=94.07  E-value=0.026  Score=43.16  Aligned_cols=29  Identities=24%  Similarity=0.426  Sum_probs=23.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||++.|||+...                      +.+.|+||..+.
T Consensus       116 ~ivH~dlkp~Nill~~~----------------------~~~kl~Dfg~~~  144 (318)
T cd05570         116 GIIYRDLKLDNVLLDSE----------------------GHIKIADFGMCK  144 (318)
T ss_pred             CeEccCCCHHHeEECCC----------------------CcEEecccCCCe
Confidence            57999999999999874                      568888887653


No 300
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=94.06  E-value=0.026  Score=42.10  Aligned_cols=17  Identities=35%  Similarity=0.415  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+..+
T Consensus       117 ~i~H~di~p~nili~~~  133 (278)
T cd05606         117 FVVYRDLKPANILLDEH  133 (278)
T ss_pred             CEEcCCCCHHHEEECCC
Confidence            48999999999999764


No 301
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=94.05  E-value=0.023  Score=43.67  Aligned_cols=17  Identities=29%  Similarity=0.534  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       126 ~ivH~dlkp~Nill~~~  142 (336)
T cd07849         126 NVLHRDLKPSNLLLNTN  142 (336)
T ss_pred             CeeccCCCHHHEEECCC
Confidence            47999999999999874


No 302
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=94.05  E-value=0.027  Score=42.62  Aligned_cols=28  Identities=25%  Similarity=0.547  Sum_probs=22.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+|+++.||++...                      +.+.++||+.+
T Consensus       136 givH~dl~p~Nilv~~~----------------------~~~~l~dfg~~  163 (292)
T cd06657         136 GVIHRDIKSDSILLTHD----------------------GRVKLSDFGFC  163 (292)
T ss_pred             CeecCCCCHHHEEECCC----------------------CCEEEcccccc
Confidence            47899999999999864                      56788888754


No 303
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=94.04  E-value=0.028  Score=41.02  Aligned_cols=30  Identities=20%  Similarity=0.328  Sum_probs=24.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+|+++.||++..+                      +.+.++||..+..
T Consensus       113 ~~~h~dl~~~nilv~~~----------------------~~~~l~df~~~~~  142 (262)
T cd05572         113 GIIYRDLKPENLLLDSN----------------------GYVKLVDFGFAKK  142 (262)
T ss_pred             CcccCCCCHHHEEEcCC----------------------CCEEEeeCCcccc
Confidence            47999999999999774                      5678888776553


No 304
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=94.04  E-value=0.032  Score=41.07  Aligned_cols=17  Identities=29%  Similarity=0.483  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.||++..+
T Consensus       120 ~i~h~dl~p~ni~~~~~  136 (284)
T cd07836         120 RVLHRDLKPQNLLINKR  136 (284)
T ss_pred             CeeeCCCCHHHEEECCC
Confidence            48999999999999864


No 305
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=94.04  E-value=0.03  Score=41.49  Aligned_cols=17  Identities=29%  Similarity=0.511  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++...
T Consensus       121 ~ivH~dl~p~Nil~~~~  137 (277)
T cd06640         121 KKIHRDIKAANVLLSEQ  137 (277)
T ss_pred             CccCcCCChhhEEEcCC
Confidence            47899999999999864


No 306
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=94.02  E-value=0.04  Score=40.40  Aligned_cols=28  Identities=29%  Similarity=0.444  Sum_probs=23.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+|+++.||++...                      +.+.|+||..+
T Consensus       127 ~i~h~~l~~~nili~~~----------------------~~~~l~dfg~~  154 (287)
T cd07838         127 RIVHRDLKPQNILVTSD----------------------GQVKIADFGLA  154 (287)
T ss_pred             CeeeccCChhhEEEccC----------------------CCEEEeccCcc
Confidence            37999999999999875                      56888888655


No 307
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=94.01  E-value=0.034  Score=43.09  Aligned_cols=29  Identities=31%  Similarity=0.588  Sum_probs=24.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.|||+..+                      +.+.++||..+.
T Consensus       138 gi~H~dlkp~Nill~~~----------------------~~~kl~dfg~~~  166 (343)
T cd07880         138 GIIHRDLKPGNLAVNED----------------------CELKILDFGLAR  166 (343)
T ss_pred             CeecCCCCHHHEEEcCC----------------------CCEEEeeccccc
Confidence            47999999999999874                      668888887664


No 308
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=94.00  E-value=0.031  Score=41.62  Aligned_cols=17  Identities=29%  Similarity=0.479  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       126 ~i~H~dl~p~nili~~~  142 (293)
T cd07843         126 WILHRDLKTSNLLLNNR  142 (293)
T ss_pred             CeeeccCCHHHEEECCC
Confidence            37899999999999874


No 309
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=93.98  E-value=0.024  Score=42.79  Aligned_cols=17  Identities=35%  Similarity=0.505  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+...
T Consensus       160 gi~H~dlkp~Nill~~~  176 (307)
T cd05098         160 KCIHRDLAARNVLVTED  176 (307)
T ss_pred             CcccccccHHheEEcCC
Confidence            57899999999999764


No 310
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=93.94  E-value=0.034  Score=41.50  Aligned_cols=29  Identities=24%  Similarity=0.401  Sum_probs=24.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||++.||++..+                      +.+.++||.++.
T Consensus       125 ~i~H~dl~~~nil~~~~----------------------~~~~l~dfg~~~  153 (287)
T cd06621         125 KIIHRDIKPSNILLTRK----------------------GQVKLCDFGVSG  153 (287)
T ss_pred             CcccCCCCHHHEEEecC----------------------CeEEEeeccccc
Confidence            57999999999999874                      668899998765


No 311
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=93.91  E-value=0.032  Score=41.59  Aligned_cols=17  Identities=35%  Similarity=0.571  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+.++
T Consensus       147 ~ivH~dikp~nill~~~  163 (290)
T cd05045         147 KLVHRDLAARNVLVAEG  163 (290)
T ss_pred             CeehhhhhhheEEEcCC
Confidence            57999999999999774


No 312
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=93.89  E-value=0.04  Score=40.94  Aligned_cols=28  Identities=29%  Similarity=0.667  Sum_probs=23.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCC-CeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNI-DLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa   60 (107)
                      .++|+||++.||++...                      + .+.++||..+
T Consensus       129 ~i~H~dl~p~nil~~~~----------------------~~~~~l~dfg~~  157 (267)
T PHA03390        129 NIIHNDIKLENVLYDRA----------------------KDRIYLCDYGLC  157 (267)
T ss_pred             CeeeCCCCHHHEEEeCC----------------------CCeEEEecCccc
Confidence            38999999999999874                      3 6888888755


No 313
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=93.87  E-value=0.024  Score=41.99  Aligned_cols=28  Identities=18%  Similarity=0.312  Sum_probs=22.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+|+.+.||++..+                      +.+.++||..+
T Consensus       115 ~i~H~di~p~Nil~~~~----------------------~~~~l~dfg~~  142 (277)
T cd05577         115 RIVYRDLKPENVLLDDH----------------------GNVRISDLGLA  142 (277)
T ss_pred             CcccCCCCHHHEEECCC----------------------CCEEEccCcch
Confidence            46899999999999874                      56788888654


No 314
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=93.86  E-value=0.035  Score=40.81  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=14.6

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+.|+||++.||++..+
T Consensus       120 ~i~H~dl~p~nil~~~~  136 (286)
T cd07847         120 NCIHRDVKPENILITKQ  136 (286)
T ss_pred             CceecCCChhhEEEcCC
Confidence            36899999999999764


No 315
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=93.85  E-value=0.026  Score=41.21  Aligned_cols=28  Identities=21%  Similarity=0.390  Sum_probs=22.4

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      +.|+||++.||++...                      +.+.++||..+.
T Consensus       123 i~H~dl~p~nil~~~~----------------------~~~~l~dfg~~~  150 (265)
T cd06631         123 VVHRDIKGNNVMLMPN----------------------GIIKLIDFGCAR  150 (265)
T ss_pred             cccCCcCHHhEEECCC----------------------CeEEeccchhhH
Confidence            6899999999999764                      567788876543


No 316
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=93.83  E-value=0.04  Score=42.25  Aligned_cols=17  Identities=35%  Similarity=0.563  Sum_probs=15.2

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.||++...
T Consensus       127 ~i~H~dl~p~nill~~~  143 (337)
T cd07852         127 NVIHRDLKPSNILLNSD  143 (337)
T ss_pred             CeecCCCCHHHEEEcCC
Confidence            47999999999999874


No 317
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=93.82  E-value=0.035  Score=42.01  Aligned_cols=28  Identities=25%  Similarity=0.509  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -+.|+|++++||++..+                      +.+.|+||..+
T Consensus       137 ~ivH~dl~p~Nill~~~----------------------~~~kL~dfg~~  164 (297)
T cd06659         137 GVIHRDIKSDSILLTLD----------------------GRVKLSDFGFC  164 (297)
T ss_pred             CeecCCCCHHHeEEccC----------------------CcEEEeechhH
Confidence            47899999999999774                      67888998755


No 318
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=93.82  E-value=0.026  Score=40.80  Aligned_cols=30  Identities=20%  Similarity=0.382  Sum_probs=23.9

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ..++|+||.+.||++...                      +.+.|+||..+.
T Consensus       119 ~~~~H~~l~~~ni~~~~~----------------------~~~~l~df~~~~  148 (264)
T cd06623         119 RHIIHRDIKPSNLLINSK----------------------GEVKIADFGISK  148 (264)
T ss_pred             CCCccCCCCHHHEEECCC----------------------CCEEEccCccce
Confidence            567999999999999874                      567777776554


No 319
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=93.81  E-value=0.031  Score=40.28  Aligned_cols=17  Identities=29%  Similarity=0.481  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++..+
T Consensus       122 ~i~H~dl~~~ni~~~~~  138 (258)
T cd06632         122 NTVHRDIKGANILVDTN  138 (258)
T ss_pred             CcccCCCCHHHEEECCC
Confidence            47999999999999764


No 320
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=93.80  E-value=0.046  Score=40.55  Aligned_cols=16  Identities=31%  Similarity=0.490  Sum_probs=14.6

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      -++|+||++.||++..
T Consensus       130 ~i~H~dl~~~nil~~~  145 (295)
T cd07837         130 GVMHRDLKPQNLLVDK  145 (295)
T ss_pred             CeeecCCChHHEEEec
Confidence            4799999999999986


No 321
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=93.79  E-value=0.051  Score=39.07  Aligned_cols=28  Identities=25%  Similarity=0.284  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+|+++.||++..+                      +.+.|+||..+
T Consensus       123 ~i~h~~l~~~ni~~~~~----------------------~~~kl~d~g~~  150 (256)
T cd08530         123 KILHRDLKSANILLVAN----------------------DLVKIGDLGIS  150 (256)
T ss_pred             CcccCCCCcceEEEecC----------------------CcEEEeeccch
Confidence            47899999999999884                      66888888654


No 322
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=93.76  E-value=0.042  Score=45.63  Aligned_cols=28  Identities=25%  Similarity=0.381  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -++|+||+|.|||+...                      +.+.|+||-.+
T Consensus       163 ~IiHrDLKP~NILl~~~----------------------~~vkL~DFGls  190 (496)
T PTZ00283        163 HMIHRDIKSANILLCSN----------------------GLVKLGDFGFS  190 (496)
T ss_pred             CEecCCCCHHHEEEeCC----------------------CCEEEEecccC
Confidence            46899999999999874                      67889998654


No 323
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=93.75  E-value=0.051  Score=40.21  Aligned_cols=17  Identities=29%  Similarity=0.429  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       136 ~ivH~dlkp~nil~~~~  152 (277)
T cd05036         136 HFIHRDIAARNCLLTCK  152 (277)
T ss_pred             CEeecccchheEEEecc
Confidence            38999999999999863


No 324
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=93.74  E-value=0.041  Score=47.42  Aligned_cols=30  Identities=23%  Similarity=0.375  Sum_probs=25.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||++.|||+...                      +.++|+||-.+..
T Consensus       124 gIiHrDLKP~NILl~~~----------------------g~vkL~DFGls~~  153 (669)
T cd05610         124 GIIHRDLKPDNMLISNE----------------------GHIKLTDFGLSKV  153 (669)
T ss_pred             CEEeCCccHHHEEEcCC----------------------CCEEEEeCCCCcc
Confidence            48999999999999764                      6799999988764


No 325
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=93.71  E-value=0.035  Score=40.21  Aligned_cols=29  Identities=31%  Similarity=0.477  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||.+.||++.+.                      +.+.|+||.++.
T Consensus       122 ~i~h~~l~p~ni~~~~~----------------------~~~~l~df~~~~  150 (267)
T cd06610         122 GQIHRDIKAGNILLGED----------------------GSVKIADFGVSA  150 (267)
T ss_pred             CeecCCCCHHhEEEcCC----------------------CCEEEcccchHH
Confidence            47999999999999874                      568888887553


No 326
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=93.70  E-value=0.027  Score=40.83  Aligned_cols=29  Identities=24%  Similarity=0.509  Sum_probs=23.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||.+.||++...                      +.+.|+||..+.
T Consensus       133 ~i~H~~l~p~ni~~~~~----------------------~~~~l~d~~~~~  161 (275)
T cd06608         133 KVIHRDIKGQNILLTKN----------------------AEVKLVDFGVSA  161 (275)
T ss_pred             CcccCCCCHHHEEEccC----------------------CeEEECCCccce
Confidence            47999999999999874                      568888886553


No 327
>KOG0658|consensus
Probab=93.70  E-value=0.038  Score=45.45  Aligned_cols=18  Identities=28%  Similarity=0.600  Sum_probs=16.2

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      .-+||+|++|-|||++.+
T Consensus       144 ~~IcHRDIKPqNlLvD~~  161 (364)
T KOG0658|consen  144 HGICHRDIKPQNLLVDPD  161 (364)
T ss_pred             cCcccCCCChheEEEcCC
Confidence            568999999999999885


No 328
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=93.69  E-value=0.039  Score=40.19  Aligned_cols=17  Identities=24%  Similarity=0.503  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.||++...
T Consensus       117 ~i~H~dl~p~nil~~~~  133 (260)
T cd05611         117 GIIHRDIKPENLLIDQT  133 (260)
T ss_pred             CeecCCCCHHHeEECCC
Confidence            47999999999999774


No 329
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=93.68  E-value=0.051  Score=42.92  Aligned_cols=17  Identities=35%  Similarity=0.487  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       234 ~ivH~Dlkp~Nill~~~  250 (375)
T cd05104         234 NCIHRDLAARNILLTHG  250 (375)
T ss_pred             CeeccCCchhhEEEECC
Confidence            37899999999999864


No 330
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=93.66  E-value=0.032  Score=40.42  Aligned_cols=17  Identities=24%  Similarity=0.511  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+.|+||.++||++...
T Consensus       119 ~i~H~dl~~~nil~~~~  135 (264)
T cd06626         119 GIVHRDIKPANIFLDHN  135 (264)
T ss_pred             CcccCCCCHHHEEECCC
Confidence            36899999999999874


