Query         psy15724
Match_columns 360
No_of_seqs    154 out of 450
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:48:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15724.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15724hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2858|consensus               99.9 2.6E-25 5.5E-30  217.1   1.2  233   37-273    14-280 (390)
  2 KOG2858|consensus               99.6 1.4E-16   3E-21  156.3   1.0  195   41-264   186-390 (390)
  3 KOG2857|consensus               98.9 6.9E-10 1.5E-14   97.3   1.5   43   40-82      5-47  (157)
  4 PF04438 zf-HIT:  HIT zinc fing  98.8 7.1E-10 1.5E-14   73.6  -1.0   29   40-69      2-30  (30)
  5 KOG4317|consensus               98.6   4E-08 8.7E-13   96.1   3.4   70   40-113     7-78  (383)
  6 KOG3362|consensus               97.5 2.3E-05 5.1E-10   69.3   0.7   38   38-77    116-153 (156)
  7 PF01753 zf-MYND:  MYND finger;  92.7    0.03 6.4E-07   38.3  -0.2   29   43-72      1-30  (37)
  8 PF13824 zf-Mss51:  Zinc-finger  91.9     0.1 2.2E-06   39.5   1.7   24   42-65      1-28  (55)
  9 PF07754 DUF1610:  Domain of un  85.2    0.51 1.1E-05   30.0   1.3   18   43-60      1-24  (24)
 10 KOG0551|consensus               78.8     2.7 5.9E-05   42.7   4.4   97  166-274   273-373 (390)
 11 KOG1710|consensus               77.8    0.53 1.1E-05   46.9  -0.9   32   40-71    319-351 (396)
 12 PRK13130 H/ACA RNA-protein com  75.4     1.5 3.3E-05   33.3   1.2   26   38-63      3-28  (56)
 13 PRK14890 putative Zn-ribbon RN  73.4     1.3 2.7E-05   34.1   0.3   21   40-60     36-56  (59)
 14 PLN03158 methionine aminopepti  71.4     1.5 3.2E-05   45.2   0.4   33   37-70      6-46  (396)
 15 COG2888 Predicted Zn-ribbon RN  68.6     1.7 3.8E-05   33.5   0.2   22   39-60     37-58  (61)
 16 TIGR00622 ssl1 transcription f  67.0     2.7   6E-05   36.2   1.1   43   53-110     2-44  (112)
 17 PF13842 Tnp_zf-ribbon_2:  DDE_  65.4     4.3 9.3E-05   27.2   1.6   25   42-66      2-30  (32)
 18 PHA00626 hypothetical protein   63.6     3.8 8.3E-05   31.3   1.1   40   40-90     11-50  (59)
 19 cd00350 rubredoxin_like Rubred  54.9     7.1 0.00015   26.1   1.2   20   42-61      3-26  (33)
 20 PF04640 PLATZ:  PLATZ transcri  54.4       9  0.0002   30.5   1.9   26   36-67     45-70  (72)
 21 KOG2807|consensus               51.5     7.9 0.00017   39.2   1.4   60   38-113   261-322 (378)
 22 cd00729 rubredoxin_SM Rubredox  46.0      12 0.00026   25.3   1.2   20   42-61      4-27  (34)
 23 smart00154 ZnF_AN1 AN1-like Zi  43.7      15 0.00033   25.6   1.5   23   43-65      1-25  (39)
 24 COG5195 Uncharacterized conser  41.7      17 0.00038   31.0   1.8   30   36-66     62-91  (118)
 25 PF09862 DUF2089:  Protein of u  40.2      15 0.00033   31.7   1.3   20   43-62      1-22  (113)
 26 PF12387 Peptidase_C74:  Pestiv  35.9      17 0.00036   33.8   0.9   28   40-67    162-190 (200)
 27 COG5151 SSL1 RNA polymerase II  35.6      16 0.00036   36.8   0.9   60   40-115   295-356 (421)
 28 PF08265 YL1_C:  YL1 nuclear pr  35.4      22 0.00049   23.7   1.2   27   42-69      2-28  (30)
 29 TIGR00354 polC DNA polymerase,  33.0      21 0.00045   40.9   1.2   25   38-62    623-647 (1095)
 30 PLN00206 DEAD-box ATP-dependen  33.0      15 0.00033   38.6   0.2   35   40-75     28-62  (518)
 31 PRK00420 hypothetical protein;  32.9      29 0.00063   29.9   1.8   30   40-72     23-57  (112)
 32 PF00643 zf-B_box:  B-box zinc   32.9      19 0.00042   24.5   0.6   35   39-73      2-36  (42)
 33 COG2260 Predicted Zn-ribbon RN  32.5      24 0.00052   27.2   1.1   11   82-92     31-41  (59)
 34 PRK03824 hypA hydrogenase nick  31.8      20 0.00044   31.4   0.7   10   52-61    107-116 (135)
 35 PF01428 zf-AN1:  AN1-like Zinc  31.6      24 0.00051   24.9   0.9   33   46-81      6-39  (43)
 36 PF07282 OrfB_Zn_ribbon:  Putat  31.1      29 0.00063   26.2   1.4   21   41-61     29-55  (69)
 37 PRK14714 DNA polymerase II lar  31.0      26 0.00057   41.2   1.6   22   41-62    668-689 (1337)
 38 PRK14714 DNA polymerase II lar  31.0      27 0.00059   41.1   1.7   21   41-61    680-701 (1337)
 39 KOG1356|consensus               30.9      22 0.00047   40.1   0.9   34   38-72    227-262 (889)
 40 PF10122 Mu-like_Com:  Mu-like   30.9      18 0.00039   27.1   0.2   23   39-61      3-33  (51)
 41 smart00290 ZnF_UBP Ubiquitin C  30.1      34 0.00073   24.2   1.5   24   42-65      1-24  (50)
 42 PRK12380 hydrogenase nickel in  30.0      22 0.00048   30.2   0.7   25   37-61     67-95  (113)
 43 PRK00762 hypA hydrogenase nick  29.7      26 0.00056   30.3   1.0   24   37-61     67-101 (124)
 44 PF07150 DUF1390:  Protein of u  29.7      27 0.00059   33.6   1.3   40   51-92      6-47  (229)
 45 KOG4850|consensus               29.2      24 0.00052   32.4   0.8   35   37-72    132-169 (190)
 46 KOG4217|consensus               28.4      34 0.00074   36.4   1.8   24   37-63    266-289 (605)
 47 COG1592 Rubrerythrin [Energy p  28.3      34 0.00074   31.4   1.6   22   40-61    134-158 (166)
 48 COG4049 Uncharacterized protei  28.1      23 0.00049   27.3   0.3   13   49-61     14-26  (65)
 49 PRK04023 DNA polymerase II lar  27.5      50  0.0011   38.2   3.0   25   37-61    623-647 (1121)
 50 PF13894 zf-C2H2_4:  C2H2-type   27.4      13 0.00027   21.5  -0.9   20   53-72      1-20  (24)
 51 PRK00564 hypA hydrogenase nick  27.0      34 0.00075   29.2   1.3   25   37-61     68-97  (117)
 52 PF00096 zf-C2H2:  Zinc finger,  26.9      21 0.00046   21.0  -0.0   10   53-62      1-10  (23)
 53 PRK01343 zinc-binding protein;  26.8      39 0.00085   25.8   1.4   29   38-71      7-35  (57)
 54 TIGR00627 tfb4 transcription f  26.5      39 0.00084   33.4   1.7   29   37-66    239-269 (279)
 55 PF14206 Cys_rich_CPCC:  Cystei  26.4      29 0.00062   28.1   0.7   13   52-64      1-13  (78)
 56 PHA00616 hypothetical protein   26.1      12 0.00025   27.2  -1.4   21   52-72      1-21  (44)
 57 PF09855 DUF2082:  Nucleic-acid  25.2      31 0.00068   26.8   0.7   11   53-63      1-11  (64)
 58 PF14949 ARF7EP_C:  ARF7 effect  25.2      37  0.0008   28.9   1.2   32   38-70     58-92  (103)
 59 PF03884 DUF329:  Domain of unk  24.9      21 0.00046   27.2  -0.3    9   61-69     22-30  (57)
 60 COG4640 Predicted membrane pro  24.9      38 0.00083   35.3   1.4   26   40-65      1-28  (465)
 61 PF13465 zf-H2C2_2:  Zinc-finge  24.8      22 0.00048   22.3  -0.2   13   49-61     11-23  (26)
 62 COG1571 Predicted DNA-binding   23.9      40 0.00086   35.3   1.3   23   40-62    350-377 (421)
 63 PF07649 C1_3:  C1-like domain;  23.3      38 0.00083   21.8   0.7   20   42-61      2-24  (30)
 64 PF08271 TF_Zn_Ribbon:  TFIIB z  22.9      40 0.00087   23.5   0.8   10   53-62      1-10  (43)
 65 TIGR00100 hypA hydrogenase nic  22.3      43 0.00094   28.5   1.0   26   37-62     67-96  (115)
 66 cd01121 Sms Sms (bacterial rad  22.2      50  0.0011   33.7   1.7   20   42-61      2-23  (372)
 67 PF07975 C1_4:  TFIIH C1-like d  22.1      36 0.00078   25.4   0.4   29   50-79     19-48  (51)
 68 COG0675 Transposase and inacti  22.0      48   0.001   31.4   1.4   20   41-60    310-330 (364)
 69 PRK12496 hypothetical protein;  21.8      40 0.00088   30.5   0.8    7   55-61    146-152 (164)
 70 PRK03976 rpl37ae 50S ribosomal  21.0      47   0.001   27.6   1.0   13   50-62     34-46  (90)
 71 smart00531 TFIIE Transcription  21.0      47   0.001   29.3   1.0   14   50-63     97-110 (147)
 72 PRK14704 anaerobic ribonucleos  20.9      54  0.0012   35.9   1.7   24   37-60    556-580 (618)
 73 PRK03681 hypA hydrogenase nick  20.9      43 0.00094   28.5   0.8   26   37-62     67-97  (114)
 74 COG1997 RPL43A Ribosomal prote  20.7      47   0.001   27.6   0.9   13   50-62     33-45  (89)
 75 PF01780 Ribosomal_L37ae:  Ribo  20.5      43 0.00092   27.9   0.6   13   50-62     33-45  (90)
 76 PF01155 HypA:  Hydrogenase exp  20.2      33 0.00071   29.1  -0.1   26   37-62     67-96  (113)

