BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1572
         (74 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3AXJ|B Chain B, High Resolution Crystal Structure Of C3po
          Length = 298

 Score = 26.2 bits (56), Expect = 4.5,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 18/35 (51%)

Query: 31  FQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIE 65
            Q  +Q  TY   +CH   + + E K+V+   AI+
Sbjct: 121 LQEFIQAYTYXEYLCHEDAEGENETKSVSDWQAIQ 155


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.128    0.358 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,857,199
Number of Sequences: 62578
Number of extensions: 54048
Number of successful extensions: 104
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 85
Number of HSP's gapped (non-prelim): 25
length of query: 74
length of database: 14,973,337
effective HSP length: 44
effective length of query: 30
effective length of database: 12,219,905
effective search space: 366597150
effective search space used: 366597150
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)