No 331
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=93.65  E-value=0.036  Score=41.22  Aligned_cols=17  Identities=35%  Similarity=0.532  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+.++
T Consensus       142 ~i~H~dlkp~nil~~~~  158 (280)
T cd05092         142 HFVHRDLATRNCLVGQG  158 (280)
T ss_pred             CeecccccHhhEEEcCC
Confidence            47899999999999864


No 332
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=93.65  E-value=0.033  Score=42.25  Aligned_cols=29  Identities=34%  Similarity=0.439  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+||.+.|||+..+                      +.+.++||.++.
T Consensus       135 ~i~H~dl~p~nil~~~~----------------------~~~kl~dfg~~~  163 (308)
T cd06634         135 NMIHRDVKAGNILLSEP----------------------GLVKLGDFGSAS  163 (308)
T ss_pred             CcccCCCCHHhEEECCC----------------------CcEEECCcccce
Confidence            47999999999999764                      568888887654


No 333
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=93.65  E-value=0.036  Score=40.71  Aligned_cols=17  Identities=29%  Similarity=0.518  Sum_probs=14.7

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++..+
T Consensus       126 ~i~H~~l~p~nil~~~~  142 (266)
T cd06651         126 MIVHRDIKGANILRDSA  142 (266)
T ss_pred             CeeeCCCCHHHEEECCC
Confidence            47999999999998764


No 334
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=93.63  E-value=0.049  Score=40.03  Aligned_cols=17  Identities=35%  Similarity=0.573  Sum_probs=15.2

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++.+.
T Consensus       119 ~i~H~dl~~~ni~i~~~  135 (283)
T cd07830         119 GFFHRDLKPENLLVSGP  135 (283)
T ss_pred             CcccCCCChhhEEEcCC
Confidence            47999999999999874


No 335
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=93.62  E-value=0.035  Score=42.90  Aligned_cols=29  Identities=31%  Similarity=0.531  Sum_probs=24.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .++|+|+++.||++..+                      +.+.|+||..+.
T Consensus       138 gi~H~dlkp~Nill~~~----------------------~~~kL~dfg~~~  166 (343)
T cd07851         138 GIIHRDLKPSNIAVNED----------------------CELKILDFGLAR  166 (343)
T ss_pred             CeecCCCCHHHeEECCC----------------------CCEEEccccccc
Confidence            47899999999999874                      678899987664


No 336
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=93.60  E-value=0.031  Score=41.74  Aligned_cols=16  Identities=38%  Similarity=0.414  Sum_probs=14.5

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||++.|||+..
T Consensus       128 ~i~h~dlkp~Nil~~~  143 (316)
T cd07842         128 WVLHRDLKPANILVMG  143 (316)
T ss_pred             CEeeCCCCHHHEEEcC
Confidence            3789999999999987


No 337
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=93.57  E-value=0.042  Score=40.03  Aligned_cols=18  Identities=28%  Similarity=0.377  Sum_probs=15.6

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+|++|.||++..+
T Consensus       104 ~~i~H~dlkp~Nil~~~~  121 (237)
T cd05576         104 EGIVCRDLNPNNILLDDR  121 (237)
T ss_pred             CCeeccCCCHHHEEEcCC
Confidence            358999999999999874


No 338
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=93.56  E-value=0.037  Score=41.30  Aligned_cols=17  Identities=29%  Similarity=0.503  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+|+++.|||+...
T Consensus       139 ~i~H~dikp~nili~~~  155 (288)
T cd05061         139 KFVHRDLAARNCMVAHD  155 (288)
T ss_pred             CCcCCCCChheEEEcCC
Confidence            47999999999999874


No 339
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=93.54  E-value=0.035  Score=41.29  Aligned_cols=17  Identities=29%  Similarity=0.550  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       139 ~i~H~dl~p~nil~~~~  155 (310)
T cd07865         139 KILHRDMKAANILITKD  155 (310)
T ss_pred             CeeccCCCHHHEEECCC
Confidence            47999999999999764


No 340
>KOG0610|consensus
Probab=93.52  E-value=0.058  Score=45.45  Aligned_cols=32  Identities=28%  Similarity=0.390  Sum_probs=27.3

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      +.+.=+||+|.|||++++                      +.++|.||+.+--.
T Consensus       198 lGivYRDLKPENILvred----------------------GHIMLsDFDLS~~~  229 (459)
T KOG0610|consen  198 LGIVYRDLKPENILVRED----------------------GHIMLSDFDLSLRC  229 (459)
T ss_pred             hceeeccCCcceeEEecC----------------------CcEEeeeccccccC
Confidence            456779999999999996                      89999999987643


No 341
>KOG1235|consensus
Probab=93.52  E-value=0.06  Score=46.24  Aligned_cols=33  Identities=33%  Similarity=0.633  Sum_probs=25.2

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      |-|+|.|||||++++.++.                  ..++++.|+--.+.
T Consensus       322 ffHaDPHPGNilv~~~~~~------------------~~~ivllDhGl~~~  354 (538)
T KOG1235|consen  322 FFHADPHPGNILVRPNPEG------------------DEEIVLLDHGLYAV  354 (538)
T ss_pred             CccCCCCCCcEEEecCCCC------------------CccEEEEccccccc
Confidence            8899999999999975422                  16789999864443


No 342
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=93.52  E-value=0.044  Score=40.42  Aligned_cols=17  Identities=29%  Similarity=0.466  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++..+
T Consensus       120 ~i~H~~l~p~nill~~~  136 (284)
T cd07860         120 RVLHRDLKPQNLLINTE  136 (284)
T ss_pred             CeecCCCCHHHEEECCC
Confidence            47899999999999874


No 343
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=93.51  E-value=0.063  Score=40.49  Aligned_cols=29  Identities=34%  Similarity=0.477  Sum_probs=22.9

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -++|+||+++||++..+                      +.+.+.||..+.
T Consensus       135 ~i~H~dl~p~nIl~~~~----------------------~~~kL~dfg~~~  163 (307)
T cd06607         135 ERIHRDIKAGNILLTEP----------------------GTVKLADFGSAS  163 (307)
T ss_pred             CceecCCCcccEEECCC----------------------CCEEEeecCcce
Confidence            36899999999999874                      567778876553


No 344
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=93.49  E-value=0.036  Score=41.23  Aligned_cols=17  Identities=35%  Similarity=0.624  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++.+.
T Consensus       136 ~i~H~dl~p~nili~~~  152 (302)
T cd07864         136 NFLHRDIKCSNILLNNK  152 (302)
T ss_pred             CeecCCCCHHHEEECCC
Confidence            47999999999999874


No 345
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=93.48  E-value=0.035  Score=40.72  Aligned_cols=17  Identities=29%  Similarity=0.518  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++...
T Consensus       126 ~i~H~dl~p~ni~i~~~  142 (264)
T cd06653         126 MIVHRDIKGANILRDSA  142 (264)
T ss_pred             CEecCCCCHHHEEEcCC
Confidence            47999999999999764


No 346
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=93.46  E-value=0.034  Score=40.89  Aligned_cols=18  Identities=33%  Similarity=0.556  Sum_probs=15.6

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..+.|+||.+.||++..+
T Consensus       120 ~~i~H~dl~p~ni~i~~~  137 (277)
T cd06917         120 VGVIHRDIKAANILVTNT  137 (277)
T ss_pred             CCcccCCcCHHHEEEcCC
Confidence            357999999999999874


No 347
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=93.45  E-value=0.034  Score=40.57  Aligned_cols=17  Identities=29%  Similarity=0.495  Sum_probs=14.7

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+|+++.||++.+.
T Consensus       126 ~ivH~di~p~nil~~~~  142 (267)
T cd06628         126 GIIHRDIKGANILVDNK  142 (267)
T ss_pred             CcccccCCHHHEEEcCC
Confidence            37899999999999764


No 348
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=93.41  E-value=0.054  Score=41.98  Aligned_cols=17  Identities=29%  Similarity=0.491  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++..+
T Consensus       140 ~ivH~dlkp~NIll~~~  156 (345)
T cd07877         140 DIIHRDLKPSNLAVNED  156 (345)
T ss_pred             CeeecCCChHHEEEcCC
Confidence            47999999999999874


No 349
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=93.41  E-value=0.037  Score=42.70  Aligned_cols=17  Identities=41%  Similarity=0.614  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+...
T Consensus       128 ~iiH~dl~p~Nili~~~  144 (328)
T cd07856         128 GVVHRDLKPSNILINEN  144 (328)
T ss_pred             CcccCCCCHHHEeECCC
Confidence            47899999999999764


No 350
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=93.36  E-value=0.065  Score=39.57  Aligned_cols=17  Identities=29%  Similarity=0.505  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.||++..+
T Consensus       121 ~ivH~dl~p~ni~i~~~  137 (277)
T cd06642         121 RKIHRDIKAANVLLSEQ  137 (277)
T ss_pred             CeeccCCChheEEEeCC
Confidence            47899999999999874


No 351
>KOG0983|consensus
Probab=93.34  E-value=0.033  Score=45.37  Aligned_cols=37  Identities=27%  Similarity=0.386  Sum_probs=30.2

Q ss_pred             cccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665          3 LLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus         3 l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      |...+..-.+.|+|++|.|||++++                      +.+.|-||--+|
T Consensus       204 L~YLKeKH~viHRDvKPSNILlDe~----------------------GniKlCDFGIsG  240 (391)
T KOG0983|consen  204 LYYLKEKHGVIHRDVKPSNILLDER----------------------GNIKLCDFGISG  240 (391)
T ss_pred             HHHHHHhcceeecccCccceEEccC----------------------CCEEeecccccc
Confidence            4445566678999999999999996                      889999997666


No 352
>KOG0608|consensus
Probab=93.32  E-value=0.053  Score=48.45  Aligned_cols=32  Identities=28%  Similarity=0.566  Sum_probs=28.2

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ....|.|+|+++.|||++.+                      +.+.|-||-.|.
T Consensus       746 HkmGFIHRDiKPDNILIDrd----------------------GHIKLTDFGLCT  777 (1034)
T KOG0608|consen  746 HKMGFIHRDIKPDNILIDRD----------------------GHIKLTDFGLCT  777 (1034)
T ss_pred             HhccceecccCccceEEccC----------------------Cceeeeeccccc
Confidence            45789999999999999885                      889999998775


No 353
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=93.32  E-value=0.054  Score=39.70  Aligned_cols=16  Identities=25%  Similarity=0.534  Sum_probs=14.3

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||++.||++..
T Consensus       128 ~i~h~dl~p~nil~~~  143 (268)
T cd06624         128 QIVHRDIKGDNVLVNT  143 (268)
T ss_pred             CEeecCCCHHHEEEcC
Confidence            4799999999999965


No 354
>KOG1006|consensus
Probab=93.30  E-value=0.016  Score=46.88  Aligned_cols=38  Identities=29%  Similarity=0.463  Sum_probs=32.2

Q ss_pred             cccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665          3 LLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus         3 l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      |++.+..+-+.|+|++|.|||++..                      +.+.|-||--||.
T Consensus       180 L~yLK~~lkiIHRDvKPSNILldr~----------------------G~vKLCDFGIcGq  217 (361)
T KOG1006|consen  180 LDYLKEELKIIHRDVKPSNILLDRH----------------------GDVKLCDFGICGQ  217 (361)
T ss_pred             HHHHHHHhhhhhccCChhheEEecC----------------------CCEeeecccchHh
Confidence            5566777889999999999999885                      8899999987773


No 355
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=93.28  E-value=0.057  Score=39.64  Aligned_cols=17  Identities=35%  Similarity=0.518  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+..+
T Consensus       137 ~i~H~dlkp~Nili~~~  153 (275)
T cd05046         137 RFVHRDLAARNCLVSSQ  153 (275)
T ss_pred             CcccCcCccceEEEeCC
Confidence            37999999999999774


No 356
>PRK09902 hypothetical protein; Provisional
Probab=93.27  E-value=0.048  Score=41.87  Aligned_cols=44  Identities=14%  Similarity=0.060  Sum_probs=31.1

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc-----hhhhHHHHH
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY-----RAFDIANHF   73 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~-----r~fDlanhf   73 (107)
                      ..++|+||.+.||+++..  +                  .-++.|||||=+....     +.-||+-..
T Consensus       147 ~Gv~Hgdly~khIll~~~--g------------------~~~v~lIDlEk~r~~l~~~~~~~~Dl~~l~  195 (216)
T PRK09902        147 VNRQHGCCYVRHIYVKTE--G------------------KAEAGFLDLEKSRRRLRRDKAINHDFRQLE  195 (216)
T ss_pred             CCCcCCCCCHhheeecCC--C------------------CeeEEEEEhhccchhhhhhhhhHhHHHHHH
Confidence            357999999999999853  0                  0359999999776544     345665443


No 357
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=93.21  E-value=0.04  Score=40.32  Aligned_cols=17  Identities=29%  Similarity=0.513  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+.+.
T Consensus       120 ~~~h~dl~p~nil~~~~  136 (287)
T cd07840         120 GILHRDIKGSNILINND  136 (287)
T ss_pred             CceeccCcHHHeEEcCC
Confidence            47999999999999874


No 358
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=93.16  E-value=0.062  Score=45.54  Aligned_cols=28  Identities=25%  Similarity=0.413  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .++|+||++.|||+..+                      ..+.++||..|
T Consensus       329 ~ivHrDLKp~NILl~~~----------------------~~~kL~DFGla  356 (507)
T PLN03224        329 GIVHRDIKPENLLVTVD----------------------GQVKIIDFGAA  356 (507)
T ss_pred             CeecCCCchHhEEECCC----------------------CcEEEEeCcCc
Confidence            37899999999999874                      56888888765


No 359
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=93.10  E-value=0.066  Score=39.27  Aligned_cols=18  Identities=33%  Similarity=0.613  Sum_probs=15.2

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+|+++.||++...
T Consensus       125 ~g~~H~dl~p~nili~~~  142 (269)
T cd05065         125 MNYVHRDLAARNILVNSN  142 (269)
T ss_pred             CCEeecccChheEEEcCC
Confidence            357899999999999764


No 360
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=93.09  E-value=0.053  Score=40.00  Aligned_cols=17  Identities=24%  Similarity=0.360  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+|+++.|||+...
T Consensus       137 ~i~H~di~p~nil~~~~  153 (280)
T cd05043         137 GVIHKDIAARNCVIDEE  153 (280)
T ss_pred             CEeecccCHhhEEEcCC
Confidence            47899999999999774


No 361
>PTZ00284 protein kinase; Provisional
Probab=93.07  E-value=0.048  Score=44.31  Aligned_cols=18  Identities=39%  Similarity=0.595  Sum_probs=15.4

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+||++.|||+...
T Consensus       251 ~gIiHrDlKP~NILl~~~  268 (467)
T PTZ00284        251 LHLMHTDLKPENILMETS  268 (467)
T ss_pred             CCeecCCCCHHHEEEecC
Confidence            458999999999999763


No 362
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=93.04  E-value=0.047  Score=42.01  Aligned_cols=17  Identities=29%  Similarity=0.536  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       128 ~i~H~dlkp~Nil~~~~  144 (337)
T cd07858         128 NVLHRDLKPSNLLLNAN  144 (337)
T ss_pred             CEecCCCCHHHEEEcCC
Confidence            48999999999999764


No 363
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=93.04  E-value=0.052  Score=40.88  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.||++..+
T Consensus       135 gi~H~dL~p~Nili~~~  151 (293)
T cd06647         135 QVIHRDIKSDNILLGMD  151 (293)
T ss_pred             CEeeccCCHHHEEEcCC
Confidence            47999999999999874


No 364
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=93.03  E-value=0.038  Score=39.27  Aligned_cols=18  Identities=28%  Similarity=0.442  Sum_probs=15.6

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+|+.+.||++...
T Consensus       120 ~~~~h~dl~p~ni~i~~~  137 (260)
T cd06606         120 NGIVHRDIKGANILVDSD  137 (260)
T ss_pred             CCccccCCCHHHEEEcCC
Confidence            357999999999999874


No 365
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=93.03  E-value=0.069  Score=42.97  Aligned_cols=31  Identities=42%  Similarity=0.482  Sum_probs=26.2

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ...+.|+|+.+-|||+.++                      +.+++|||--|-
T Consensus       220 ~~GiVHGDlSefNIlV~~d----------------------g~~~vIDwPQ~v  250 (304)
T COG0478         220 RRGIVHGDLSEFNILVTED----------------------GDIVVIDWPQAV  250 (304)
T ss_pred             HcCccccCCchheEEEecC----------------------CCEEEEeCcccc
Confidence            3567899999999999985                      789999997554


No 366
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=93.03  E-value=0.049  Score=41.77  Aligned_cols=17  Identities=35%  Similarity=0.585  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+|+++.||++..+
T Consensus       127 ~ivH~dlkp~Nil~~~~  143 (334)
T cd07855         127 NVIHRDLKPSNLLVNED  143 (334)
T ss_pred             CeecCCCCHHHEEEcCC
Confidence            37999999999999874


No 367
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=92.96  E-value=0.07  Score=43.06  Aligned_cols=16  Identities=31%  Similarity=0.530  Sum_probs=14.6

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      ++|+||++.|||+...
T Consensus       258 ivH~dikp~Nill~~~  273 (400)
T cd05105         258 CVHRDLAARNVLLAQG  273 (400)
T ss_pred             eeCCCCChHhEEEeCC
Confidence            7999999999999874


No 368
>COG3281 Ble Uncharacterized protein, probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]
Probab=92.92  E-value=0.059  Score=44.85  Aligned_cols=42  Identities=26%  Similarity=0.259  Sum_probs=31.4

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC---------CchhhhHHHHHHHh
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY---------NYRAFDIANHFVES   76 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~---------n~r~fDlanhf~E~   76 (107)
                      =.|+|||.|.+|+.+                       +..+|||||==.-         --+--|+|-.+...
T Consensus       286 RvHGDLHLgQVLvt~-----------------------g~~~liDFEGEPsRpl~err~~~sPlrDvAgllRS~  336 (438)
T COG3281         286 RVHGDLHLGQVLVTP-----------------------GRALLIDFEGEPSRPLDERRAPDSPLRDVAGLLRSF  336 (438)
T ss_pred             HHhccceehheeeeC-----------------------CcEEEEecCCCCCCChhhccCCCCchHHHHHHHHHh
Confidence            369999999999998                       7899999994322         22456777766654


No 369
>KOG0581|consensus
Probab=92.88  E-value=0.028  Score=46.25  Aligned_cols=43  Identities=26%  Similarity=0.385  Sum_probs=33.0

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHH
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVE   75 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E   75 (107)
                      ..-+.|+|++|.|||++.+                      +++.+=||--++.--..  +||.|.-
T Consensus       197 ~~~IIHRDIKPsNlLvNsk----------------------GeVKicDFGVS~~lvnS--~a~tfvG  239 (364)
T KOG0581|consen  197 ERKIIHRDIKPSNLLVNSK----------------------GEVKICDFGVSGILVNS--IANTFVG  239 (364)
T ss_pred             ccCeeeccCCHHHeeeccC----------------------CCEEeccccccHHhhhh--hcccccc
Confidence            3568899999999999985                      88999999877754444  5555543


No 370
>PLN00181 protein SPA1-RELATED; Provisional
Probab=92.79  E-value=0.089  Score=45.88  Aligned_cols=18  Identities=0%  Similarity=0.021  Sum_probs=15.3

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..++|+||+|.|||+...
T Consensus        99 ~gIvHrDlKP~NiLl~~~  116 (793)
T PLN00181         99 QGIVVHNVRPSCFVMSSF  116 (793)
T ss_pred             CCeeeccCCchhEEEccc
Confidence            358999999999999763


No 371
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=92.68  E-value=0.054  Score=39.83  Aligned_cols=17  Identities=35%  Similarity=0.505  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++..+
T Consensus       118 ~i~h~dl~p~ni~i~~~  134 (274)
T cd06609         118 GKIHRDIKAANILLSEE  134 (274)
T ss_pred             CcccCCCCHHHEEECCC
Confidence            37999999999999874


No 372
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=92.67  E-value=0.096  Score=38.99  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=14.3

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      -++|+||++.||++..
T Consensus       122 ~i~H~dl~p~nill~~  137 (294)
T PLN00009        122 RVLHRDLKPQNLLIDR  137 (294)
T ss_pred             CeeCCCCCcceEEEEC
Confidence            4799999999999975


No 373
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=92.61  E-value=0.078  Score=48.21  Aligned_cols=30  Identities=27%  Similarity=0.414  Sum_probs=25.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      .++|+||+|.|||+...                      +.+.++||..|..
T Consensus       133 GIIHRDLKPeNILLd~d----------------------g~vKLiDFGLAk~  162 (932)
T PRK13184        133 GVLHRDLKPDNILLGLF----------------------GEVVILDWGAAIF  162 (932)
T ss_pred             CccccCCchheEEEcCC----------------------CCEEEEecCccee
Confidence            47999999999999874                      6788999987653


No 374
>KOG1163|consensus
Probab=92.60  E-value=0.089  Score=42.28  Aligned_cols=33  Identities=27%  Similarity=0.414  Sum_probs=25.6

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -.|.|+|++|.|+|+.-..-                   ..+|.+|||-.|-
T Consensus       130 r~fiHRDIKPdNFLMGlgrh-------------------~~kl~LIDFGLaK  162 (341)
T KOG1163|consen  130 RNFIHRDIKPDNFLMGLGRH-------------------CNKLYLIDFGLAK  162 (341)
T ss_pred             hccccccCCccceeeccccc-------------------cceEEEEeccchh
Confidence            46899999999999865321                   2689999996554


No 375
>KOG3087|consensus
Probab=92.47  E-value=0.15  Score=39.50  Aligned_cols=34  Identities=38%  Similarity=0.579  Sum_probs=26.1

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      -+||+||...|||+.++...                   -..++|||--+..+
T Consensus       133 diiHGDLTTSNill~~~~~~-------------------~~~~lIdfgls~~s  166 (229)
T KOG3087|consen  133 DIIHGDLTTSNILLRSDGNQ-------------------ITPILIDFGLSSVS  166 (229)
T ss_pred             CeecccccccceEEecCCCc-------------------CceEEEeecchhcc
Confidence            37999999999999885211                   34599999877655


No 376
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=92.43  E-value=0.058  Score=41.21  Aligned_cols=17  Identities=35%  Similarity=0.571  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+++||++...
T Consensus       139 ~i~H~dl~~~nill~~~  155 (335)
T PTZ00024        139 YFMHRDLSPANIFINSK  155 (335)
T ss_pred             CeecccccHHHeEECCC
Confidence            48999999999999764


No 377
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=92.37  E-value=0.083  Score=38.70  Aligned_cols=16  Identities=31%  Similarity=0.617  Sum_probs=14.4

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||++.||++..
T Consensus       120 ~i~H~dl~p~ni~l~~  135 (282)
T cd07831         120 GIFHRDIKPENILIKD  135 (282)
T ss_pred             CceecccCHHHEEEcC
Confidence            4799999999999987


No 378
>KOG0588|consensus
Probab=92.35  E-value=0.062  Score=47.65  Aligned_cols=34  Identities=26%  Similarity=0.510  Sum_probs=27.6

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      .-+||+||++.|+|+...                      ..+.+=||-.|..-..
T Consensus       131 ~~icHRDLKpENlLLd~~----------------------~nIKIADFGMAsLe~~  164 (786)
T KOG0588|consen  131 FNICHRDLKPENLLLDVK----------------------NNIKIADFGMASLEVP  164 (786)
T ss_pred             hcceeccCCchhhhhhcc----------------------cCEeeeccceeecccC
Confidence            458999999999999885                      5699999977765444


No 379
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=92.18  E-value=0.1  Score=38.54  Aligned_cols=17  Identities=24%  Similarity=0.405  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+...
T Consensus       125 ~ivH~dlkp~Nill~~~  141 (262)
T cd05077         125 DLVHGNVCTKNILLARE  141 (262)
T ss_pred             CeECCCCCcccEEEecC
Confidence            47999999999999753


No 380
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=92.16  E-value=0.1  Score=42.18  Aligned_cols=17  Identities=35%  Similarity=0.501  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       259 ~ivHrdlkp~NiLl~~~  275 (401)
T cd05107         259 NCVHRDLAARNVLICEG  275 (401)
T ss_pred             CcCcccCCcceEEEeCC
Confidence            36999999999999874


No 381
>KOG0599|consensus
Probab=92.08  E-value=0.073  Score=43.48  Aligned_cols=39  Identities=21%  Similarity=0.386  Sum_probs=33.0

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHH
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANH   72 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanh   72 (107)
                      +.|+||++.|||+.+.                      -.+++=||-+|.--.+|=-|-+.
T Consensus       144 IVHRDLKpENILlddn----------------------~~i~isDFGFa~~l~~GekLrel  182 (411)
T KOG0599|consen  144 IVHRDLKPENILLDDN----------------------MNIKISDFGFACQLEPGEKLREL  182 (411)
T ss_pred             hhhcccChhheeeccc----------------------cceEEeccceeeccCCchhHHHh
Confidence            5799999999999884                      67999999999988887766543


No 382
>KOG0596|consensus
Probab=92.07  E-value=0.11  Score=45.37  Aligned_cols=29  Identities=31%  Similarity=0.437  Sum_probs=24.9

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -.+.|.||+|.|+|+-.                       +.|.||||--|.
T Consensus       479 ~gIVHSDLKPANFLlVk-----------------------G~LKLIDFGIA~  507 (677)
T KOG0596|consen  479 HGIVHSDLKPANFLLVK-----------------------GRLKLIDFGIAN  507 (677)
T ss_pred             hceeecCCCcccEEEEe-----------------------eeEEeeeechhc
Confidence            35789999999999988                       789999996554


No 383
>KOG0592|consensus
Probab=92.02  E-value=0.1  Score=45.24  Aligned_cols=18  Identities=33%  Similarity=0.464  Sum_probs=16.0

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..+.|+||+|.|||++.+
T Consensus       193 ~GIIHRDlKPENILLd~d  210 (604)
T KOG0592|consen  193 NGIIHRDLKPENILLDKD  210 (604)
T ss_pred             cCceeccCChhheeEcCC
Confidence            467899999999999985


No 384
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=91.93  E-value=0.11  Score=37.96  Aligned_cols=16  Identities=38%  Similarity=0.559  Sum_probs=14.5

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      ++|+|+++.||++...
T Consensus       119 i~H~~l~~~ni~~~~~  134 (282)
T cd07829         119 ILHRDLKPQNILINRD  134 (282)
T ss_pred             cccCCCChheEEEcCC
Confidence            6899999999999874


No 385
>KOG0593|consensus
Probab=91.87  E-value=0.097  Score=43.05  Aligned_cols=28  Identities=25%  Similarity=0.421  Sum_probs=23.6

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      +.|+|++|.|||++..                      +.+.+-||-+|.
T Consensus       122 ~IHRDIKPENILit~~----------------------gvvKLCDFGFAR  149 (396)
T KOG0593|consen  122 CIHRDIKPENILITQN----------------------GVVKLCDFGFAR  149 (396)
T ss_pred             eecccCChhheEEecC----------------------CcEEeccchhhH
Confidence            5689999999999985                      778888887654


No 386
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=91.81  E-value=0.073  Score=38.36  Aligned_cols=17  Identities=24%  Similarity=0.507  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.||++.+.
T Consensus       121 ~i~H~dl~~~nil~~~~  137 (257)
T cd08225         121 KILHRDIKSQNIFLSKN  137 (257)
T ss_pred             CcccccCCHHHEEEcCC
Confidence            48999999999999763


No 387
>KOG1166|consensus
Probab=91.73  E-value=0.18  Score=46.16  Aligned_cols=36  Identities=25%  Similarity=0.435  Sum_probs=26.6

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      ..+.|+||+|.|+|++....+..               +...|.||||-+|
T Consensus       813 ~~IIHgDiKPDNfll~~~~~~~~---------------~~~~l~lIDfG~s  848 (974)
T KOG1166|consen  813 MGIIHGDIKPDNFLLRREICADS---------------DSKGLYLIDFGRS  848 (974)
T ss_pred             cceecccCCcceeEeecccCCCC---------------cccceEEEecccc
Confidence            45889999999999987643321               1278999999543


No 388
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=91.62  E-value=0.1  Score=37.97  Aligned_cols=16  Identities=25%  Similarity=0.495  Sum_probs=14.2

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||++.||++..
T Consensus       123 ~i~H~~i~~~nil~~~  138 (268)
T cd06630         123 QIIHRDVKGANLLIDS  138 (268)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            5799999999999965


No 389
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=91.51  E-value=0.098  Score=38.04  Aligned_cols=16  Identities=31%  Similarity=0.586  Sum_probs=14.4

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+||.+.||++..
T Consensus       126 ~i~h~~l~~~nili~~  141 (260)
T cd08222         126 RILHRDLKAKNIFLKN  141 (260)
T ss_pred             CccccCCChhheEeec
Confidence            5799999999999975


No 390
>KOG1164|consensus
Probab=91.39  E-value=0.11  Score=40.40  Aligned_cols=36  Identities=22%  Similarity=0.395  Sum_probs=26.6

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ...|.|+|++|+|+++......                 +...+.+|||-.|.
T Consensus       140 ~~G~iHRDiKp~N~~~g~~~~~-----------------~~~~~~llDfGlar  175 (322)
T KOG1164|consen  140 SKGFIHRDIKPENFVVGQSSRS-----------------EVRTLYLLDFGLAR  175 (322)
T ss_pred             hcCcccCCcCHHHeeecCCCCc-----------------ccceEEEEecCCCc
Confidence            4579999999999999874211                 11569999996554


No 391
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=91.32  E-value=0.1  Score=37.52  Aligned_cols=16  Identities=38%  Similarity=0.549  Sum_probs=14.4

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+|++++||++.+
T Consensus       121 ~i~h~dl~~~nil~~~  136 (256)
T cd08220         121 LILHRDLKTQNILLDK  136 (256)
T ss_pred             CeecCCCCHHHEEEcC
Confidence            5799999999999975


No 392
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=91.21  E-value=0.14  Score=37.78  Aligned_cols=17  Identities=18%  Similarity=0.415  Sum_probs=14.7

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+|+++.|||+..+
T Consensus       127 ~iiH~dikp~nili~~~  143 (266)
T cd05064         127 GYVHKGLAAHKVLVNSD  143 (266)
T ss_pred             CEeeccccHhhEEEcCC
Confidence            47899999999999764


No 393
>KOG1035|consensus
Probab=91.00  E-value=0.14  Score=48.02  Aligned_cols=30  Identities=23%  Similarity=0.332  Sum_probs=25.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ++.|+||+|.||+++.+                      ++|.+.||--|.-
T Consensus       717 giIHRDLKP~NIFLd~~----------------------~~VKIGDFGLAt~  746 (1351)
T KOG1035|consen  717 GIIHRDLKPRNIFLDSR----------------------NSVKIGDFGLATD  746 (1351)
T ss_pred             ceeeccCCcceeEEcCC----------------------CCeeecccccchh
Confidence            48999999999999975                      7789999866653


No 394
>KOG0660|consensus
Probab=90.88  E-value=0.12  Score=42.56  Aligned_cols=33  Identities=30%  Similarity=0.491  Sum_probs=26.7

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY   64 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   64 (107)
                      -...|+||+|+|||++.+                      -.+++-||-+|..-.
T Consensus       144 AnViHRDLKPsNll~n~~----------------------c~lKI~DFGLAR~~~  176 (359)
T KOG0660|consen  144 ANVIHRDLKPSNLLLNAD----------------------CDLKICDFGLARYLD  176 (359)
T ss_pred             ccccccccchhheeeccC----------------------CCEEeccccceeecc
Confidence            456799999999999985                      668888888777653


No 395
>KOG0668|consensus
Probab=90.86  E-value=0.11  Score=41.56  Aligned_cols=37  Identities=16%  Similarity=0.292  Sum_probs=27.2

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhh
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFD   68 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fD   68 (107)
                      .+.|+|++|.|+|++..                     .++|.+|||-.|-+..++-+
T Consensus       152 GImHRDVKPhNvmIdh~---------------------~rkLrlIDWGLAEFYHp~~e  188 (338)
T KOG0668|consen  152 GIMHRDVKPHNVMIDHE---------------------LRKLRLIDWGLAEFYHPGKE  188 (338)
T ss_pred             CcccccCCcceeeechh---------------------hceeeeeecchHhhcCCCce
Confidence            46799999999999874                     16788888876665554433


No 396
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=90.84  E-value=0.13  Score=37.99  Aligned_cols=17  Identities=41%  Similarity=0.618  Sum_probs=14.7

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.||++...
T Consensus       123 ~i~h~dl~p~nili~~~  139 (280)
T cd06611         123 KVIHRDLKAGNILLTLD  139 (280)
T ss_pred             CcccCCCChhhEEECCC
Confidence            46899999999999764


No 397
>KOG0616|consensus
Probab=90.57  E-value=0.18  Score=41.15  Aligned_cols=29  Identities=21%  Similarity=0.414  Sum_probs=24.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -+..+||+|.|||++..                      +-+.++||-+|-
T Consensus       164 ~iiYRDLKPENiLlD~~----------------------G~iKitDFGFAK  192 (355)
T KOG0616|consen  164 DIIYRDLKPENLLLDQN----------------------GHIKITDFGFAK  192 (355)
T ss_pred             CeeeccCChHHeeeccC----------------------CcEEEEeccceE
Confidence            36789999999999985                      889999997764


No 398
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=90.48  E-value=0.14  Score=38.03  Aligned_cols=17  Identities=29%  Similarity=0.512  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.||++.++
T Consensus       124 ~i~H~dl~p~nil~~~~  140 (284)
T cd06620         124 RIMHRDIKPSNILVNSR  140 (284)
T ss_pred             CeeccCCCHHHEEECCC
Confidence            48999999999999774


No 399
>PRK14705 glycogen branching enzyme; Provisional
Probab=90.42  E-value=0.21  Score=46.75  Aligned_cols=35  Identities=26%  Similarity=0.360  Sum_probs=25.6

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeec
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEY   59 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY   59 (107)
                      .+..=||+|+|.|.+|+..+-.++                 ....+|||||=
T Consensus       329 ~~~~RIHGD~HLGQVL~t~~D~~~-----------------~~~~~IIDFEG  363 (1224)
T PRK14705        329 GQLQRIHGDLHLGQILQVPGAEGQ-----------------PERWAILDFEG  363 (1224)
T ss_pred             cceEEEecccccccEEEecCCCCc-----------------cCCEEEEecCC
Confidence            356779999999999987531000                 15699999984


No 400
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=90.13  E-value=0.13  Score=43.36  Aligned_cols=45  Identities=27%  Similarity=0.349  Sum_probs=37.2

Q ss_pred             ccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHH
Q psy15665          4 LKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIAN   71 (107)
Q Consensus         4 ~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlan   71 (107)
                      .-.....-|-|++|.-+|||+++                       +.+.+|||-.|..++.+=+|.+
T Consensus       335 ~~lekkf~fehrnlt~~niLId~-----------------------GnvtLIDfklsRl~~~q~~isy  379 (488)
T COG5072         335 DILEKKFPFEHRNLTLDNILIDE-----------------------GNVTLIDFKLSRLSYSQGIISY  379 (488)
T ss_pred             hhhhhcCCcccccccccceeeec-----------------------CceEEEEeeeeecccCCceeec
Confidence            33445677899999999999996                       8899999999998888766654


No 401
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=89.86  E-value=0.25  Score=36.15  Aligned_cols=17  Identities=18%  Similarity=0.323  Sum_probs=15.2

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+..+
T Consensus       120 ~iiH~dlkp~nili~~~  136 (258)
T cd05078         120 GLTHGNVCAKNVLLIRE  136 (258)
T ss_pred             CeecCCCccceEEEecc
Confidence            47999999999999874


No 402
>KOG0659|consensus
Probab=89.70  E-value=0.21  Score=40.27  Aligned_cols=29  Identities=28%  Similarity=0.502  Sum_probs=24.1

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      +-|+||+|.|+|+..+                      +.|.+=||--|..
T Consensus       122 IlHRDlKPnNLLis~~----------------------g~lKiADFGLAr~  150 (318)
T KOG0659|consen  122 ILHRDLKPNNLLISSD----------------------GQLKIADFGLARF  150 (318)
T ss_pred             hhcccCCccceEEcCC----------------------CcEEeecccchhc
Confidence            5699999999999985                      7888888876643


No 403
>KOG0615|consensus
Probab=89.61  E-value=0.19  Score=42.45  Aligned_cols=18  Identities=28%  Similarity=0.451  Sum_probs=16.0

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..+||+||+|.|||+..+
T Consensus       295 ~GI~HRDiKPeNILl~~~  312 (475)
T KOG0615|consen  295 QGIIHRDIKPENILLSND  312 (475)
T ss_pred             cCcccccCCcceEEeccC
Confidence            468999999999999875


No 404
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=89.57  E-value=0.13  Score=39.66  Aligned_cols=16  Identities=25%  Similarity=0.501  Sum_probs=14.3

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .++|+|+++.||++..
T Consensus       134 givH~dikp~Nili~~  149 (342)
T cd07854         134 NVLHRDLKPANVFINT  149 (342)
T ss_pred             CcccCCCCHHHEEEcC
Confidence            4899999999999974


No 405
>KOG0032|consensus
Probab=89.45  E-value=0.22  Score=40.73  Aligned_cols=38  Identities=21%  Similarity=0.358  Sum_probs=29.4

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      ..++|+||+|.|||+.......                  ..+.++||--|.+..+
T Consensus       154 ~gvvHrDlKpEN~L~~~~~~~~------------------~~ik~~DFGla~~~~~  191 (382)
T KOG0032|consen  154 LGVVHRDLKPENLLLASKDEGS------------------GRIKLIDFGLAKFIKP  191 (382)
T ss_pred             CCceeccCCHHHeeeccccCCC------------------CcEEEeeCCCceEccC
Confidence            5689999999999998752221                  5799999987776554


No 406
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=89.26  E-value=0.29  Score=37.39  Aligned_cols=17  Identities=18%  Similarity=0.421  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+||++.|||+...
T Consensus       121 ~iiH~dlkp~Nil~~~~  137 (327)
T cd08227         121 GYVHRSVKASHILISVD  137 (327)
T ss_pred             CEecCCCChhhEEEecC
Confidence            47899999999999764


No 407
>KOG0595|consensus
Probab=89.24  E-value=0.38  Score=40.39  Aligned_cols=41  Identities=24%  Similarity=0.400  Sum_probs=29.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhh
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAF   67 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~f   67 (107)
                      -+.|+||+|.|||+.......+                ...+.|=||-+|.+-..+-
T Consensus       129 ~IiHRDLKPQNiLLs~~~~~~~----------------~~~LKIADFGfAR~L~~~~  169 (429)
T KOG0595|consen  129 NIIHRDLKPQNILLSTTARNDT----------------SPVLKIADFGFARFLQPGS  169 (429)
T ss_pred             CeeeccCCcceEEeccCCCCCC----------------CceEEecccchhhhCCchh
Confidence            4789999999999988522211                0468899999888765443


No 408
>KOG0598|consensus
Probab=89.14  E-value=0.15  Score=41.99  Aligned_cols=18  Identities=33%  Similarity=0.361  Sum_probs=15.7

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      .-+.|+||+|.|||++.+
T Consensus       144 ~gIiyRDlKPENILLd~~  161 (357)
T KOG0598|consen  144 KGIIYRDLKPENILLDEQ  161 (357)
T ss_pred             CCeeeccCCHHHeeecCC
Confidence            347899999999999986


No 409
>PHA02988 hypothetical protein; Provisional
Probab=89.13  E-value=0.21  Score=37.57  Aligned_cols=15  Identities=20%  Similarity=0.173  Sum_probs=13.4

Q ss_pred             EecccCCCceeeecC
Q psy15665         13 CHNDLQEGNILYRES   27 (107)
Q Consensus        13 cHnDl~~gNiL~~~~   27 (107)
                      .|+||++.|||+..+
T Consensus       145 ~Hrdlkp~nill~~~  159 (283)
T PHA02988        145 PYKNLTSVSFLVTEN  159 (283)
T ss_pred             CCCcCChhhEEECCC
Confidence            399999999999874


No 410
>COG2187 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=88.92  E-value=0.28  Score=39.91  Aligned_cols=20  Identities=30%  Similarity=0.471  Sum_probs=17.5

Q ss_pred             CCCeEEEecccCCCceeeec
Q psy15665          7 KSPVTFCHNDLQEGNILYRE   26 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~   26 (107)
                      ..-+.=||+||+.+||.+-+
T Consensus       206 ~g~IRecHGDLhl~ni~l~d  225 (337)
T COG2187         206 EGFIRECHGDLHLRNICLWD  225 (337)
T ss_pred             cCCceecccchhhcceeeec
Confidence            34578899999999999988


No 411
>KOG0578|consensus
Probab=88.89  E-value=0.35  Score=41.77  Aligned_cols=31  Identities=26%  Similarity=0.503  Sum_probs=27.1

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ..+.|+|++..|||+..+                      +.+.+.||-+|+.
T Consensus       388 ~gIiHrDIKSDnILL~~~----------------------g~vKltDFGFcaq  418 (550)
T KOG0578|consen  388 RGIIHRDIKSDNILLTMD----------------------GSVKLTDFGFCAQ  418 (550)
T ss_pred             cceeeeccccceeEeccC----------------------CcEEEeeeeeeec
Confidence            357899999999999886                      7899999998864


No 412
>KOG0605|consensus
Probab=88.77  E-value=0.19  Score=43.35  Aligned_cols=32  Identities=19%  Similarity=0.401  Sum_probs=27.6

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      +...+.|+||+|.|+|++..                      +.|.|=||-.|.
T Consensus       258 H~~gyIHRDIKPdNlLiD~~----------------------GHiKLSDFGLs~  289 (550)
T KOG0605|consen  258 HQLGYIHRDIKPDNLLIDAK----------------------GHIKLSDFGLST  289 (550)
T ss_pred             HHcCcccccCChhheeecCC----------------------CCEeeccccccc
Confidence            34678999999999999985                      889999998773


No 413
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=88.70  E-value=0.25  Score=37.71  Aligned_cols=17  Identities=18%  Similarity=0.473  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||++.|||+..+
T Consensus       121 ~ivHrDlkp~Nill~~~  137 (328)
T cd08226         121 GYIHRNIKASHILISGD  137 (328)
T ss_pred             CeecCCCCHHHEEEeCC
Confidence            47999999999999864


No 414
>COG3231 Aph Aminoglycoside phosphotransferase [Translation, ribosomal structure and biogenesis]
Probab=88.68  E-value=0.52  Score=37.30  Aligned_cols=44  Identities=18%  Similarity=0.025  Sum_probs=37.6

Q ss_pred             CCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHH
Q psy15665          8 SPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHF   73 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf   73 (107)
                      ..+|+||+|--.-|+|+.+.                      +---+||+.-+|...|--||+--.
T Consensus       183 edLVv~HGDACLPN~i~d~~----------------------rf~GfIDlGrlGVaDRh~DLala~  226 (266)
T COG3231         183 EDLVVTHGDACLPNFILDGW----------------------RFSGFIDLGRLGVADRHQDLALAT  226 (266)
T ss_pred             hhceeecCcccCcceEecCC----------------------ceEEeeecCcccchHHHHhHHHHH
Confidence            45899999999999999874                      445699999999999999997543


No 415
>KOG0198|consensus
Probab=88.68  E-value=0.33  Score=39.03  Aligned_cols=16  Identities=31%  Similarity=0.503  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeec
Q psy15665         11 TFCHNDLQEGNILYRE   26 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~   26 (107)
                      .+.|+||++.|||+..
T Consensus       137 g~vH~DiK~~NiLl~~  152 (313)
T KOG0198|consen  137 GIVHCDIKPANILLDP  152 (313)
T ss_pred             CEeccCcccceEEEeC
Confidence            5889999999999988


No 416
>KOG0665|consensus
Probab=88.54  E-value=0.27  Score=40.49  Aligned_cols=32  Identities=25%  Similarity=0.434  Sum_probs=26.0

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ...+.|+||+|.||++..+                      .-+.+.||-||--
T Consensus       136 s~~IihRdLkPsnivv~~~----------------------~~lKi~dfg~ar~  167 (369)
T KOG0665|consen  136 SAGIIHRDLKPSNIVVNSD----------------------CTLKILDFGLART  167 (369)
T ss_pred             hcceeecccCcccceecch----------------------hheeeccchhhcc
Confidence            4568999999999999985                      5688888877753