No 1  
>KOG2858|consensus
Probab=99.90  E-value=2.6e-25  Score=217.10  Aligned_cols=233  Identities=16%  Similarity=0.137  Sum_probs=139.4

Q ss_pred             cCCccCcccCCCCCCcccCCCCCCccccccccccccccccccCCCCcccccc-CCCcc------hhhhhhhhhhHHHHHh
Q psy15724         37 VSRLGDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKRELECDGIRNKVKFIP-LQKFS------NLELQNDFNLLEEVSN  109 (360)
Q Consensus        37 ~~~~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd~t~fVp-~~~~~------~~~l~~DYnFLe~i~R  109 (360)
                      .....+|.||+.+++||+||||.++||||.|+++||...+|+|.|||..||| +++++      ++.|++|||||-+++|
T Consensus        14 ~~~~vlCgVClknE~KYkCPRCl~rtCsLeCskkHK~~dnCsG~rqp~t~Vp~l~q~d~~K~~~~q~v~~d~n~l~gvkr   93 (390)
T KOG2858|consen   14 GLHSVLCGVCLKNEPKYKCPRCLARTCSLECSKKHKIGDNCSGSRQPPTEVPMLDQPDTEKRLAGQWVEQDVNDLPGVKR   93 (390)
T ss_pred             ccchhhhhhcccCcccccCcchhhhheeccccccccccCCCcCCcCCcccccccccCCchhhhhhHHHHHHhhhhhcccc
Confidence            4567789999999999999999999999999999999999999999999999 45553      4689999999999999


