Diaphorina citri psyllid: psy1571


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MKLEQLVPNYLPSVSAAIGNYTLQRIVFTSAIVLHTGPRIIYLLAYQEYYREVLKRRSLYLAQIAALLNIIEIVSLLALTLVPSAVNYPIHEKCFITFILTSEVYMIVTCWIYKKERQLPFNNLESRSFNLKLKCFVLNIFCFSIAGYCFLRHNAYCEPGDINK
cccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*KLEQLVPNYLPSVSAAIGNYTLQRIVFTSAIVLHTGPRIIYLLAYQEYYREVLKRRSLYLAQIAALLNIIEIVSLLALTLVPSAVNYPIHEKCFITFILTSEVYMIVTCWIYKKERQLPFNNLESRSFNLKLKCFVLNIFCFSIAGYCFLRHNAYCE**D***
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLEQLVPNYLPSVSAAIGNYTLQRIVFTSAIVLHTGPRIIYLLAYQEYYREVLKRRSLYLAQIAALLNIIEIVSLLALTLVPSAVNYPIHEKCFITFILTSEVYMIVTCWIYKKERQLPFNNLESRSFNLKLKCFVLNIFCFSIAGYCFLRHNAYCEPGDINK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Post-GPI attachment to proteins factor 2 Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface.confidentQ2ABP2
Post-GPI attachment to proteins factor 2 Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface.confidentQ2ABP3
Post-GPI attachment to proteins factor 2 Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface.confidentA6H7B8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted