BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15695
(299 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2W6E|G Chain G, Low Resolution Structures Of Bovine Mitochondrial
F1-Atpase During Controlled Dehydration: Hydration State
1.
pdb|2W6F|G Chain G, Low Resolution Structures Of Bovine Mitochondrial
F1-Atpase During Controlled Dehydration: Hydration State
2.
pdb|2W6I|G Chain G, Low Resolution Structures Of Bovine Mitochondrial
F1-Atpase During Controlled Dehydration: Hydration State
4b.
pdb|2W6J|G Chain G, Low Resolution Structures Of Bovine Mitochondrial
F1-Atpase During Controlled Dehydration: Hydration State
5.
pdb|2W6G|G Chain G, Low Resolution Structures Of Bovine Mitochondrial
F1-Atpase During Controlled Dehydration: Hydration State
3.
pdb|2W6H|G Chain G, Low Resolution Structures Of Bovine Mitochondrial
F1-Atpase During Controlled Dehydration: Hydration State
4a
Length = 298
Score = 28.9 bits (63), Expect = 3.8, Method: Compositional matrix adjust.
Identities = 15/54 (27%), Positives = 36/54 (66%), Gaps = 2/54 (3%)
Query: 79 ALTDLLVHSLDTSSESDLFAIEKVHSICNSSKSSNELIAEITTLFHCIRYPVVS 132
+L +++ +SL S+ S+ A ++ ++ N+SK+++E+I ++T F+ R V++
Sbjct: 233 SLANIIYYSLKESTTSEQSA--RMTAMDNASKNASEMIDKLTLTFNRTRQAVIT 284
>pdb|1COW|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B
pdb|1EFR|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With The Peptide
Antibiotic Efrapeptin
pdb|1BMF|G Chain G, Bovine Mitochondrial F1-Atpase
pdb|1NBM|G Chain G, The Structure Of Bovine F1-Atpase Covalently Inhibited
With 4-Chloro-7-Nitrobenzofurazan
pdb|1QO1|G Chain G, Molecular Architecture Of The Rotary Motor In Atp Synthase
From Yeast Mitochondria
pdb|1E1Q|G Chain G, Bovine Mitochondrial F1-Atpase At 100k
pdb|1E1R|G Chain G, Bovine Mitochondrial F1-Atpase Inhibited By Mg2+adp And
Aluminium Fluoride
pdb|1E79|G Chain G, Bovine F1-Atpase Inhibited By Dccd
(Dicyclohexylcarbodiimide)
pdb|1H8H|G Chain G, Bovine Mitochondrial F1-Atpase Crystallised In The
Presence Of 5mm Amppnp
pdb|1H8E|G Chain G, (Adp.Alf4)2(Adp.So4) Bovine F1-Atpase (All Three Catalytic
Sites Occupied)
pdb|1W0J|G Chain G, Beryllium Fluoride Inhibited Bovine F1-Atpase
pdb|1W0K|G Chain G, Beryllium Fluoride Inhibited Bovine F1-Atpase
pdb|2CK3|G Chain G, Azide Inhibited Bovine F1-Atpase
pdb|2JIZ|G Chain G, The Structure Of F1-Atpase Inhibited By Resveratrol.
pdb|2JIZ|N Chain N, The Structure Of F1-Atpase Inhibited By Resveratrol.
pdb|2JJ1|G Chain G, The Structure Of F1-Atpase Inhibited By Piceatannol.
pdb|2JJ1|N Chain N, The Structure Of F1-Atpase Inhibited By Piceatannol.
pdb|2JJ2|G Chain G, The Structure Of F1-atpase Inhibited By Quercetin.
pdb|2JJ2|N Chain N, The Structure Of F1-atpase Inhibited By Quercetin.
pdb|2V7Q|G Chain G, The Structure Of F1-Atpase Inhibited By I1-60his, A
Monomeric Form Of The Inhibitor Protein, If1.
pdb|2WSS|G Chain G, The Structure Of The Membrane Extrinsic Region Of Bovine
Atp Synthase
pdb|2WSS|P Chain P, The Structure Of The Membrane Extrinsic Region Of Bovine
Atp Synthase
pdb|2XND|G Chain G, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp
Synthase
Length = 272
Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust.
Identities = 16/66 (24%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
Query: 79 ALTDLLVHSLDTSSESDLFAIEKVHSICNSSKSSNELIAEITTLFHCIRYPVVSVGVIRW 138
+L +++ +SL S+ S+ A ++ ++ N+SK+++E+I ++T F+ R V++ +I
Sbjct: 208 SLANIIYYSLKESTTSEQSA--RMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEI 265
Query: 139 VECTVT 144
+
Sbjct: 266 ISGAAA 271
>pdb|2JDI|G Chain G, Ground State Structure Of F1-Atpase From Bovine Heart
Mitochondria (Bovine F1-Atpase Crystallised In The
Absence Of Azide)
pdb|4ASU|G Chain G, F1-Atpase In Which All Three Catalytic Sites Contain Bound
Nucleotide, With Magnesium Ion Released In The Empty
Site
Length = 273
Score = 28.5 bits (62), Expect = 4.2, Method: Compositional matrix adjust.
Identities = 16/66 (24%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
Query: 79 ALTDLLVHSLDTSSESDLFAIEKVHSICNSSKSSNELIAEITTLFHCIRYPVVSVGVIRW 138
+L +++ +SL S+ S+ A ++ ++ N+SK+++E+I ++T F+ R V++ +I
Sbjct: 208 SLANIIYYSLKESTTSEQSA--RMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEI 265
Query: 139 VECTVT 144
+
Sbjct: 266 ISGAAA 271
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.137 0.419
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,560,492
Number of Sequences: 62578
Number of extensions: 313360
Number of successful extensions: 519
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 519
Number of HSP's gapped (non-prelim): 3
length of query: 299
length of database: 14,973,337
effective HSP length: 98
effective length of query: 201
effective length of database: 8,840,693
effective search space: 1776979293
effective search space used: 1776979293
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)