Q ss_pred             h-hhhccCCCcc-----ccccCCCCCCchhHHHHHHHHHcCcEEE---EcCchhhhccccCcee--ccceEEEEEEEEEE
Q psy15724        110 S-LFKYKRDPVK-----NSVSMYNKLPHPLHILRKYAYMRKTQVK---FLPKLFTQHKINTSCV--YKNNLYWRVEWVFV  178 (360)
Q Consensus       110 ~-ve~~krd~~~-----r~~~~~~~lp~~~~~Lr~~a~~RgI~L~---~lP~gMsRrk~NtT~~--K~~~i~WtVEWiF~  178 (360)
                      . +...+.|...     +.....    .....++....|.+|+..   |+|+|+...+.|.+.+  +.+.|.|+|+|-|.
T Consensus        94 e~v~~qk~D~~~~~ke~kv~~Pe----v~r~~~k~~~eRy~in~~~~rfi~~g~k~e~ln~~~~~~~sd~ikW~i~~dlk  169 (390)
T KOG2858|consen   94 ENVVKQKTDSSLVVKEAKVGEPE----VKREKVKGEVERYSINKQEERFIGQGIKEELLNGECVKEESDFIKWEIVDDLK  169 (390)
T ss_pred             cccccccccccccccccccCCcc----cccccccchhhhhhhhhhhhhhcccchhhhhcchhhhhhhccchheeeeeeee
Confidence            7 6666666322     111110    111112222233333333   5566666666666666  56666666666665


Q ss_pred             CC-------ceeEeecccccccchhhHhhhccCCCc---hhhhhhcCCccchhhhhcCCCceEEeeec--cC----Ccce
Q psy15724        179 SG-------NLKHVDEKLIDSTRLCIPLTAHLDQPD---LAFYKAADQPDLAFYKAAGINGLLILMKV--ER----SSKF  242 (360)
Q Consensus       179 ~~-------~~~~v~~rv~E~~tL~~iL~k~l~~~~---~dp~~~~~~~kLk~y~~~~i~~l~vlmK~--E~----~~~y  242 (360)
                      -.       ++.-.....+|+....++.........   .-+.......+|..+...++++.+|++..  +.    ...+
T Consensus       170 v~s~~~il~p~~~k~~~~~eTi~te~~k~~~pr~k~y~clV~e~~k~v~ql~c~~~Rgidd~qf~e~~~s~~~R~~g~I~  249 (390)
T KOG2858|consen  170 VKSEPPILHPVGCKRKSRCETIGTEEAKYRCPRCKRYSCLVPEVKKHVAQLTCNGVRGIDDQQFTEMNLSDVARTAGHIS  249 (390)
T ss_pred             eeccCCCcCchhhhccccccchhhhhccccccchhhhceeccchhhhhhhhcccccccchHHHHHHHhccchhhhcceee
Confidence            10       111111233444433333332222210   00000012223443333466666666652  11    2223


Q ss_pred             EEccCCCcHHHhhcCCEEEECcEEEEEecCC
Q psy15724        243 YILDHTLSIAENLKNKCIIEFPIFYVIFNYE  273 (360)
Q Consensus       243 ~~LD~~kTL~enLrgKtVIEFPTI~V~l~~~  273 (360)
                      -..-+..++...+++-++++-|++.|.++..
T Consensus       250 ~k~~lk~~~s~~~~nf~k~~~~~k~vfl~~~  280 (390)
T KOG2858|consen  250 RKAFLKRPISNKYMNFMKNRARRKGVFLKLL  280 (390)
T ss_pred             hhcccccchhhhhhhhhheeccccchhHHHh
Confidence            3344556777777777777777777776655


No 2  
>KOG2858|consensus
Probab=99.60  E-value=1.4e-16  Score=156.26  Aligned_cols=195  Identities=26%  Similarity=0.441  Sum_probs=156.9

Q ss_pred             cCcccCCCCCCcccCCCCCCccccccccccccccccccCCCCccccccCCCcchhhhhhhhhh----HHHHHhhhhhccC
Q psy15724         41 GDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKRELECDGIRNKVKFIPLQKFSNLELQNDFNL----LEEVSNSLFKYKR  116 (360)
Q Consensus        41 ~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd~t~fVp~~~~~~~~l~~DYnF----Le~i~R~ve~~kr  116 (360)
                      +.|+.|....++|+||+|....|.+.|+++|+.+..|.+.|    ++           +|.+|    |++.+|..+...+
T Consensus       186 ~~~eTi~te~~k~~~pr~k~y~clV~e~~k~v~ql~c~~~R----gi-----------dd~qf~e~~~s~~~R~~g~I~~  250 (390)
T KOG2858|consen  186 SRCETIGTEEAKYRCPRCKRYSCLVPEVKKHVAQLTCNGVR----GI-----------DDQQFTEMNLSDVARTAGHISR  250 (390)
T ss_pred             ccccchhhhhccccccchhhhceeccchhhhhhhhcccccc----cc-----------hHHHHHHHhccchhhhcceeeh
Confidence            88999999999999999999999999999999999999998    33           23333    4556677666666


Q ss_pred             CCccccccCCCCCCchhHHHHHHHHHcCcEEEEcCchhhhccccCcee--ccceEEEEEEEEEECCceeEeecccccccc
Q psy15724        117 DPVKNSVSMYNKLPHPLHILRKYAYMRKTQVKFLPKLFTQHKINTSCV--YKNNLYWRVEWVFVSGNLKHVDEKLIDSTR  194 (360)
Q Consensus       117 d~~~r~~~~~~~lp~~~~~Lr~~a~~RgI~L~~lP~gMsRrk~NtT~~--K~~~i~WtVEWiF~~~~~~~v~~rv~E~~t  194 (360)
                      ++..+....+    .....++..+.+.||.|.+++.++..+.+|+|++  ++..|.|+++--|+.+...+...+++...+
T Consensus       251 k~~lk~~~s~----~~~nf~k~~~~~k~vfl~~~q~~~~e~lenst~~~~~~q~f~~~~~~d~pes~~~~~~nr~p~ekt  326 (390)
T KOG2858|consen  251 KAFLKRPISN----KYMNFMKNRARRKGVFLKLLQNGFTERLENSTFFDKKKQQFCWHVKLDFPESQAEYIENRVPDEKT  326 (390)
T ss_pred             hcccccchhh----hhhhhhheeccccchhHHHhhhhhhhhhccccccccCCceeeeeeeccCccchhhhhcccCCCccc
Confidence            6655433332    2355667788999999999999999999999999  678999999999998888888899999999


Q ss_pred             hhhHhhhccCCCchhhhhhcCCccchhhhhcCCCceEEeeeccC----CcceEEccCCCcHHHhhcCCEEEECc
Q psy15724        195 LCIPLTAHLDQPDLAFYKAADQPDLAFYKAAGINGLLILMKVER----SSKFYILDHTLSIAENLKNKCIIEFP  264 (360)
Q Consensus       195 L~~iL~k~l~~~~~dp~~~~~~~kLk~y~~~~i~~l~vlmK~E~----~~~y~~LD~~kTL~enLrgKtVIEFP  264 (360)
                      ...+...++++.+.++   ..+.+++       .+..+.++.+.    ..+||.|||-+++..+|+|+.++|||
T Consensus       327 ~N~~k~p~~D~e~~d~---~~r~r~~-------t~~~~~rk~~y~s~~~~~~ysldPy~p~l~~~~n~l~~ey~  390 (390)
T KOG2858|consen  327 INEIKKPYIDPEKSDP---VIRQRLK-------TGVQILRKIEYMSQNLVRYYSLDPYKPLLDNLRNKLIIEYP  390 (390)
T ss_pred             cccccCCCCCcccccc---hhhccCC-------CCchhhhccchhhhccccccccCCccchhhcccccccccCC
Confidence            9888777888877665   3333332       34445555544    56789999999999999999999998


No 3  
>KOG2857|consensus
Probab=98.86  E-value=6.9e-10  Score=97.31  Aligned_cols=43  Identities=35%  Similarity=0.925  Sum_probs=38.2

Q ss_pred             ccCcccCCCCCCcccCCCCCCccccccccccccccccccCCCC
Q psy15724         40 LGDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKRELECDGIRN   82 (360)
Q Consensus        40 ~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd   82 (360)
                      +..|.+|.+.+.||+||+|.++||||.|+|.||..-.|-..-+
T Consensus         5 t~tC~ic~e~~~KYKCpkC~vPYCSl~CfKiHk~tPq~~~ve~   47 (157)
T KOG2857|consen    5 TTTCVICLESEIKYKCPKCSVPYCSLPCFKIHKSTPQCETVED   47 (157)
T ss_pred             eeeehhhhcchhhccCCCCCCccccchhhhhccCCccccccCC
Confidence            6789999999999999999999999999999998667766543


No 4  
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=98.77  E-value=7.1e-10  Score=73.58  Aligned_cols=29  Identities=45%  Similarity=1.107  Sum_probs=23.4

Q ss_pred             ccCcccCCCCCCcccCCCCCCccccccccc
Q psy15724         40 LGDCEVCAIEPAKYTCPKCELKTCCLNCVN   69 (360)
Q Consensus        40 ~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k   69 (360)
                      ..+|.||+. .++|+||+|+.++|||+|+|
T Consensus         2 ~~~C~vC~~-~~kY~Cp~C~~~~CSl~C~k   30 (30)
T PF04438_consen    2 RKLCSVCGN-PAKYRCPRCGARYCSLACYK   30 (30)
T ss_dssp             -EEETSSSS-EESEE-TTT--EESSHHHHH
T ss_pred             cCCCccCcC-CCEEECCCcCCceeCcEeEC
Confidence            357999998 99999999999999999986


No 5  
>KOG4317|consensus
Probab=98.55  E-value=4e-08  Score=96.06  Aligned_cols=70  Identities=27%  Similarity=0.637  Sum_probs=47.5

Q ss_pred             ccCcccCCCCCCcccCCCCCCccccccccccccccccccCCCCccccccCCCcch--hhhhhhhhhHHHHHhhhhh
Q psy15724         40 LGDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKRELECDGIRNKVKFIPLQKFSN--LELQNDFNLLEEVSNSLFK  113 (360)
Q Consensus        40 ~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd~t~fVp~~~~~~--~~l~~DYnFLe~i~R~ve~  113 (360)
                      -..|.||++..+.||||||..+||||.||+.||.  +|+...-+-.-  ..++..  ++...--+.+|...|..+.
T Consensus         7 ~~~C~ic~vq~~~YtCPRCn~~YCsl~CYr~h~~--~CsE~FyrdqV--~~eL~~~r~d~s~k~km~e~lkr~~q~   78 (383)
T KOG4317|consen    7 FLACGICGVQKREYTCPRCNLLYCSLKCYRNHKH--SCSEKFYRDQV--KQELSGKRADISQKRKMGEELKRKMQK   78 (383)
T ss_pred             eeeccccccccccccCCCCCccceeeeeecCCCc--cchHHHHHHHH--HHHhhhccccccchhHHHHHHHHHHhh
Confidence            4579999999999999999999999999999995  59976422111  011111  2233334556666666554


No 6  
>KOG3362|consensus
Probab=97.55  E-value=2.3e-05  Score=69.32  Aligned_cols=38  Identities=32%  Similarity=0.822  Sum_probs=33.0

Q ss_pred             CCccCcccCCCCCCcccCCCCCCccccccccccccccccc
Q psy15724         38 SRLGDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKRELEC   77 (360)
Q Consensus        38 ~~~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~~~~C   77 (360)
                      .....|.||| ..++|.|-+||.+|||+.|.+.|.. +-|
T Consensus       116 P~r~fCaVCG-~~S~ysC~~CG~kyCsv~C~~~Hne-TRC  153 (156)
T KOG3362|consen  116 PLRKFCAVCG-YDSKYSCVNCGTKYCSVRCLKTHNE-TRC  153 (156)
T ss_pred             CcchhhhhcC-CCchhHHHhcCCceeechhhhhccc-ccc
Confidence            4456899999 5899999999999999999999974 555


No 7  
>PF01753 zf-MYND:  MYND finger;  InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MYND-type zinc finger domains. The MYND domain (myeloid, Nervy, and DEAF-1) is present in a large group of proteins that includes RP-8 (PDCD2), Nervy, and predicted proteins from Drosophila, mammals, Caenorhabditis elegans, yeast, and plants [, , ]. The MYND domain consists of a cluster of cysteine and histidine residues, arranged with an invariant spacing to form a potential zinc-binding motif []. Mutating conserved cysteine residues in the DEAF-1 MYND domain does not abolish DNA binding, which suggests that the MYND domain might be involved in protein-protein interactions []. Indeed, the MYND domain of ETO/MTG8 interacts directly with the N-CoR and SMRT co-repressors [, ]. Aberrant recruitment of co-repressor complexes and inappropriate transcriptional repression is believed to be a general mechanism of leukemogenesis caused by the t(8;21) translocations that fuse ETO with the acute myelogenous leukemia 1 (AML1) protein. ETO has been shown to be a co-repressor recruited by the promyelocytic leukemia zinc finger (PLZF) protein []. A divergent MYND domain present in the adenovirus E1A binding protein BS69 was also shown to interact with N-CoR and mediate transcriptional repression []. The current evidence suggests that the MYND motif in mammalian proteins constitutes a protein-protein interaction domain that functions as a co-repressor-recruiting interface. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3QWW_A 3QWV_A 3TG5_A 3S7F_A 3RIB_B 3TG4_A 3S7J_A 3S7D_A 3S7B_A 3RU0_A ....
Probab=92.72  E-value=0.03  Score=38.27  Aligned_cols=29  Identities=28%  Similarity=0.765  Sum_probs=23.5

Q ss_pred             cccCCCCCCcccCCCC-CCcccccccccccc
Q psy15724         43 CEVCAIEPAKYTCPKC-ELKTCCLNCVNIHK   72 (360)
Q Consensus        43 C~vC~~~~~kY~CP~C-~~~tCSl~C~k~Hk   72 (360)
                      |.+|+....+ +|++| .+.|||.+|-+.|-
T Consensus         1 C~~C~~~~~~-~C~~C~~~~YCs~~Cq~~~w   30 (37)
T PF01753_consen    1 CAVCGKPALK-RCSRCKSVYYCSEECQRADW   30 (37)
T ss_dssp             -TTTSSCSSE-EETTTSSSEESSHHHHHHHH
T ss_pred             CcCCCCCcCC-cCCCCCCEEecCHHHHHHHH
Confidence            7789986666 99999 78899999987764


No 8  
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=91.85  E-value=0.1  Score=39.51  Aligned_cols=24  Identities=33%  Similarity=0.944  Sum_probs=18.7

Q ss_pred             CcccCCC---CCCcccCCCCCCcc-ccc
Q psy15724         42 DCEVCAI---EPAKYTCPKCELKT-CCL   65 (360)
Q Consensus        42 ~C~vC~~---~~~kY~CP~C~~~t-CSl   65 (360)
                      +|.+|..   ....|.||.||++| ||-
T Consensus         1 ~Cpv~~~~~~~~v~~~Cp~cGipthcS~   28 (55)
T PF13824_consen    1 LCPVCKKDLPAHVNFECPDCGIPTHCSE   28 (55)
T ss_pred             CCCCCccccccccCCcCCCCCCcCccCH
Confidence            4777876   35799999999987 554


No 9  
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=85.18  E-value=0.51  Score=30.01  Aligned_cols=18  Identities=28%  Similarity=1.071  Sum_probs=14.0

Q ss_pred             cccC------CCCCCcccCCCCCC
Q psy15724         43 CEVC------AIEPAKYTCPKCEL   60 (360)
Q Consensus        43 C~vC------~~~~~kY~CP~C~~   60 (360)
                      |..|      .+....|.||.|+.
T Consensus         1 C~sC~~~i~~r~~~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGRPIAPREQAVPFPCPNCGF   24 (24)
T ss_pred             CccCCCcccCcccCceEeCCCCCC
Confidence            6667      55577999999983


No 10 
>KOG0551|consensus
Probab=78.82  E-value=2.7  Score=42.72  Aligned_cols=97  Identities=15%  Similarity=0.241  Sum_probs=68.3

Q ss_pred             cceEEEEEEEEEE-CCceeEeecccccccchhhHhhhccCCCchhhhhhcCCccchhhhhcCCCceEEeeeccCCcceEE
Q psy15724        166 KNNLYWRVEWVFV-SGNLKHVDEKLIDSTRLCIPLTAHLDQPDLAFYKAADQPDLAFYKAAGINGLLILMKVERSSKFYI  244 (360)
Q Consensus       166 ~~~i~WtVEWiF~-~~~~~~v~~rv~E~~tL~~iL~k~l~~~~~dp~~~~~~~kLk~y~~~~i~~l~vlmK~E~~~~y~~  244 (360)
                      ..+++|-+=+.+| ..+.-|+ ..++|.+|..++|.-+|..+..-       +.-+.|   .+.+|.|||..+... +++
T Consensus       273 ~s~LiwP~l~~YPe~~qsDFv-~e~~E~tT~~elL~~vl~~p~~w-------D~~~~y---~p~nv~Vf~e~~~~g-L~k  340 (390)
T KOG0551|consen  273 QSRLIWPALFLYPEYAQSDFV-SEVSELTTVIELLKTVLGEPAPW-------DLEQKY---NPDNVLVFMETEAGG-LIK  340 (390)
T ss_pred             cceeehhHHHhccchhhcchh-hhccccccHHHHHHHHhCCCCCC-------CHHhcc---CccceeEEEeccccc-eee
Confidence            4678999988888 2333333 48999999999999988765311       111122   458999999887755 999