No 417
>KOG0582|consensus
Probab=88.52  E-value=0.31  Score=41.60  Aligned_cols=17  Identities=35%  Similarity=0.591  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .-.|+|++.||||+..+
T Consensus       146 G~IHRdvKAgnILi~~d  162 (516)
T KOG0582|consen  146 GHIHRDVKAGNILIDSD  162 (516)
T ss_pred             CceecccccccEEEcCC
Confidence            35799999999999986


No 418
>KOG1187|consensus
Probab=87.78  E-value=0.34  Score=39.12  Aligned_cols=19  Identities=32%  Similarity=0.455  Sum_probs=16.4

Q ss_pred             eEEEecccCCCceeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESP   28 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~   28 (107)
                      ..+.|+|+++.|||++.+.
T Consensus       196 ~~iiHrDiKssNILLD~~~  214 (361)
T KOG1187|consen  196 PPIIHRDIKSSNILLDEDF  214 (361)
T ss_pred             CCEecCCCCHHHeeECCCC
Confidence            3688999999999999763


No 419
>KOG0579|consensus
Probab=87.73  E-value=0.32  Score=43.86  Aligned_cols=17  Identities=41%  Similarity=0.643  Sum_probs=14.9

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+.|+||+.||||+.-+
T Consensus       150 ~iIHRDLKAGNiL~Tld  166 (1187)
T KOG0579|consen  150 NIIHRDLKAGNILLTLD  166 (1187)
T ss_pred             chhhhhccccceEEEec
Confidence            36799999999999875


No 420
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]
Probab=87.55  E-value=0.36  Score=38.34  Aligned_cols=27  Identities=33%  Similarity=0.439  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -+.|+||.+=|||+.+                       +.+++|||--|
T Consensus       187 ~LVHgDLSEyNiL~~~-----------------------~~p~iID~~Qa  213 (268)
T COG1718         187 GLVHGDLSEYNILVHD-----------------------GEPYIIDVSQA  213 (268)
T ss_pred             CcccccchhhheEEEC-----------------------CeEEEEECccc
Confidence            4789999999999996                       77999999644


No 421
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=87.35  E-value=0.47  Score=35.31  Aligned_cols=17  Identities=24%  Similarity=0.372  Sum_probs=14.6

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -++|+||++.|||+...
T Consensus       137 ~iiH~dlkp~Nill~~~  153 (274)
T cd05076         137 NLVHGNVCAKNILLARL  153 (274)
T ss_pred             CccCCCCCcccEEEecc
Confidence            46899999999999753


No 422
>KOG1167|consensus
Probab=87.01  E-value=0.38  Score=40.32  Aligned_cols=32  Identities=25%  Similarity=0.434  Sum_probs=25.6

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ..+.|+|++|+|+|+....                     ++-+||||--|-.
T Consensus       151 ~GIvHRDiKpsNFL~n~~t---------------------~rg~LvDFgLA~~  182 (418)
T KOG1167|consen  151 NGIVHRDIKPSNFLYNRRT---------------------QRGVLVDFGLAQR  182 (418)
T ss_pred             cCccccCCCcccccccccc---------------------CCceEEechhHHH
Confidence            4578999999999998741                     5678999977663


No 423
>KOG0586|consensus
Probab=86.48  E-value=0.35  Score=42.13  Aligned_cols=31  Identities=29%  Similarity=0.670  Sum_probs=26.1

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      -.+||+||+..|||+...                      -.+.+=||+++..
T Consensus       174 k~ivHrdLk~eNilL~~~----------------------mnikIaDfgfS~~  204 (596)
T KOG0586|consen  174 KNIVHRDLKAENILLDEN----------------------MNIKIADFGFSTF  204 (596)
T ss_pred             cceeccccchhhcccccc----------------------cceeeecccccee
Confidence            358999999999999984                      4588999988764


No 424
>KOG0604|consensus
Probab=86.28  E-value=0.37  Score=39.73  Aligned_cols=36  Identities=28%  Similarity=0.512  Sum_probs=26.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      -+.|+||++.|+|+.....+                   -.+.|=||-+|.--.+
T Consensus       181 nIAHRDlKpENLLyt~t~~n-------------------a~lKLtDfGFAK~t~~  216 (400)
T KOG0604|consen  181 NIAHRDLKPENLLYTTTSPN-------------------APLKLTDFGFAKETQE  216 (400)
T ss_pred             chhhccCChhheeeecCCCC-------------------cceEecccccccccCC
Confidence            46899999999999875322                   4588888877765443


No 425
>KOG0577|consensus
Probab=86.25  E-value=0.32  Score=43.37  Aligned_cols=33  Identities=30%  Similarity=0.325  Sum_probs=26.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      ...|+|++.||||+.+.                      +.|.|-||--|+.--+
T Consensus       146 ~~IHRDiKAGNILLse~----------------------g~VKLaDFGSAsi~~P  178 (948)
T KOG0577|consen  146 NRIHRDIKAGNILLSEP----------------------GLVKLADFGSASIMAP  178 (948)
T ss_pred             hHHhhhccccceEecCC----------------------CeeeeccccchhhcCc
Confidence            35799999999999985                      7788888877665433


No 426
>KOG2268|consensus
Probab=85.59  E-value=0.61  Score=39.14  Aligned_cols=27  Identities=37%  Similarity=0.583  Sum_probs=23.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeec
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEY   59 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY   59 (107)
                      .+.|+|...-|||+.++                      ..+++|||--
T Consensus       222 GlIHgDFNEFNimv~dd----------------------~~i~vIDFPQ  248 (465)
T KOG2268|consen  222 GLIHGDFNEFNIMVKDD----------------------DKIVVIDFPQ  248 (465)
T ss_pred             CceecccchheeEEecC----------------------CCEEEeechH
Confidence            47899999999999974                      7799999963


No 427
>KOG4236|consensus
Probab=85.47  E-value=0.61  Score=41.24  Aligned_cols=33  Identities=21%  Similarity=0.383  Sum_probs=26.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      -+.|+||+|.|||+...                   .+-.++.|-||-||..
T Consensus       684 nIvHCDLKPENVLLas~-------------------~~FPQvKlCDFGfARi  716 (888)
T KOG4236|consen  684 NIVHCDLKPENVLLASA-------------------SPFPQVKLCDFGFARI  716 (888)
T ss_pred             ceeeccCCchheeeccC-------------------CCCCceeeccccceee
Confidence            46799999999998763                   2227899999998864


No 428
>KOG1151|consensus
Probab=85.08  E-value=0.8  Score=39.81  Aligned_cols=30  Identities=30%  Similarity=0.475  Sum_probs=23.5

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      +.|-||+|||||+-++...                   +.+.+-||-.+
T Consensus       591 IIHYDLKPgNILLv~Gtac-------------------GeIKITDFGLS  620 (775)
T KOG1151|consen  591 IIHYDLKPGNILLVNGTAC-------------------GEIKITDFGLS  620 (775)
T ss_pred             eeeeccCCccEEEecCccc-------------------ceeEeeecchh
Confidence            5699999999999875322                   77888888654


No 429
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=84.91  E-value=0.53  Score=32.93  Aligned_cols=28  Identities=29%  Similarity=0.433  Sum_probs=23.6

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCC-CeEEEeeecCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNI-DLVVIDFEYCS   61 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~lIDfEYa~   61 (107)
                      ++|+|++|.|||+...                      . .+.++||-.+.
T Consensus       122 ~~hrd~kp~nil~~~~----------------------~~~~~l~dfg~~~  150 (384)
T COG0515         122 IIHRDIKPENILLDRD----------------------GRVVKLIDFGLAK  150 (384)
T ss_pred             eeccCCCHHHeeecCC----------------------CCeEEEeccCcce
Confidence            8999999999999874                      3 57888887766


No 430
>KOG0663|consensus
Probab=84.23  E-value=0.71  Score=38.47  Aligned_cols=18  Identities=28%  Similarity=0.399  Sum_probs=15.6

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      .-+.|+||++.|+|+..+
T Consensus       196 ~wilHRDLK~SNLLm~~~  213 (419)
T KOG0663|consen  196 NWILHRDLKTSNLLLSHK  213 (419)
T ss_pred             ceeEecccchhheeeccC
Confidence            357899999999999885


No 431
>KOG0607|consensus
Probab=84.21  E-value=0.79  Score=38.26  Aligned_cols=32  Identities=28%  Similarity=0.416  Sum_probs=23.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+.|+||+|.|||-.....                   -.++.+-||+.++
T Consensus       196 gIAHRDlKPENiLC~~pn~-------------------vsPvKiCDfDLgS  227 (463)
T KOG0607|consen  196 GIAHRDLKPENILCESPNK-------------------VSPVKICDFDLGS  227 (463)
T ss_pred             CcccccCCccceeecCCCC-------------------cCceeeecccccc
Confidence            4889999999999766311                   1568888887654


No 432
>KOG0192|consensus
Probab=83.58  E-value=0.82  Score=37.22  Aligned_cols=16  Identities=38%  Similarity=0.509  Sum_probs=15.1

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      +.|+||++.|||+...
T Consensus       164 iIHrDLK~~NiLv~~~  179 (362)
T KOG0192|consen  164 IIHRDLKSDNILVDLK  179 (362)
T ss_pred             eeecccChhhEEEcCC
Confidence            8999999999999985


No 433
>KOG0661|consensus
Probab=83.47  E-value=0.6  Score=40.15  Aligned_cols=17  Identities=41%  Similarity=0.557  Sum_probs=15.1

Q ss_pred             eEEEecccCCCceeeec
Q psy15665         10 VTFCHNDLQEGNILYRE   26 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~   26 (107)
                      -.|-|+|++|.|||+..
T Consensus       129 ~GfFHRDlKPENiLi~~  145 (538)
T KOG0661|consen  129 HGFFHRDLKPENILISG  145 (538)
T ss_pred             cCcccccCChhheEecc
Confidence            45889999999999995


No 434
>KOG0666|consensus
Probab=83.47  E-value=0.97  Score=37.57  Aligned_cols=16  Identities=38%  Similarity=0.497  Sum_probs=14.3

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      +.|+||+|.|||+..+
T Consensus       153 vlHRDLKPaNIlvmgd  168 (438)
T KOG0666|consen  153 VLHRDLKPANILVMGD  168 (438)
T ss_pred             eeeccCCcceEEEecc
Confidence            5699999999999875


No 435
>KOG0600|consensus
Probab=83.34  E-value=0.87  Score=39.38  Aligned_cols=29  Identities=28%  Similarity=0.385  Sum_probs=24.5

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .+-|+|++..|||++..                      +.|.|=||-.|.
T Consensus       238 gvlHRDIK~SNiLidn~----------------------G~LKiaDFGLAr  266 (560)
T KOG0600|consen  238 GVLHRDIKGSNILIDNN----------------------GVLKIADFGLAR  266 (560)
T ss_pred             CeeeccccccceEEcCC----------------------CCEEecccccee
Confidence            46799999999999985                      778888887666


No 436
>KOG0671|consensus
Probab=83.20  E-value=1.2  Score=37.36  Aligned_cols=48  Identities=25%  Similarity=0.306  Sum_probs=28.0

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCC-CCCCCCCCCCeEEEeeecC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNN-NNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~lIDfEYa   60 (107)
                      +-+.|-||+|.|||+-++--.++   .+.-+. ......+...+.||||-=|
T Consensus       211 ~kl~HTDLKPENILfvss~~~~~---~~~k~~~~~~r~~ks~~I~vIDFGsA  259 (415)
T KOG0671|consen  211 LKLTHTDLKPENILFVSSEYFKT---YNPKKKVCFIRPLKSTAIKVIDFGSA  259 (415)
T ss_pred             cceeecCCChheEEEeccceEEE---eccCCccceeccCCCcceEEEecCCc
Confidence            56889999999999987511110   000010 1123334467999999544


No 437
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=83.12  E-value=0.8  Score=36.53  Aligned_cols=64  Identities=27%  Similarity=0.347  Sum_probs=42.7

Q ss_pred             cccCCCCeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHhhhccCC
Q psy15665          3 LLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSY   82 (107)
Q Consensus         3 l~~~~~~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~   82 (107)
                      |++....--+.|+||+.||.+...+                      + -+++|= =|-++.|.+|||..  |+-    .
T Consensus       180 L~~hqpqPsLlHGDLW~gN~a~~~~----------------------G-Pv~fDP-A~y~GDrE~Dlam~--elF----g  229 (286)
T COG3001         180 LADHQPQPSLLHGDLWSGNCAFGKD----------------------G-PVIFDP-ACYWGDRECDLAML--ELF----G  229 (286)
T ss_pred             HhcCCCCcceeecccccccccccCC----------------------C-Ceeecc-ccccCCcccceehh--hhh----c
Confidence            4555666789999999999998873                      4 567674 34568999999863  331    1


Q ss_pred             CCCC--ceeecCCCCCC
Q psy15665         83 KHFP--HYTVKRENYPS   97 (107)
Q Consensus        83 ~~~p--~~~~~~~~~Pt   97 (107)
                      . +|  +|+-|.+-+|-
T Consensus       230 g-fp~efy~gY~sv~PL  245 (286)
T COG3001         230 G-FPPEFYDGYQSVSPL  245 (286)
T ss_pred             C-CcHHHHHhhhccCCC
Confidence            2 22  45555565553


No 438
>KOG0585|consensus
Probab=82.75  E-value=0.86  Score=39.38  Aligned_cols=17  Identities=24%  Similarity=0.493  Sum_probs=15.1

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+|++|.|+|+...
T Consensus       230 giiHRDIKPsNLLl~~~  246 (576)
T KOG0585|consen  230 GIIHRDIKPSNLLLSSD  246 (576)
T ss_pred             CeeccccchhheEEcCC
Confidence            36899999999999985


No 439
>KOG0612|consensus
Probab=81.98  E-value=0.81  Score=42.97  Aligned_cols=20  Identities=25%  Similarity=0.579  Sum_probs=17.2

Q ss_pred             CCeEEEecccCCCceeeecC
Q psy15665          8 SPVTFCHNDLQEGNILYRES   27 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~   27 (107)
                      +.+.+.|+|++|.|||++..
T Consensus       192 H~mgyVHRDiKPDNvLld~~  211 (1317)
T KOG0612|consen  192 HSMGYVHRDIKPDNVLLDKS  211 (1317)
T ss_pred             HhccceeccCCcceeEeccc
Confidence            35678999999999999875


No 440
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=81.80  E-value=0.79  Score=42.31  Aligned_cols=17  Identities=29%  Similarity=0.458  Sum_probs=14.8

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .++|+||+|.|||+..+
T Consensus       145 ~IVHRDLKPeNILL~s~  161 (1021)
T PTZ00266        145 RVLHRDLKPQNIFLSTG  161 (1021)
T ss_pred             CceeccCcHHHeEeecC
Confidence            38999999999999763


