Diaphorina citri psyllid: psy15665

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
KHLLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRNSSWVY
cccccccccEEEEEcccccccEEEEccccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHcccccccccccccccccccccHHHHHccccc
******KSPVTFCHNDLQEGNILYRE*******************NNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRNSSWVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KHLLKIKSPVTFCHNDLQEGNILYRESPNNNNSSNNNNNNNNNNNNNNNIDLVVIDFEYCSYNYRAFDIANHFVESVYDYSYKHFPHYTVKRENYPSYSLRNSSWVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004305 [MF]ethanolamine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0033265 [MF]choline bindingprobableGO:0043169, GO:0043178, GO:0050997, GO:0043167, GO:0036094, GO:0003674, GO:0005488
GO:0016310 [BP]phosphorylationprobableGO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0004104 [MF]cholinesterase activityprobableGO:0016787, GO:0003674, GO:0016788, GO:0052689, GO:0003824
GO:0004103 [MF]choline kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0006657 [BP]CDP-choline pathwayprobableGO:0006656, GO:0006650, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:0044255, GO:1901576, GO:0044710, GO:0044711, GO:0008150, GO:0071704, GO:0006644, GO:0006629, GO:0009308, GO:0045017, GO:0046165, GO:0009987, GO:0044106, GO:0009058, GO:0042439, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:1901564, GO:0006576, GO:1901566, GO:0008654, GO:0044237, GO:0046470, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:1901617, GO:1901615
GO:0019695 [BP]choline metabolic processprobableGO:0044710, GO:1901564, GO:0009308, GO:0006576, GO:0071704, GO:0009987, GO:0044237, GO:0006066, GO:0044106, GO:0034641, GO:0006807, GO:0042439, GO:0044281, GO:0008152, GO:0008150, GO:1901615

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NW1, chain A
Confidence level:very confident
Coverage over the Query: 4-26,51-104
View the alignment between query and template
View the model in PyMOL