Q ss_pred             ccCCCcHHHhhcCCEEE---ECcEEEEEecCCC
Q psy15724        245 LDHTLSIAENLKNKCII---EFPIFYVIFNYEK  274 (360)
Q Consensus       245 LD~~kTL~enLrgKtVI---EFPTI~V~l~~~~  274 (360)
                      +....||.++|+..-|-   ==|.|||+.++.+
T Consensus       341 V~~~~~~~~iL~~~~~~l~~g~~~i~Vv~k~~a  373 (390)
T KOG0551|consen  341 VGKKSTLLDILKHPGVFLKDGALKIYVVPKVSA  373 (390)
T ss_pred             ccccchHHHHHcCCCeeecCCceEEEEecCccc
Confidence            99999999999965522   1356677665543


No 11 
>KOG1710|consensus
Probab=77.84  E-value=0.53  Score=46.94  Aligned_cols=32  Identities=28%  Similarity=0.695  Sum_probs=29.1

Q ss_pred             ccCcccCCCCCCcccCCCCC-Cccccccccccc
Q psy15724         40 LGDCEVCAIEPAKYTCPKCE-LKTCCLNCVNIH   71 (360)
Q Consensus        40 ~~~C~vC~~~~~kY~CP~C~-~~tCSl~C~k~H   71 (360)
                      -..|.+|+...++=||..|. +-||+-.|-|.|
T Consensus       319 ~~fCstCG~~ga~KrCs~CKav~YCdqeCQk~h  351 (396)
T KOG1710|consen  319 CQFCSTCGHPGAKKRCSQCKAVAYCDQECQKFH  351 (396)
T ss_pred             cccccccCCCCccchhhhhHHHHHHHHHHHHhh
Confidence            45799999999999999999 899999998765


No 12 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=75.41  E-value=1.5  Score=33.30  Aligned_cols=26  Identities=35%  Similarity=0.696  Sum_probs=20.9

Q ss_pred             CCccCcccCCCCCCcccCCCCCCccc
Q psy15724         38 SRLGDCEVCAIEPAKYTCPKCELKTC   63 (360)
Q Consensus        38 ~~~~~C~vC~~~~~kY~CP~C~~~tC   63 (360)
                      .++..|..|+.-.-+-.||.||..|-
T Consensus         3 s~mr~C~~CgvYTLk~~CP~CG~~t~   28 (56)
T PRK13130          3 SKIRKCPKCGVYTLKEICPVCGGKTK   28 (56)
T ss_pred             ccceECCCCCCEEccccCcCCCCCCC
Confidence            56778999998777888999987753


No 13 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=73.39  E-value=1.3  Score=34.09  Aligned_cols=21  Identities=43%  Similarity=1.065  Sum_probs=16.3

Q ss_pred             ccCcccCCCCCCcccCCCCCC
Q psy15724         40 LGDCEVCAIEPAKYTCPKCEL   60 (360)
Q Consensus        40 ~~~C~vC~~~~~kY~CP~C~~   60 (360)
                      ..+|.-|.+....|+||.|+.
T Consensus        36 I~RC~~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         36 IYRCEKCRKQSNPYTCPKCGF   56 (59)
T ss_pred             EeechhHHhcCCceECCCCCC
Confidence            455777777778899998875


No 14 
>PLN03158 methionine aminopeptidase; Provisional
Probab=71.43  E-value=1.5  Score=45.17  Aligned_cols=33  Identities=30%  Similarity=0.755  Sum_probs=26.0

Q ss_pred             cCCccCcccCCCCCCcccCCCCCC--------cccccccccc
Q psy15724         37 VSRLGDCEVCAIEPAKYTCPKCEL--------KTCCLNCVNI   70 (360)
Q Consensus        37 ~~~~~~C~vC~~~~~kY~CP~C~~--------~tCSl~C~k~   70 (360)
                      ...+..|.-|++ ++.-+||.|..        .+||-.|+|.
T Consensus         6 ~~~~~~c~~c~~-~a~l~Cp~C~k~~~~~~~s~fCsq~CFk~   46 (396)
T PLN03158          6 TTSPLACARCSK-PAHLQCPKCLELKLPREGASFCSQDCFKA   46 (396)
T ss_pred             CCCcccccCCCC-cccccCccchhcCCCCCCceeECHHHHHH
Confidence            345667999996 68899999965        4699999863


No 15 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=68.57  E-value=1.7  Score=33.46  Aligned_cols=22  Identities=32%  Similarity=0.830  Sum_probs=16.9

Q ss_pred             CccCcccCCCCCCcccCCCCCC
Q psy15724         39 RLGDCEVCAIEPAKYTCPKCEL   60 (360)
Q Consensus        39 ~~~~C~vC~~~~~kY~CP~C~~   60 (360)
                      -..+|.-|.+....|+||.|+.
T Consensus        37 ~I~Rc~~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          37 EIYRCAKCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eeehhhhHHHcCCceECCCcCc
Confidence            3456777778788999999985


No 16 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=66.98  E-value=2.7  Score=36.16  Aligned_cols=43  Identities=28%  Similarity=0.535  Sum_probs=26.7

Q ss_pred             ccCCCCCCccccccccccccccccccCCCCccccccCCCcchhhhhhhhhhHHHHHhh
Q psy15724         53 YTCPKCELKTCCLNCVNIHKRELECDGIRNKVKFIPLQKFSNLELQNDFNLLEEVSNS  110 (360)
Q Consensus        53 Y~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd~t~fVp~~~~~~~~l~~DYnFLe~i~R~  110 (360)
                      |.||+|+.+.|+|+        ..|.-=       .+.=....+|-|-|..|--+.-.
T Consensus         2 Y~CPrC~skvC~LP--------~~CpiC-------gLtLVss~HLARSyHHLfPl~~f   44 (112)
T TIGR00622         2 YFCPQCRAKVCELP--------VECPIC-------GLTLILSTHLARSYHHLFPLKAF   44 (112)
T ss_pred             ccCCCCCCCccCCC--------CcCCcC-------CCEEeccchHHHhhhccCCCccc
Confidence            99999999999996        223100       01111345788888876555433