No 441
>KOG0664|consensus
Probab=81.61  E-value=0.93  Score=37.25  Aligned_cols=17  Identities=29%  Similarity=0.634  Sum_probs=14.7

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      -+-|+|++|||+|++..
T Consensus       176 ~ILHRDIKPGNLLVNSN  192 (449)
T KOG0664|consen  176 NILHRDIKPGNLLVNSN  192 (449)
T ss_pred             chhhccCCCccEEeccC
Confidence            46799999999999873


No 442
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=81.32  E-value=1  Score=33.17  Aligned_cols=16  Identities=31%  Similarity=0.526  Sum_probs=13.8

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      ++|++|.+.||++...
T Consensus       124 iiH~~l~~~nill~~~  139 (259)
T PF07714_consen  124 IIHGNLSPSNILLDSN  139 (259)
T ss_dssp             EEEST-SGGGEEEETT
T ss_pred             cccccccccccccccc
Confidence            7999999999999975


No 443
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the 
Probab=81.21  E-value=1.3  Score=33.17  Aligned_cols=31  Identities=23%  Similarity=0.205  Sum_probs=24.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      ++.=+|-+++|||++..    +                 +.++-|||.++--
T Consensus       129 ilglgDRh~~NIli~~~----~-----------------G~~~hIDfg~~~~  159 (219)
T cd00142         129 ILGIGDRHPDNIMIDLD----T-----------------GKLFHIDFGFIFG  159 (219)
T ss_pred             HhccCCCCCccEEEECC----C-----------------CeEEEEeeHHhhC
Confidence            45558999999999972    1                 8899999987643


No 444
>KOG1027|consensus
Probab=81.01  E-value=0.83  Score=41.50  Aligned_cols=18  Identities=33%  Similarity=0.506  Sum_probs=16.0

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      +-+.|+||+|.|||+..+
T Consensus       625 l~iVHRDLkPQNILI~~~  642 (903)
T KOG1027|consen  625 LKIVHRDLKPQNILISVP  642 (903)
T ss_pred             cccccccCCCceEEEEcc
Confidence            678999999999999874


No 445
>KOG0907|consensus
Probab=80.69  E-value=3.9  Score=27.70  Aligned_cols=45  Identities=24%  Similarity=0.309  Sum_probs=36.7

Q ss_pred             CCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCCceeecCCCCCC
Q psy15665         50 IDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPS   97 (107)
Q Consensus        50 ~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p~~~~~~~~~Pt   97 (107)
                      +++++||| ||.+..++-=|+-.|++..-.|....  +++++-+..+.
T Consensus        21 ~kliVvdF-~a~wCgPCk~i~P~~~~La~~y~~v~--Flkvdvde~~~   65 (106)
T KOG0907|consen   21 DKLVVVDF-YATWCGPCKAIAPKFEKLAEKYPDVV--FLKVDVDELEE   65 (106)
T ss_pred             CCeEEEEE-ECCCCcchhhhhhHHHHHHHHCCCCE--EEEEecccCHh
Confidence            58999999 99999999999999999998888744  56666555333


No 446
>KOG0591|consensus
Probab=80.13  E-value=1.3  Score=36.34  Aligned_cols=17  Identities=29%  Similarity=0.540  Sum_probs=15.0

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      ...|+|++|+||+++..
T Consensus       148 ~VmHRDIKPaNIFl~~~  164 (375)
T KOG0591|consen  148 TVMHRDIKPANIFLTAN  164 (375)
T ss_pred             ceeeccCcchheEEcCC
Confidence            56799999999999974


No 447
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phosphoinositide 3-kinase isoforms participate in a variety of processes,  including cell motility, the Ras pathway, vesicle trafficking and  secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
Probab=79.92  E-value=1.6  Score=32.32  Aligned_cols=31  Identities=26%  Similarity=0.290  Sum_probs=24.0

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCc
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNY   64 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~   64 (107)
                      +-=+|-+++|||++.+                      +.++-|||.++--..
T Consensus       103 lglgDRh~~NIli~~~----------------------G~v~hIDfg~~~~~~  133 (202)
T smart00146      103 LGLGDRHNDNIMLDKT----------------------GHLFHIDFGFILGNG  133 (202)
T ss_pred             hcCCCCCCCcEEEeCC----------------------CCEEEEechhhhCcc
Confidence            3447999999999953                      889999998765433


No 448
>KOG0694|consensus
Probab=78.78  E-value=1  Score=39.92  Aligned_cols=44  Identities=20%  Similarity=0.289  Sum_probs=36.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      .+.++||+..|||++..                      +-+.|+||-.|--+.-.-|-+..||-.
T Consensus       488 ~IIYRDlKLdNiLLD~e----------------------Gh~kiADFGlcKe~m~~g~~TsTfCGT  531 (694)
T KOG0694|consen  488 GIIYRDLKLDNLLLDTE----------------------GHVKIADFGLCKEGMGQGDRTSTFCGT  531 (694)
T ss_pred             CceeeecchhheEEccc----------------------CcEEecccccccccCCCCCccccccCC
Confidence            36789999999999985                      889999999888777666777788754


No 449
>KOG0574|consensus
Probab=78.65  E-value=0.64  Score=38.65  Aligned_cols=15  Identities=40%  Similarity=0.740  Sum_probs=13.5

Q ss_pred             EecccCCCceeeecC
Q psy15665         13 CHNDLQEGNILYRES   27 (107)
Q Consensus        13 cHnDl~~gNiL~~~~   27 (107)
                      .|+|++.||||++.+
T Consensus       151 IHRDIKAGNILLNT~  165 (502)
T KOG0574|consen  151 IHRDIKAGNILLNTD  165 (502)
T ss_pred             HHhhcccccEEEccc
Confidence            599999999999875


No 450
>KOG0590|consensus
Probab=78.07  E-value=1.7  Score=37.61  Aligned_cols=37  Identities=30%  Similarity=0.350  Sum_probs=27.3

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhh
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAF   67 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~f   67 (107)
                      -.+++|+|+++.|+|+...                      +.+.+|||--+...--++
T Consensus       438 ~~GiahrdlK~enll~~~~----------------------g~lki~Dfg~~~vf~~~~  474 (601)
T KOG0590|consen  438 SMGLAHRDLKLENLLVTEN----------------------GILKIIDFGAASVFRYPW  474 (601)
T ss_pred             hcCceeccCccccEEEecC----------------------CceEEeecCcceeeccCc
Confidence            3578999999999999985                      567777776555433333


No 451
>KOG1989|consensus
Probab=77.75  E-value=1.1  Score=40.03  Aligned_cols=34  Identities=21%  Similarity=0.248  Sum_probs=26.3

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhh
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAF   67 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~f   67 (107)
                      +.|+||+-.|||+...                      +..+|=||-=|.-..+..
T Consensus       167 iIHRDLKiENvLls~~----------------------g~~KLCDFGSatt~~~~~  200 (738)
T KOG1989|consen  167 IIHRDLKIENVLLSAD----------------------GNYKLCDFGSATTKILSP  200 (738)
T ss_pred             cchhhhhhhheEEcCC----------------------CCEEeCcccccccccCCC
Confidence            6899999999999985                      678888887655444433


No 452
>PHA03111 Ser/Thr kinase; Provisional
Probab=77.51  E-value=2.6  Score=35.41  Aligned_cols=21  Identities=38%  Similarity=0.412  Sum_probs=17.5

Q ss_pred             CCCeEEEecccCCCceeeecC
Q psy15665          7 KSPVTFCHNDLQEGNILYRES   27 (107)
Q Consensus         7 ~~~~VfcHnDl~~gNiL~~~~   27 (107)
                      +.--.|.|+||+|.|||+-++
T Consensus       299 p~c~nF~H~DLKPdNILiFds  319 (444)
T PHA03111        299 PCCDNFLHVDLKPDNILIFDS  319 (444)
T ss_pred             CCcceeeeccCCCCcEEEecC
Confidence            334579999999999999885


No 453
>PF10707 YrbL-PhoP_reg:  PhoP regulatory network protein YrbL;  InterPro: IPR019647  This entry represents proteins that are activated by the protein PhoP. PhoP controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multi-component loop in Salmonella sp., where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner []. 
Probab=77.48  E-value=2.4  Score=31.72  Aligned_cols=27  Identities=30%  Similarity=0.380  Sum_probs=20.1

Q ss_pred             EecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEee
Q psy15665         13 CHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDF   57 (107)
Q Consensus        13 cHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDf   57 (107)
                      +.+|+.++||++....++.                  ..+++||-
T Consensus       140 v~~dl~~~NIv~~~~~~~~------------------~~lvlIDG  166 (199)
T PF10707_consen  140 VIRDLNPHNIVVQRRDSGE------------------FRLVLIDG  166 (199)
T ss_pred             eecCCCcccEEEEecCCCc------------------eEEEEEeC
Confidence            4459999999998853221                  47999997


No 454
>KOG0193|consensus
Probab=77.14  E-value=1.3  Score=39.18  Aligned_cols=33  Identities=27%  Similarity=0.500  Sum_probs=25.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      -+.|+||+..||++.++                      ..|++=||-.++..-+
T Consensus       508 ~IIHrDLKSnNIFl~~~----------------------~kVkIgDFGLatvk~~  540 (678)
T KOG0193|consen  508 NIIHRDLKSNNIFLHED----------------------LKVKIGDFGLATVKTR  540 (678)
T ss_pred             hhhhhhccccceEEccC----------------------CcEEEecccceeeeee
Confidence            36799999999999986                      5677778877665443


No 455
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central 
Probab=75.96  E-value=2.2  Score=32.63  Aligned_cols=30  Identities=27%  Similarity=0.362  Sum_probs=23.3

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      |+-=+|-+++|||++..    +                 +.++-|||.++-
T Consensus       140 ilgigDRh~~NIli~~~----t-----------------G~~~HIDfg~~~  169 (237)
T cd00892         140 ILGLGDRHGENILFDSN----T-----------------GDVVHVDFNCLF  169 (237)
T ss_pred             HhccCCCCcccEEEEcC----C-----------------CcEEEEehHhhh
Confidence            44457999999999873    1                 889999997654


No 456
>PF05445 Pox_ser-thr_kin:  Poxvirus serine/threonine protein kinase;  InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly. ; GO: 0004672 protein kinase activity, 0005524 ATP binding
Probab=75.96  E-value=2.9  Score=35.18  Aligned_cols=22  Identities=36%  Similarity=0.479  Sum_probs=18.3

Q ss_pred             CCCCeEEEecccCCCceeeecC
Q psy15665          6 IKSPVTFCHNDLQEGNILYRES   27 (107)
Q Consensus         6 ~~~~~VfcHnDl~~gNiL~~~~   27 (107)
                      .+.---|.|+||+|.|||+-++
T Consensus       294 lp~c~nF~H~DLKPdNILiFds  315 (434)
T PF05445_consen  294 LPCCTNFLHVDLKPDNILIFDS  315 (434)
T ss_pred             CCCcceeeecccCcCcEEEecC
Confidence            3444679999999999999886


No 457
>KOG0575|consensus
Probab=75.74  E-value=1.6  Score=38.12  Aligned_cols=18  Identities=33%  Similarity=0.636  Sum_probs=15.7

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..+.|+||+.|||+++..
T Consensus       137 ~~IiHRDLKLGNlfL~~~  154 (592)
T KOG0575|consen  137 LGIIHRDLKLGNLFLNEN  154 (592)
T ss_pred             cCceecccchhheeecCc
Confidence            347899999999999984


No 458
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st
Probab=75.49  E-value=2.9  Score=32.01  Aligned_cols=31  Identities=26%  Similarity=0.128  Sum_probs=24.7

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      .|+.=+|-+++|||++..    +                 +.++-|||.++-
T Consensus       136 YilglgDRH~~NIli~~~----t-----------------G~v~HIDfg~~f  166 (235)
T cd05172         136 WILGIGDRHLSNFLVDLE----T-----------------GGLVGIDFGHAF  166 (235)
T ss_pred             heeeccCCCcccEEEECC----C-----------------CcEEEEeeHhhh
Confidence            466778999999999852    1                 889999997653


No 459
>cd05168 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIbeta (also called Pik1p in yeast) is a 110 kDa protein that is localized to the Golgi and the nucleus. It is required for maintaining the structural integrity of the Golgi complex (GC), and is a key regulator of protein transport from the GC to the plasma membrane. PI4KII
Probab=74.45  E-value=2.3  Score=33.90  Aligned_cols=26  Identities=31%  Similarity=0.502  Sum_probs=21.9

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      +|=|.+|||++.+                      +.++-|||-++-=
T Consensus       146 gDRH~~NILi~~~----------------------G~liHIDFG~~fg  171 (293)
T cd05168         146 KDRHNGNILIDND----------------------GHIIHIDFGFMLS  171 (293)
T ss_pred             cccCCCceEEcCC----------------------CCEEEEehHHhhc
Confidence            6788999999874                      8899999987653


No 460
>cd00893 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. There are two types of PI4Ks, types II and III. Type II PI4Ks lack the characteristic catalytic kinase domain present in PI3Ks and type III PI4Ks, and are excluded from this family. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes.
Probab=74.00  E-value=2.4  Score=33.77  Aligned_cols=30  Identities=27%  Similarity=0.408  Sum_probs=24.0

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchh
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRA   66 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~   66 (107)
                      +|=|.+|||++.+                      +.++-|||-++-=+.++
T Consensus       144 gDRH~~NILid~~----------------------G~liHIDFG~ilg~~p~  173 (289)
T cd00893         144 KDRHNGNILLDSD----------------------GHIIHIDFGFILDSSPG  173 (289)
T ss_pred             cccCCCceEECCC----------------------CCEEEEehHHhhCcCCc
Confidence            6888999999874                      88999999887655444


No 461
>KOG1236|consensus
Probab=73.53  E-value=1.9  Score=37.15  Aligned_cols=16  Identities=50%  Similarity=0.845  Sum_probs=14.5

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      |.|.|++|||||++.-
T Consensus       366 FvHaDlHPGNVlirf~  381 (565)
T KOG1236|consen  366 FVHADLHPGNVLIRFN  381 (565)
T ss_pred             ceecccCCCcEEEEec
Confidence            8899999999999864


No 462
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with 
Probab=73.32  E-value=2.6  Score=32.70  Aligned_cols=30  Identities=23%  Similarity=0.349  Sum_probs=23.9

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      .|+.=+|-+++|||++..    +                 +.++-|||.++
T Consensus       181 YilglgDRH~~NIll~~~----t-----------------G~v~HIDfg~~  210 (280)
T cd05169         181 YILGLGDRHPSNIMIDRL----T-----------------GKVIHIDFGDC  210 (280)
T ss_pred             hheeccCCCcceEEEEcC----C-----------------CCEEEEecHHH
Confidence            356668999999999873    1                 88999999654


