Diaphorina citri psyllid: psy15698


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------
MSQCCSDDVYSSCSYSENSDSYVQDVECIRQIKDNGEKERLSRVKCKQKCNLHKEFIVTFRGYYKSAARSRYIAAALNNSDSVLRWEILQRKNPATDFPSDFDVVLLEEVTAALSSLLEHPLIKRVTPQRLVHRSLQFIPEQRHGSEGVKDEDGSEGVEKEADVRPLRRTSLGVQSQFWQATGRLTSRRLLKTVPRQITSILQANTLWDLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGLIASSQRCLGFAPDAELHIFRVFTNQQVSYTSWFLDAFNYAILKKMDVLNLSIGGPDFMDFPFVDKVWELTANRVILISAIGNDGPLYGTLNNPADQMDVIGVGGINFEDQIAKFSSRGMTAWELPGGYGRVKPDIVTYGSAVRGPSTNGECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEVSIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGIKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKYEQRKAPSDWFKDFCSSQF
ccccccccccccccccccccccccccEEEEccccccHHHHHcccccccccccccEEEEEEcccccHHHHHHHHHHHHcccccccccEEECccccccccccccEEEEEcHHHHHHHHHccccccCECccccCEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccHHHHcccccccccEEEEEccccccccccccccccCCcccccccccccccccHHHHHHHHcccccEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccEEEEEEECccccccccccccccccccccccccccccEEcccccEEccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHccccccccccccccEEEEEECccccEEEEEEEEECcccCEECcccccccccCEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccCEECccccc
**************Y******YVQDVECIRQIKD*****RLSRVKCKQKCNLHKEFIVTFRGYYKSAARSRYIAAALNNSDSVLRWEILQRKNPATDFPSDFDVVLLEEVTAALSSLLEHPLIKRVTPQRLVHRSLQFIPEQR**SEGVKDEDGSEGVEKEADVRPLRRT*LGVQSQFWQATGRLTSRRLLKTVPRQITSILQANTLWDLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGLIASSQRCLGFAPDAELHIFRVFTNQQVSYTSWFLDAFNYAILKKMDVLNLSIGGPDFMDFPFVDKVWELTANRVILISAIGNDGPLYGTLNNPADQMDVIGVGGINFEDQIAKFSSRGMTAWELPGGYGRVKPDIVTYGSAVRGPSTNGECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEVSIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGIKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKYEQRKAPSDWFKDFCSSQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQCCSDDVYSSCSYSENSDSYVQDVECIRQIKDNGEKERLSRVKCKQKCNLHKEFIVTFRGYYKSAARSRYIAAALNNSDSVLRWEILQRKNPATDFPSDFDVVLLEEVTAALSSLLEHPLIKRVTPQRLVHRSLQFIPEQRHGSEGVKDEDGSEGVEKEADVRPLRRTSLGVQSQFWQATGRLTSRRLLKTVPRQITSILQANTLWDLGIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGLIASSQRCLGFAPDAELHIFRVFTNQQVSYTSWFLDAFNYAILKKMDVLNLSIGGPDFMDFPFVDKVWELTANRVILISAIGNDGPLYGTLNNPADQMDVIGVGGINFEDQIAKFSSRGMTAWELPGGYGRVKPDIVTYGSAVRGPSTNGECQYMWPYCTQPLYHGAIPIIVNVTILNGMGVVGKILERPKWYPYLPHNGEFLEVSIRGSGVKVAVFDTGLSSGHTGFNNVAERTDWTNENTLEDKLGHGTFVAGIKRILWDQYHNLRYPQGYFPRDNLKMKNDPLDWNGDHVHTNFKYEQRKAPSDWFKDFCSSQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Membrane-bound transcription factor site-1 protease Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu.confidentQ9WTZ3
Membrane-bound transcription factor site-1 protease Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu.confidentQ9WTZ2
Membrane-bound transcription factor site-1 protease Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu.confidentQ14703

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0006629 [BP]lipid metabolic processprobableGO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0042990 [BP]regulation of transcription factor import into nucleusprobableGO:0033157, GO:0070201, GO:0032879, GO:0060341, GO:1900180, GO:0051049, GO:0032386, GO:0050794, GO:0008150, GO:0065007, GO:0046822, GO:0042306, GO:0051223, GO:0050789, GO:0032880
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005795 [CC]Golgi stackprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IXT, chain A
Confidence level:very confident
Coverage over the Query: 200-447
View the alignment between query and template
View the model in PyMOL
Template: 3AFG, chain A
Confidence level:very confident
Coverage over the Query: 54-135,201-458
View the alignment between query and template
View the model in PyMOL
Template: 3T41, chain A
Confidence level:very confident
Coverage over the Query: 52-162,181,200-382,394-460
View the alignment between query and template
View the model in PyMOL
Template: 1R6V, chain A
Confidence level:very confident
Coverage over the Query: 51-141,153-381,394-468
View the alignment between query and template
View the model in PyMOL
Template: 1EA7, chain A
Confidence level:probable
Coverage over the Query: 189-379
View the alignment between query and template
View the model in PyMOL