No 17 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=65.44  E-value=4.3  Score=27.25  Aligned_cols=25  Identities=32%  Similarity=0.990  Sum_probs=20.1

Q ss_pred             CcccCCCC----CCcccCCCCCCcccccc
Q psy15724         42 DCEVCAIE----PAKYTCPKCELKTCCLN   66 (360)
Q Consensus        42 ~C~vC~~~----~~kY~CP~C~~~tCSl~   66 (360)
                      .|.+|..+    ..+|.|..|++..|--.
T Consensus         2 rC~vC~~~k~rk~T~~~C~~C~v~lC~~~   30 (32)
T PF13842_consen    2 RCKVCSKKKRRKDTRYMCSKCDVPLCVEP   30 (32)
T ss_pred             CCeECCcCCccceeEEEccCCCCcccCCC
Confidence            58888864    37899999999888655


No 18 
>PHA00626 hypothetical protein
Probab=63.55  E-value=3.8  Score=31.32  Aligned_cols=40  Identities=20%  Similarity=0.388  Sum_probs=29.0

Q ss_pred             ccCcccCCCCCCcccCCCCCCccccccccccccccccccCCCCccccccCC
Q psy15724         40 LGDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKRELECDGIRNKVKFIPLQ   90 (360)
Q Consensus        40 ~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd~t~fVp~~   90 (360)
                      ..+|.+|......|.||.|+..+=        |   +--|.|.+..||.+.
T Consensus        11 Ivrcg~cr~~snrYkCkdCGY~ft--------~---~~~~~~~~~~~~~~~   50 (59)
T PHA00626         11 IAKEKTMRGWSDDYVCCDCGYNDS--------K---DAFGERGKNEFVRIN   50 (59)
T ss_pred             eeeeceecccCcceEcCCCCCeec--------h---hhhhhccccceEEec
Confidence            346888887778999999997651        1   234677777888764


No 19 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=54.91  E-value=7.1  Score=26.09  Aligned_cols=20  Identities=35%  Similarity=0.863  Sum_probs=14.4

Q ss_pred             CcccCCCC----CCcccCCCCCCc
Q psy15724         42 DCEVCAIE----PAKYTCPKCELK   61 (360)
Q Consensus        42 ~C~vC~~~----~~kY~CP~C~~~   61 (360)
                      .|.+|+-.    ...++||.|+..
T Consensus         3 ~C~~CGy~y~~~~~~~~CP~Cg~~   26 (33)
T cd00350           3 VCPVCGYIYDGEEAPWVCPVCGAP   26 (33)
T ss_pred             ECCCCCCEECCCcCCCcCcCCCCc
Confidence            57888742    367899999864


No 20 
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=54.43  E-value=9  Score=30.53  Aligned_cols=26  Identities=27%  Similarity=0.575  Sum_probs=18.6

Q ss_pred             ccCCccCcccCCCCCCcccCCCCCCccccccc
Q psy15724         36 KVSRLGDCEVCAIEPAKYTCPKCELKTCCLNC   67 (360)
Q Consensus        36 ~~~~~~~C~vC~~~~~kY~CP~C~~~tCSl~C   67 (360)
                      .+.....|.+|+..-.   =|   .++|||.|
T Consensus        45 ~~~~~~~C~~C~R~L~---d~---~~fCSl~C   70 (72)
T PF04640_consen   45 SKGSGNICETCHRSLQ---DP---YRFCSLSC   70 (72)
T ss_pred             CCCCCCccCCCCCCCC---CC---CeEEeeeE
Confidence            3456788999987543   12   68999999


No 21 
>KOG2807|consensus
Probab=51.51  E-value=7.9  Score=39.19  Aligned_cols=60  Identities=23%  Similarity=0.469  Sum_probs=39.2

Q ss_pred             CCccCcccCCCC--CCcccCCCCCCccccccccccccccccccCCCCccccccCCCcchhhhhhhhhhHHHHHhhhhh
Q psy15724         38 SRLGDCEVCAIE--PAKYTCPKCELKTCCLNCVNIHKRELECDGIRNKVKFIPLQKFSNLELQNDFNLLEEVSNSLFK  113 (360)
Q Consensus        38 ~~~~~C~vC~~~--~~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd~t~fVp~~~~~~~~l~~DYnFLe~i~R~ve~  113 (360)
                      ..+.+|. |+..  .+-|-||+|..+.|||+=.=     ..|+     ...|     ..-+|-|-|++|-=+.-..+.
T Consensus       261 ~~ps~C~-CH~~~~~~Gy~CP~CkakvCsLP~eC-----piC~-----ltLV-----ss~hLARSyhhL~PL~~F~Ei  322 (378)
T KOG2807|consen  261 DTPSFCA-CHSELSGGGYFCPQCKAKVCSLPIEC-----PICS-----LTLV-----SSPHLARSYHHLFPLKPFVEI  322 (378)
T ss_pred             cCcchhe-eccccccCceeCCcccCeeecCCccC-----Cccc-----eeEe-----cchHHHHHHHhhcCCcchhhc
Confidence            3456787 8852  34799999999999995110     1233     1122     346899999999877655554


No 22 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=45.98  E-value=12  Score=25.32  Aligned_cols=20  Identities=35%  Similarity=0.745  Sum_probs=14.1

Q ss_pred             CcccCCCC----CCcccCCCCCCc
Q psy15724         42 DCEVCAIE----PAKYTCPKCELK   61 (360)
Q Consensus        42 ~C~vC~~~----~~kY~CP~C~~~   61 (360)
                      .|.+|+-.    .+..+||.|+..
T Consensus         4 ~C~~CG~i~~g~~~p~~CP~Cg~~   27 (34)
T cd00729           4 VCPVCGYIHEGEEAPEKCPICGAP   27 (34)
T ss_pred             ECCCCCCEeECCcCCCcCcCCCCc
Confidence            58888743    256789999864