No 463
>cd05167 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIalpha is a 220 kDa protein found in the plasma membrane and the endoplasmic reticulum (ER). The role of PI4KIIIalpha in the ER remains unclear. In the plasma membrane, it provides PtdIns(4)P, which is then converted by PI5Ks to PtdIns(4,5)P2, an important signaling mole
Probab=70.75  E-value=3.4  Score=33.22  Aligned_cols=29  Identities=24%  Similarity=0.408  Sum_probs=23.4

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      +=-+|=|.+|||++.+                      +.++-|||-+.-=
T Consensus       162 LgigDRHn~NILid~~----------------------G~l~HIDFG~il~  190 (311)
T cd05167         162 LQIKDRHNGNIMIDDD----------------------GHIIHIDFGFIFE  190 (311)
T ss_pred             hhccccCccceEEcCC----------------------CCEEEEeeHHhhc
Confidence            3446889999999975                      8899999987653


No 464
>KOG0670|consensus
Probab=70.69  E-value=3.1  Score=36.72  Aligned_cols=18  Identities=39%  Similarity=0.530  Sum_probs=16.0

Q ss_pred             eEEEecccCCCceeeecC
Q psy15665         10 VTFCHNDLQEGNILYRES   27 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~   27 (107)
                      ..+.|.|++|.|||+..+
T Consensus       555 c~vlHaDIKPDNiLVNE~  572 (752)
T KOG0670|consen  555 CGVLHADIKPDNILVNES  572 (752)
T ss_pred             cCeeecccCccceEeccC
Confidence            457899999999999985


No 465
>KOG0662|consensus
Probab=70.61  E-value=2.7  Score=32.76  Aligned_cols=25  Identities=32%  Similarity=0.526  Sum_probs=20.3

Q ss_pred             ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      |+||+|.|+|+...                      +.+.+-||-.|
T Consensus       124 hrdlkpqnllin~n----------------------gelkladfgla  148 (292)
T KOG0662|consen  124 HRDLKPQNLLINRN----------------------GELKLADFGLA  148 (292)
T ss_pred             hccCCcceEEeccC----------------------CcEEecccchh
Confidence            47999999999874                      67888888655


No 466
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno
Probab=70.07  E-value=3.9  Score=32.44  Aligned_cols=29  Identities=24%  Similarity=0.377  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      |+.=+|-+++|||+...    +                 +.++-|||.++
T Consensus       210 ilglgDRh~~NIli~~~----t-----------------G~v~hiDf~~~  238 (307)
T cd05170         210 VIGLGDRHLDNVLIDLK----T-----------------GEVVHIDYNVC  238 (307)
T ss_pred             HccCCCCCCccEEEEcC----C-----------------CcEEEEeeHhh
Confidence            45668999999999853    1                 88999999865


No 467
>cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms c
Probab=69.91  E-value=3  Score=33.97  Aligned_cols=26  Identities=27%  Similarity=0.307  Sum_probs=21.8

Q ss_pred             ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      =+|=|.+|||++.+                      +.++-|||-+.-
T Consensus       207 igDRH~~NILi~~~----------------------G~~~HIDFG~il  232 (352)
T cd00891         207 IGDRHNDNIMLTKT----------------------GHLFHIDFGHFL  232 (352)
T ss_pred             ccccCCCceEECCC----------------------CCEEEEehHHhh
Confidence            36889999999864                      889999998763


No 468
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transi
Probab=69.36  E-value=4  Score=31.90  Aligned_cols=29  Identities=28%  Similarity=0.367  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      |+.=+|-+++|||+...    +                 +.++-|||.++
T Consensus       182 ilglgDRh~~NIll~~~----t-----------------G~v~hiDf~~~  210 (279)
T cd05171         182 ILGLGDRHANNILIDEK----T-----------------AEVVHIDLGIA  210 (279)
T ss_pred             hhccCCCCcccEEEEcC----c-----------------CcEEEEechhh
Confidence            45568999999999853    1                 88999999876


No 469
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members include ATM (Ataxia telangiectasia mutated), ATR (Ataxia telangiectasia and Rad3-related), TOR (Target of rapamycin), SMG-1 (Suppressor of morphogenetic effect on genitalia-1), and DNA-PK (DNA-dependent protein kinase). PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). They show strong preference for phosphorylating serine/threonine residues followed by a glutamine and are also referred to as (S/T)-Q-directed kinases. They all contain a FATC (FRAP, ATM and TRRAP, C-terminal) d
Probab=69.20  E-value=3.8  Score=31.03  Aligned_cols=29  Identities=28%  Similarity=0.295  Sum_probs=23.4

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      |+.=+|-+++|||++..    +                 +.++-|||-++
T Consensus       132 vlglgDRh~~NIli~~~----t-----------------G~v~hIDf~~~  160 (222)
T cd05164         132 ILGLGDRHLDNILIDRE----T-----------------GEVVHIDFGCI  160 (222)
T ss_pred             HhccCCCCCceEEEECC----C-----------------CcEEEEccHHh
Confidence            45568999999999983    1                 78999999765


No 470
>KOG0611|consensus
Probab=68.80  E-value=3.2  Score=35.85  Aligned_cols=42  Identities=26%  Similarity=0.434  Sum_probs=27.8

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCchhhhHHHHHHHh
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVES   76 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r~fDlanhf~E~   76 (107)
                      ..|+||+..|||+++.                      ..+.+-||-.+.+ |.-=-+-..||-.
T Consensus       174 VvHRDLKLENILLD~N----------------------~NiKIADFGLSNl-y~~~kfLqTFCGS  215 (668)
T KOG0611|consen  174 VVHRDLKLENILLDQN----------------------NNIKIADFGLSNL-YADKKFLQTFCGS  215 (668)
T ss_pred             ceecccchhheeecCC----------------------CCeeeeccchhhh-hccccHHHHhcCC
Confidence            4699999999999884                      5677888866554 2222333444443


No 471
>PF00454 PI3_PI4_kinase:  Phosphatidylinositol 3- and 4-kinase;  InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Phosphatidylinositol 3-kinase (PI3-kinase) (2.7.1.137 from EC) [] is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. The three products of PI3-kinase - PI-3-P, PI-3,4-P(2) and PI-3,4,5-P(3) function as secondary messengers in cell signalling. Phosphatidylinositol 4-kinase (PI4-kinase) (2.7.1.67 from EC) [] is an enzyme that acts on phosphatidylinositol (PI) in the first committed step in the production of the secondary messenger inositol-1'4'5'-trisphosphate. This domain is also present in a wide range of protein kinases, involved in diverse cellular functions, such as control of cell growth, regulation of cell cycle progression, a DNA damage checkpoint, recombination, and maintenance of telomere length. Despite significant homology to lipid kinases, no lipid kinase activity has been demonstrated for any of the PIK-related kinases []. The PI3- and PI4-kinases share a well conserved domain at their C-terminal section; this domain seems to be distantly related to the catalytic domain of protein kinases [, ]. The catalytic domain of PI3K has the typical bilobal structure that is seen in other ATP-dependent kinases, with a small N-terminal lobe and a large C-terminal lobe. The core of this domain is the most conserved region of the PI3Ks. The ATP cofactor binds in the crevice formed by the N-and C-terminal lobes, a loop between two strands provides a hydrophobic pocket for binding of the adenine moiety, and a lysine residue interacts with the alpha-phosphate. In contrast to protein kinases, the PI3K loop which interacts with the phosphates of the ATP and is known as the glycine-rich or P-loop, contains no glycine residues. Instead, contact with the ATP -phosphate is maintained through the side chain of a conserved serine residue.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 2WXL_A 4AJW_B 2WXQ_A 2WXP_A 2WXM_A 2WXH_A 2WXK_A 2WXG_A 2X38_A 2WXF_A ....
Probab=68.79  E-value=3.2  Score=30.71  Aligned_cols=27  Identities=33%  Similarity=0.472  Sum_probs=16.8

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      +|=+++|||+...    +                 +.++-|||.++--
T Consensus       139 gDRh~~Nili~~~----~-----------------g~~~hIDfg~~f~  165 (235)
T PF00454_consen  139 GDRHPGNILIDKK----T-----------------GELIHIDFGFIFG  165 (235)
T ss_dssp             CS--TTTEEE-ET----T-----------------SEEEE--HSSCTT
T ss_pred             cCCCchhheeccc----c-----------------ceeeeEEeHHhhh
Confidence            5789999999432    1                 8899999977754


No 472
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=68.49  E-value=3.3  Score=32.95  Aligned_cols=17  Identities=24%  Similarity=0.505  Sum_probs=13.4

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+|+++.|+++..+
T Consensus       165 GlVHgdi~~~nfll~~~  181 (288)
T PF14531_consen  165 GLVHGDIKPENFLLDQD  181 (288)
T ss_dssp             TEEEST-SGGGEEE-TT
T ss_pred             ceEecccceeeEEEcCC
Confidence            37899999999999985


No 473
>KOG3653|consensus
Probab=68.33  E-value=3.6  Score=35.52  Aligned_cols=20  Identities=25%  Similarity=0.476  Sum_probs=17.1

Q ss_pred             CCeEEEecccCCCceeeecC
Q psy15665          8 SPVTFCHNDLQEGNILYRES   27 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~~   27 (107)
                      .+-.+.|+||+..|||+..+
T Consensus       333 ~Kp~IaHRDlkSkNVLvK~D  352 (534)
T KOG3653|consen  333 HKPPIAHRDLKSKNVLVKND  352 (534)
T ss_pred             CCCccccccccccceEEccC
Confidence            34568999999999999986


No 474
>cd05166 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class II, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do not associate with any
Probab=67.09  E-value=4.7  Score=32.96  Aligned_cols=26  Identities=27%  Similarity=0.273  Sum_probs=21.5

Q ss_pred             ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      =+|=|.+|||++.+                      +.++-|||-+.-
T Consensus       206 igDRH~~NILl~~~----------------------G~l~HIDFG~~l  231 (353)
T cd05166         206 ICDRHNDNIMLTKS----------------------GHMFHIDFGKFL  231 (353)
T ss_pred             ccccCCCceEECCC----------------------CCEEEEeeHHhc
Confidence            36888999999864                      889999998753


No 475
>cd00896 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class III PI3Ks, also called Vps34 (vacuolar protein sorting 34), contain an N-terminal lipid binding C2 domain, a PI3K homology domain of unknown function, and a C-termin
Probab=65.29  E-value=4.5  Score=33.01  Aligned_cols=27  Identities=30%  Similarity=0.311  Sum_probs=22.0

Q ss_pred             ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      =+|=|.+|||++.+                      +.++-|||-++-=
T Consensus       206 igDRH~~NILi~~~----------------------G~~~HIDFG~ilg  232 (350)
T cd00896         206 VGDRHLDNLLLTKD----------------------GKLFHIDFGYILG  232 (350)
T ss_pred             ccccCCCcEEEcCC----------------------CCEEEEEhHHhhC
Confidence            36888999999864                      8899999987653


No 476
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=65.29  E-value=4.2  Score=31.09  Aligned_cols=32  Identities=25%  Similarity=0.557  Sum_probs=23.6

Q ss_pred             EEEecccCC--CceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         11 TFCHNDLQE--GNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        11 VfcHnDl~~--gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      .+-|+.+|-  .|||+.+                       +.+.+||||=|.++-.
T Consensus       125 GI~H~El~~~~k~vlv~~-----------------------~~~~iIDFd~At~k~~  158 (201)
T COG2112         125 GIEHGELSRPWKNVLVND-----------------------RDVYIIDFDSATFKKK  158 (201)
T ss_pred             ccchhhhcCCceeEEecC-----------------------CcEEEEEccchhhccC
Confidence            456777765  4777666                       6799999999986544


No 477
>KOG0201|consensus
Probab=65.28  E-value=4.8  Score=34.33  Aligned_cols=29  Identities=34%  Similarity=0.450  Sum_probs=23.8

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      -.|+|++..|||+...                      +.+.|-||-+++.
T Consensus       132 kiHrDIKaanil~s~~----------------------g~vkl~DfgVa~q  160 (467)
T KOG0201|consen  132 KIHRDIKAANILLSES----------------------GDVKLADFGVAGQ  160 (467)
T ss_pred             eecccccccceeEecc----------------------CcEEEEecceeee
Confidence            3699999999999985                      6688888887764


No 478
>PF08207 EFP_N:  Elongation factor P (EF-P) KOW-like domain;  InterPro: IPR013185  This entry represents the N-terminal domain of homologues of elongation factor P, which probably are translation initiation factors. ; PDB: 3TRE_A 1YBY_A 1IZ6_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H 3OYY_B.
Probab=65.26  E-value=7.2  Score=23.57  Aligned_cols=26  Identities=27%  Similarity=0.450  Sum_probs=20.2

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      +||..|+++..+.                      ....|+|+++...
T Consensus         3 ~dlr~G~~i~~~g----------------------~~~~V~~~~~~k~   28 (58)
T PF08207_consen    3 SDLRKGMVIEIDG----------------------EPYVVLDFQHVKP   28 (58)
T ss_dssp             GG--TTSEEEETT----------------------EEEEEEEEEEECC
T ss_pred             HHccCCCEEEECC----------------------EEEEEEEEEEECC
Confidence            6899999998875                      6789999998764


No 479
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1. Like Dim1, it is also implicated in pre-mRNA splicing and cell cycle progression. DLP is located in the nucleus and has been shown to interact with the U5 small nuclear ribonucleoprotein particle (snRNP)-specific 102kD protein (or Prp6). Dim1 protein, also known as U5 snRNP-specific 15kD protein is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif.
Probab=65.06  E-value=15  Score=25.54  Aligned_cols=53  Identities=15%  Similarity=0.181  Sum_probs=42.9

Q ss_pred             CCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCCceeecCCCCCCHHHHhhc
Q psy15665         50 IDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        50 ~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p~~~~~~~~~Pt~~~~~~~  104 (107)
                      +++++||| +|.+.+++--++-.|-|.+-+|... .-.++++-+.-|.-.++..+
T Consensus        14 ~klVVVdF-~a~WC~pCk~mdp~l~ela~~~~~~-~~f~kVDVDev~dva~~y~I   66 (114)
T cd02986          14 EKVLVLRF-GRDEDAVCLQLDDILSKTSHDLSKM-ASIYLVDVDKVPVYTQYFDI   66 (114)
T ss_pred             CCEEEEEE-eCCCChhHHHHHHHHHHHHHHccCc-eEEEEEeccccHHHHHhcCc
Confidence            78999999 7888999999999999999887542 33788888888887776543


No 480
>KOG1165|consensus
Probab=64.66  E-value=7.6  Score=32.64  Aligned_cols=34  Identities=18%  Similarity=0.275  Sum_probs=24.8

Q ss_pred             EEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         12 FCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      +.=+|++|.|+|+.....                 ++..-+.+|||-.|-.
T Consensus       145 LIYRDIKPdNFLIGrp~~-----------------k~~n~IhiiDFGmAK~  178 (449)
T KOG1165|consen  145 LIYRDIKPDNFLIGRPGT-----------------KDANVIHIIDFGMAKE  178 (449)
T ss_pred             eeecccCccceeecCCCC-----------------CCCceEEEEeccchhh
Confidence            556899999999976421                 2236799999977663


