Diaphorina citri psyllid: psy15688


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MCPGLTSPGAIITPVDKGTIVSIMAEGKQHALAIGLTTLSTDDIVRVNKGIGVENFHYLNDGLWNMKNIK
cccccccccccccccccccEEEEEEcccccEEEEEEEcccHHHHHHcccccCEEEEEEEccccccccccc
MCPGLTSPGAIITPVDKGTIVSIMAEGKQHALAIGLTTLSTDDIVRVNKGIGVENFHYLNDGLWNMKN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCPGLTSPGAIITPVDKGTIVSIMAEGKQHALAIGLTTLSTDDIVRVNKGIGVENFHYLNDGLWNMKNIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Malignant T-cell-amplified sequence 1 homolog May play a role in cell cycle regulation. May play a role as translation enhancer by binding to the cap complex of the 5'-terminus of mRNAs.confidentQ86KL4
Malignant T-cell-amplified sequence 1 Plays a role as translation enhancer and involved in cell cycle regulation.confidentQ5ZI42
Translation machinery-associated protein 20 Involved in translation.confidentQ75AA8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R90, chain A
Confidence level:very confident
Coverage over the Query: 1-70
View the alignment between query and template
View the model in PyMOL