BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15701
         (112 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HVN|A Chain A, Crystal Structure Of Cytotoxin Protein Suilysin From
           Streptococcus Suis
          Length = 508

 Score = 26.6 bits (57), Expect = 3.6,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 34  FWNVDYN-----VGRRIITVWAVVMYIGQSLKDVIQWPRP 68
           +W   Y+     VG+R IT+W   +Y  Q   +VI+  RP
Sbjct: 467 WWRTVYDKDLPLVGQRKITIWGTTLY-PQYADEVIELERP 505


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.143    0.487 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,526,700
Number of Sequences: 62578
Number of extensions: 130105
Number of successful extensions: 222
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 221
Number of HSP's gapped (non-prelim): 2
length of query: 112
length of database: 14,973,337
effective HSP length: 76
effective length of query: 36
effective length of database: 10,217,409
effective search space: 367826724
effective search space used: 367826724
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)