Diaphorina citri psyllid: psy15692


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MVRALRHGVEGMLESRLRSSSMYESIYEPINPRPPSDLSSRSNYSLYSSNIPPPEAEVDALTDLLVHSLDTSSESDLFGECCKCGERILGEGSGCTAMDKVYHISCFTCDHCAVQLEGKPFYIIEGHAYCEQGYLDTLEKCSVCVKPILDRILRATGRPYHPACFTCVVCGKSLDGIPFTVDAANQIHCIQDFHKKFAPRCCVCRAPIMPDSEQDETVRVVALDRSFHIGCYRCEDCGLVLSSEAEGRGCYPLDDHVLCKSCNAKRVQALTSTMVTEL
cHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEccEEcccccccccccccccccccHHccccccccccccccccccccccccccccccEEcccccccccccHHcccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccCCcccccccHHHHHHHHHcccccccccc
***********************************************************ALTDLLVHSLDTSSESDLFGECCKCGERILGEGSGCTAMDKVYHISCFTCDHCAVQLEGKPFYIIEGHAYCEQGYLDTLEKCSVCVKPILDRILRATGRPYHPACFTCVVCGKSLDGIPFTVDAANQIHCIQDFHKKFAPRCCVCRAPIMPDSEQDETVRVVALDRSFHIGCYRCEDCGLVLSSEAEGRGCYPLDDHVLCKSCNAKRVQALTSTM****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRALRHGVEGMLESRLRSSSMYESIYEPINPRPPSDLSSRSNYSLYSSNIPPPEAEVDALTDLLVHSLDTSSESDLFGECCKCGERILGEGSGCTAMDKVYHISCFTCDHCAVQLEGKPFYIIEGHAYCEQGYLDTLEKCSVCVKPILDRILRATGRPYHPACFTCVVCGKSLDGIPFTVDAANQIHCIQDFHKKFAPRCCVCRAPIMPDSEQDETVRVVALDRSFHIGCYRCEDCGLVLSSEAEGRGCYPLDDHVLCKSCNAKRVQALTSTMVTEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipoma-preferred partner homolog May play a structural role at sites of cell adhesion in maintaining cell shape and motility. May be involved in signal transduction from cell adhesion sites to the nucleus.confidentQ5F464
Thyroid receptor-interacting protein 6 Relays signals from the cell surface to the nucleus to weaken adherens junction and promote actin cytoskeleton reorganization and cell invasiveness. Involved in lysophosphatidic acid-induced cell adhesion and migration. Acts as a transcriptional coactivator for NF-kappa-B and JUN, and mediates the transrepression of these transcription factors induced by glucocorticoid receptor.confidentQ15654
Lipoma-preferred partner homolog May play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. May be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion. Also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.confidentQ5XI07

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035003 [CC]subapical complexprobableGO:0032991, GO:0043296, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005911, GO:0005886, GO:0044425, GO:0044459, GO:0030054
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0007593 [BP]chitin-based cuticle sclerotizationprobableGO:0032502, GO:0032501, GO:0044707, GO:0042303, GO:0007591, GO:0044767, GO:0022404, GO:0008150, GO:0010259, GO:0044699
GO:0035002 [BP]liquid clearance, open tracheal systemprobableGO:0060541, GO:0007424, GO:0048856, GO:0042044, GO:0042045, GO:0044707, GO:0006810, GO:0051179, GO:0032502, GO:0044765, GO:0032501, GO:0008150, GO:0048731, GO:0051234, GO:0007275, GO:0044699
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005913 [CC]cell-cell adherens junctionprobableGO:0005575, GO:0030054, GO:0070161, GO:0005912, GO:0005911
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0048526 [BP]imaginal disc-derived wing expansionprobableGO:0048563, GO:0048589, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0040007, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0060560, GO:0032502, GO:0048707, GO:0009886, GO:0044767, GO:0008150, GO:0035114, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0005149 [MF]interleukin-1 receptor bindingprobableGO:0005126, GO:0070851, GO:0003674, GO:0005488, GO:0005515, GO:0005102
GO:0045323 [CC]interleukin-1 receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0007430 [BP]terminal branching, open tracheal systemprobableGO:0032502, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0060541, GO:0032501, GO:0035239, GO:0060446, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0007424, GO:0044707, GO:0048856, GO:0048731
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0035331 [BP]negative regulation of hippo signaling cascadeprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0035330, GO:0050789, GO:0048523
GO:0045572 [BP]positive regulation of imaginal disc growthprobableGO:0048639, GO:0048638, GO:0045927, GO:0051094, GO:0046620, GO:0046622, GO:0040008, GO:0050789, GO:0050793, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0045570, GO:0051240
GO:0045805 [BP]positive regulation of eclosionprobableGO:0051094, GO:0050793, GO:0051240, GO:0007563, GO:0008150, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0035329 [BP]hippo signaling cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0008588 [BP]release of cytoplasmic sequestered NF-kappaBprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0023051, GO:0048583, GO:0023052, GO:0007165, GO:0042306, GO:0035556, GO:0010646, GO:0010627, GO:0050789, GO:0044699, GO:0032880, GO:0051716, GO:0051223, GO:0009966, GO:0051050, GO:0065007, GO:0048518, GO:0048519, GO:0043122, GO:0070201, GO:1900180, GO:0009987, GO:0090316, GO:0050794, GO:0008150, GO:0051222, GO:0042307, GO:0007154, GO:0032879, GO:0042993, GO:0042990, GO:0044700, GO:0042346, GO:0042345, GO:0050896, GO:0007249, GO:0046824, GO:0046822, GO:0007243, GO:0044763, GO:0048523
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0031430 [CC]M bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0031672, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RUT, chain X
Confidence level:very confident
Coverage over the Query: 78-199,216-234
View the alignment between query and template
View the model in PyMOL
Template: 1RUT, chain X
Confidence level:very confident
Coverage over the Query: 139-268
View the alignment between query and template
View the model in PyMOL