No 481
>KOG1152|consensus
Probab=63.49  E-value=5.9  Score=35.37  Aligned_cols=31  Identities=23%  Similarity=0.434  Sum_probs=26.3

Q ss_pred             eEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         10 VTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        10 ~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      -.+.|+|++-.|+++...                      +-+.+|||-=|.|
T Consensus       689 ~~ivhrdikdenvivd~~----------------------g~~klidfgsaa~  719 (772)
T KOG1152|consen  689 QGIVHRDIKDENVIVDSN----------------------GFVKLIDFGSAAY  719 (772)
T ss_pred             cCceecccccccEEEecC----------------------CeEEEeeccchhh
Confidence            357899999999999884                      8899999986665


No 482
>KOG0197|consensus
Probab=62.90  E-value=3.3  Score=35.28  Aligned_cols=29  Identities=31%  Similarity=0.521  Sum_probs=23.6

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      -+.|+||-..|||+.+.                      ..+.|=||-.|-
T Consensus       323 ~~IHRDLAARNiLV~~~----------------------~~vKIsDFGLAr  351 (468)
T KOG0197|consen  323 NYIHRDLAARNILVDED----------------------LVVKISDFGLAR  351 (468)
T ss_pred             CccchhhhhhheeeccC----------------------ceEEEccccccc
Confidence            37899999999999985                      567788886555


No 483
>KOG4158|consensus
Probab=62.70  E-value=5.2  Score=34.44  Aligned_cols=33  Identities=36%  Similarity=0.545  Sum_probs=24.0

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      ...|+||+..|||+.=+.++-                  ..|++-||--|-
T Consensus       361 gvAhRDlKSDNiL~ElddD~~------------------P~LVvaDFGCcL  393 (598)
T KOG4158|consen  361 GVAHRDLKSDNILLELDDDEI------------------PQLVVADFGCCL  393 (598)
T ss_pred             cchhhcccccceEEEecCCCC------------------cEEEEcccceee
Confidence            478999999999987553331                  567888886543


No 484
>KOG2270|consensus
Probab=62.62  E-value=4.7  Score=34.48  Aligned_cols=26  Identities=38%  Similarity=0.588  Sum_probs=22.7

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeec
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEY   59 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEY   59 (107)
                      -+.|-||-+-|+|+++                       +.|.+||---
T Consensus       285 ~LVHADLSEfN~Lyhd-----------------------G~lyiIDVSQ  310 (520)
T KOG2270|consen  285 RLVHADLSEFNLLYHD-----------------------GKLYIIDVSQ  310 (520)
T ss_pred             ceeccchhhhhheEEC-----------------------CEEEEEEccc
Confidence            4789999999999999                       7899999643


No 485
>cd05173 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and de
Probab=62.14  E-value=5.7  Score=32.66  Aligned_cols=25  Identities=32%  Similarity=0.384  Sum_probs=21.1

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      +|=|.+|||++.+                      +.++-|||-+.-
T Consensus       213 GDRHn~NILi~~~----------------------G~l~HIDFG~il  237 (362)
T cd05173         213 GDRHSDNIMVRKN----------------------GQLFHIDFGHIL  237 (362)
T ss_pred             cccCCCceEECCC----------------------CCEEEEehHHhh
Confidence            5778899999864                      889999998764


No 486
>cd05165 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. In vitro, they can also phosphorylate the substrates P
Probab=61.90  E-value=5.8  Score=32.70  Aligned_cols=25  Identities=32%  Similarity=0.406  Sum_probs=21.2

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      +|=|.+|||++.+                      +.++-|||-|+-
T Consensus       217 gDRH~~NILi~~~----------------------G~l~HIDFG~il  241 (366)
T cd05165         217 GDRHNDNIMVKET----------------------GQLFHIDFGHIL  241 (366)
T ss_pred             cccCCcceEEcCC----------------------CCEEEEehHHhh
Confidence            5778899999874                      889999998864


No 487
>KOG1240|consensus
Probab=59.66  E-value=3.3  Score=39.31  Aligned_cols=19  Identities=32%  Similarity=0.656  Sum_probs=16.1

Q ss_pred             CCeEEEecccCCCceeeec
Q psy15665          8 SPVTFCHNDLQEGNILYRE   26 (107)
Q Consensus         8 ~~~VfcHnDl~~gNiL~~~   26 (107)
                      ....+||+|++..|||++.
T Consensus       137 H~~gVcHGDIKsENILiTS  155 (1431)
T KOG1240|consen  137 HKLGVCHGDIKSENILITS  155 (1431)
T ss_pred             HHcCccccccccceEEEee
Confidence            3467899999999999874


No 488
>KOG0587|consensus
Probab=59.25  E-value=8.8  Score=35.37  Aligned_cols=67  Identities=19%  Similarity=0.361  Sum_probs=42.2

Q ss_pred             CeEEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC-----CchhhhHHHHHHHhhhccCCC
Q psy15665          9 PVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY-----NYRAFDIANHFVESVYDYSYK   83 (107)
Q Consensus         9 ~~VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~-----n~r~fDlanhf~E~~~dy~~~   83 (107)
                      .....|+|++-.|||++..                      ++|+++||--+.-     .=|.--||.-|  ||      
T Consensus       141 ~nkviHRDikG~NiLLT~e----------------------~~VKLvDFGvSaQldsT~grRnT~iGtP~--WM------  190 (953)
T KOG0587|consen  141 NNKVIHRDIKGQNVLLTEN----------------------AEVKLVDFGVSAQLDSTVGRRNTFIGTPY--WM------  190 (953)
T ss_pred             hcceeeecccCceEEEecc----------------------CcEEEeeeeeeeeeecccccccCcCCCcc--cc------
Confidence            3456899999999999985                      7899999975432     22222222211  33      


Q ss_pred             CCC-ceeecCCCCCCHHHHhhccc
Q psy15665         84 HFP-HYTVKRENYPSYSLRNSSWV  106 (107)
Q Consensus        84 ~~p-~~~~~~~~~Pt~~~~~~~~~  106 (107)
                       .| -+.|+.+.-+|..-|--+|.
T Consensus       191 -APEViac~e~~d~tyd~R~D~Ws  213 (953)
T KOG0587|consen  191 -APEVIACDESPDATYDYRSDLWS  213 (953)
T ss_pred             -cceeeecccCCCCCcccccchhh
Confidence             23 46677777777776665553


No 489
>cd05177 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), class II, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=58.50  E-value=7.2  Score=32.00  Aligned_cols=26  Identities=27%  Similarity=0.240  Sum_probs=21.4

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSY   62 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~   62 (107)
                      +|=|.+|||++.+                      +.++-|||-|.-=
T Consensus       208 gDRHn~NILi~~~----------------------G~~~HIDFG~ilg  233 (354)
T cd05177         208 CDRHNDNIMLTHS----------------------GHMFHIDFGKFLG  233 (354)
T ss_pred             cCcCCCceeEcCC----------------------CCEEEEehHHhcC
Confidence            5778899999864                      8899999988753


No 490
>KOG0580|consensus
Probab=58.19  E-value=3.4  Score=33.00  Aligned_cols=16  Identities=25%  Similarity=0.499  Sum_probs=13.7

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      ..|+|++|.|+|+...
T Consensus       145 VIhRdiKpenlLlg~~  160 (281)
T KOG0580|consen  145 VIHRDIKPENLLLGSA  160 (281)
T ss_pred             cccCCCCHHHhccCCC
Confidence            4699999999998764


No 491
>KOG4721|consensus
Probab=57.81  E-value=5.2  Score=35.90  Aligned_cols=16  Identities=38%  Similarity=0.495  Sum_probs=14.4

Q ss_pred             EEecccCCCceeeecC
Q psy15665         12 FCHNDLQEGNILYRES   27 (107)
Q Consensus        12 fcHnDl~~gNiL~~~~   27 (107)
                      +.|+||+.-|||+...
T Consensus       233 IIHRDLKSPNiLIs~~  248 (904)
T KOG4721|consen  233 IIHRDLKSPNILISYD  248 (904)
T ss_pred             HhhhccCCCceEeecc
Confidence            6799999999999874


No 492
>PF13575 DUF4135:  Domain of unknown function (DUF4135)
Probab=56.56  E-value=7.7  Score=31.19  Aligned_cols=26  Identities=31%  Similarity=0.200  Sum_probs=21.4

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      +|+|..||+...                       ..-++||.|-..-.
T Consensus       153 ~DlH~ENIIa~g-----------------------~~PvlIDlETlf~~  178 (370)
T PF13575_consen  153 TDLHFENIIASG-----------------------EYPVLIDLETLFHP  178 (370)
T ss_pred             CcccccceEEeC-----------------------CCcEEEehhhhCCc
Confidence            699999999987                       45689999977654


No 493
>KOG0914|consensus
Probab=56.52  E-value=13  Score=29.41  Aligned_cols=54  Identities=13%  Similarity=0.260  Sum_probs=49.0

Q ss_pred             CCeEEEeeecCCCCchhhhHHHHHHHhhhccCCCCCCceeecCCCCCCHHHHhhc
Q psy15665         50 IDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRNSS  104 (107)
Q Consensus        50 ~~l~lIDfEYa~~n~r~fDlanhf~E~~~dy~~~~~p~~~~~~~~~Pt~~~~~~~  104 (107)
                      ....+|-| |+.+++.+--.+-.|.|....|+.+...+=+++-.+||..++|..+
T Consensus       144 ~t~WlIeF-fa~ws~~Cv~~spvfaeLS~kyn~~~lkFGkvDiGrfpd~a~kfri  197 (265)
T KOG0914|consen  144 RTYWLIEF-FACWSPKCVRFSPVFAELSIKYNNNLLKFGKVDIGRFPDVAAKFRI  197 (265)
T ss_pred             ceEEEEEE-EeecChhhcccccccHHHHHHhCCCCCcccceeeccCcChHHheee
Confidence            66899998 8999999999999999999999999888888999999999998643


No 494
>KOG0033|consensus
Probab=55.15  E-value=8.6  Score=31.25  Aligned_cols=17  Identities=29%  Similarity=0.499  Sum_probs=14.6

Q ss_pred             EEEecccCCCceeeecC
Q psy15665         11 TFCHNDLQEGNILYRES   27 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~   27 (107)
                      .+.|+|++|.|+|+-.+
T Consensus       130 ~IvHRDvkP~nllLASK  146 (355)
T KOG0033|consen  130 GIVHRDLKPENLLLASK  146 (355)
T ss_pred             CceeccCChhheeeeec
Confidence            46799999999998775


No 495
>cd05174 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), class IA, delta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=54.70  E-value=9.1  Score=31.53  Aligned_cols=25  Identities=40%  Similarity=0.442  Sum_probs=20.7

Q ss_pred             cccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         15 NDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        15 nDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      +|=|.+|||++.+                      +.++-|||-+.-
T Consensus       213 GDRHn~NILi~~~----------------------G~l~HIDFG~il  237 (361)
T cd05174         213 GDRHSDNIMIRES----------------------GQLFHIDFGHFL  237 (361)
T ss_pred             cCcCccceeEcCC----------------------CCEEEEehHHhh
Confidence            5778899999864                      889999998754


No 496
>cd00894 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=54.55  E-value=11  Score=31.18  Aligned_cols=28  Identities=32%  Similarity=0.320  Sum_probs=22.5

Q ss_pred             ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCC
Q psy15665         14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYN   63 (107)
Q Consensus        14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n   63 (107)
                      =+|=|.+|||++.+                      +.++-|||-|.-=+
T Consensus       216 IgDRHndNImi~~~----------------------G~lfHIDFG~ilg~  243 (365)
T cd00894         216 IGDRHNDNIMITET----------------------GNLFHIDFGHILGN  243 (365)
T ss_pred             ccCccccceeEcCC----------------------CCEEEEeeHHhhCC
Confidence            35778899999974                      88999999876544


No 497
>KOG0614|consensus
Probab=54.12  E-value=7.8  Score=34.25  Aligned_cols=28  Identities=25%  Similarity=0.396  Sum_probs=22.8

Q ss_pred             EEEecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecC
Q psy15665         11 TFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYC   60 (107)
Q Consensus        11 VfcHnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa   60 (107)
                      -+.-+||+|.|+|+...                      +=+.|+||-+|
T Consensus       540 ~iIYRDLKPENllLd~~----------------------Gy~KLVDFGFA  567 (732)
T KOG0614|consen  540 GIIYRDLKPENLLLDNR----------------------GYLKLVDFGFA  567 (732)
T ss_pred             CceeccCChhheeeccC----------------------CceEEeehhhH
Confidence            35568999999999885                      77899998655


No 498
>KOG2464|consensus
Probab=53.62  E-value=4.6  Score=30.85  Aligned_cols=23  Identities=35%  Similarity=0.580  Sum_probs=19.0

Q ss_pred             cCCCCeEEEecccCCCceeeecC
Q psy15665          5 KIKSPVTFCHNDLQEGNILYRES   27 (107)
Q Consensus         5 ~~~~~~VfcHnDl~~gNiL~~~~   27 (107)
                      ..+...-|-|+|++.||||+...
T Consensus       152 i~~~~~~~~hrdl~~gnili~k~  174 (246)
T KOG2464|consen  152 IAEKSLGFEHRDLHLGNILIKKT  174 (246)
T ss_pred             HhhhhhcccccccCcCcEEEecc
Confidence            34566788999999999999874


No 499
>cd05176 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), class II, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=53.41  E-value=11  Score=30.96  Aligned_cols=26  Identities=27%  Similarity=0.314  Sum_probs=21.3

Q ss_pred             ecccCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCC
Q psy15665         14 HNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCS   61 (107)
Q Consensus        14 HnDl~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~   61 (107)
                      =+|=|.+|||++.+                      +.++-|||-|.-
T Consensus       206 IgDRHn~NILi~~~----------------------Ghl~HIDFG~il  231 (353)
T cd05176         206 ICDRHNDNIMLRST----------------------GHMFHIDFGKFL  231 (353)
T ss_pred             ccCcCCcceEEcCC----------------------CCEEEEeeHHhc
Confidence            35778899999864                      889999998863


No 500
>KOG0903|consensus
Probab=53.17  E-value=11  Score=34.22  Aligned_cols=27  Identities=33%  Similarity=0.458  Sum_probs=20.9

Q ss_pred             cCCCceeeecCCCCCCCCCCCCCCCCCCCCCCCCCeEEEeeecCCCCch
Q psy15665         17 LQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYR   65 (107)
Q Consensus        17 l~~gNiL~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~lIDfEYa~~n~r   65 (107)
                      =|=||||++..                      +.++-|||-+.--|-+
T Consensus       702 RHNGNILiD~E----------------------GHIIHIDFGFmLsnsP  728 (847)
T KOG0903|consen  702 RHNGNILIDEE----------------------GHIIHIDFGFMLSNSP  728 (847)
T ss_pred             ccCCceEecCC----------------------CCEEEEeeeeEecCCC
Confidence            34499999985                      8999999997654444


Done!