Diaphorina citri psyllid: psy15701

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
SSFTVKNKFLYYFFYIGTYLGDEIFYSIYFPFWFWNVDYNVGRRIITVWAVVMYIGQSLKDVIQWPRPICPPAVRVQSKWSLEYGMPSTHAMIAVAIPMASILFTVDKYNYL
cccEEccHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccc
**FTVKNKFLYYFFYIGTYLGDEIFYSIYFPFWFWNVDYNVGRRIITVWAVVMYIGQSLKDVIQWPRPICPPAVRVQSKWSLEYGMPSTHAMIAVAIPMASILFTVDKYNYL
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSFTVKNKFLYYFFYIGTYLGDEIFYSIYFPFWFWNVDYNVGRRIITVWAVVMYIGQSLKDVIQWPRPICPPAVRVQSKWSLEYGMPSTHAMIAVAIPMASILFTVDKYNYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sphingosine-1-phosphate phosphatase 1 Has enzymatic activity against both sphingosine 1-phosphate (S1P) and dihydro-S1P. Regulates intracellular and extracellular S1P levels.confidentQ9BX95
Sphingosine-1-phosphate phosphatase 1 Has enzymatic activity against both sphingosine 1-phosphate (S1P) and dihydro-S1P. Regulates intracellular and extracellular S1P levels.confidentQ9JI99
Sphingosine-1-phosphate phosphatase 1 Has enzymatic activity against both sphingosine 1-phosphate (S1P) and dihydro-S1P. Regulates intracellular and extracellular S1P levels.confidentQ99P55

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016020 [CC]membraneprobableGO:0005575
GO:0006668 [BP]sphinganine-1-phosphate metabolic processprobableGO:0044238, GO:0006644, GO:1901564, GO:0006643, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0006807, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255, GO:0006665, GO:0006629
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006670 [BP]sphingosine metabolic processprobableGO:0006066, GO:0044710, GO:0009987, GO:1901564, GO:0006643, GO:0044238, GO:0006629, GO:0019751, GO:0044237, GO:0034311, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0046519, GO:0044255, GO:0006665, GO:1901615
GO:0042392 [MF]sphingosine-1-phosphate phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0016311 [BP]dephosphorylationprobableGO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2T, chain A
Confidence level:confident
Coverage over the Query: 6-107
View the alignment between query and template
View the model in PyMOL