No 23 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=43.73  E-value=15  Score=25.62  Aligned_cols=23  Identities=22%  Similarity=0.668  Sum_probs=19.3

Q ss_pred             cccCCCCCC--cccCCCCCCccccc
Q psy15724         43 CEVCAIEPA--KYTCPKCELKTCCL   65 (360)
Q Consensus        43 C~vC~~~~~--kY~CP~C~~~tCSl   65 (360)
                      |.+|++...  .++|..|+..+|+.
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~   25 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGE   25 (39)
T ss_pred             CcccCCcccccCeECCccCCccccc
Confidence            678887666  69999999999984


No 24 
>COG5195 Uncharacterized conserved protein [Function unknown]
Probab=41.73  E-value=17  Score=31.04  Aligned_cols=30  Identities=33%  Similarity=0.665  Sum_probs=25.0

Q ss_pred             ccCCccCcccCCCCCCcccCCCCCCcccccc
Q psy15724         36 KVSRLGDCEVCAIEPAKYTCPKCELKTCCLN   66 (360)
Q Consensus        36 ~~~~~~~C~vC~~~~~kY~CP~C~~~tCSl~   66 (360)
                      .+.+|..|+|=+- .+.|+||.=+++|=..+
T Consensus        62 v~P~~KyCDvTGL-~a~Yt~P~t~lrYhn~e   91 (118)
T COG5195          62 VKPRMKYCDVTGL-PAPYTCPNTGLRYHNSE   91 (118)
T ss_pred             cccccccccccCC-cccccCCCcCceeccHH
Confidence            4778999999997 79999999999884433


No 25 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=40.19  E-value=15  Score=31.69  Aligned_cols=20  Identities=35%  Similarity=0.921  Sum_probs=15.2

Q ss_pred             cccCCCCCC--cccCCCCCCcc
Q psy15724         43 CEVCAIEPA--KYTCPKCELKT   62 (360)
Q Consensus        43 C~vC~~~~~--kY~CP~C~~~t   62 (360)
                      |.||+..-.  +++||.|++..
T Consensus         1 CPvCg~~l~vt~l~C~~C~t~i   22 (113)
T PF09862_consen    1 CPVCGGELVVTRLKCPSCGTEI   22 (113)
T ss_pred             CCCCCCceEEEEEEcCCCCCEE
Confidence            888986544  89999988653


No 26 
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=35.92  E-value=17  Score=33.85  Aligned_cols=28  Identities=29%  Similarity=0.509  Sum_probs=20.6

Q ss_pred             ccCcccCCCCCC-cccCCCCCCccccccc
Q psy15724         40 LGDCEVCAIEPA-KYTCPKCELKTCCLNC   67 (360)
Q Consensus        40 ~~~C~vC~~~~~-kY~CP~C~~~tCSl~C   67 (360)
                      -.+|.||..... .=+||+|+..-=+..|
T Consensus       162 cilCtvCe~r~w~g~~CPKCGr~G~pi~C  190 (200)
T PF12387_consen  162 CILCTVCEGREWKGGNCPKCGRHGKPITC  190 (200)
T ss_pred             eEEEeeeecCccCCCCCCcccCCCCCeec
Confidence            346999987666 5679999987655555


No 27 
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=35.56  E-value=16  Score=36.85  Aligned_cols=60  Identities=25%  Similarity=0.440  Sum_probs=41.4

Q ss_pred             ccCcccCCCCC--CcccCCCCCCccccccccccccccccccCCCCccccccCCCcchhhhhhhhhhHHHHHhhhhhcc
Q psy15724         40 LGDCEVCAIEP--AKYTCPKCELKTCCLNCVNIHKRELECDGIRNKVKFIPLQKFSNLELQNDFNLLEEVSNSLFKYK  115 (360)
Q Consensus        40 ~~~C~vC~~~~--~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd~t~fVp~~~~~~~~l~~DYnFLe~i~R~ve~~k  115 (360)
                      ..+|. |+...  +-|-||+|..+-|||+=+=     ..|+-.     .|     -..+|.|.|++|--..-.+|...
T Consensus       295 Ps~Ca-CHs~~~~gGy~CP~CktkVCsLPi~C-----P~Csl~-----Li-----lsthLarSyhhL~PLk~f~E~p~  356 (421)
T COG5151         295 PSVCA-CHSEVKGGGYECPVCKTKVCSLPISC-----PICSLQ-----LI-----LSTHLARSYHHLYPLKPFVEKPE  356 (421)
T ss_pred             cccee-eeeeeccCceeCCcccceeecCCccC-----cchhHH-----HH-----HHHHHHHHHHhhccCcccccccC
Confidence            56788 88643  4799999999999995211     224311     11     34689999999988877776544


No 28 
>PF08265 YL1_C:  YL1 nuclear protein C-terminal domain;  InterPro: IPR013272 This domain is found at the C terminus in proteins of the YL1 family []. These proteins have been shown to be DNA-binding and may be transcription factors []. This domain is also found in proteins that do not belong to the YL1 family.
Probab=35.40  E-value=22  Score=23.67  Aligned_cols=27  Identities=26%  Similarity=0.533  Sum_probs=22.8

Q ss_pred             CcccCCCCCCcccCCCCCCccccccccc
Q psy15724         42 DCEVCAIEPAKYTCPKCELKTCCLNCVN   69 (360)
Q Consensus        42 ~C~vC~~~~~kY~CP~C~~~tCSl~C~k   69 (360)
                      .|.|=+. +++|+.|+=+.++.++.-++
T Consensus         2 ~C~iTgl-pA~Y~DP~T~l~Y~n~~ayk   28 (30)
T PF08265_consen    2 YCDITGL-PARYRDPKTGLPYANSEAYK   28 (30)
T ss_pred             cccccCC-CccccCCCCCCcccCHHHhh
Confidence            5888776 89999999999998887665


No 29 
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=33.01  E-value=21  Score=40.93  Aligned_cols=25  Identities=28%  Similarity=0.578  Sum_probs=20.6

Q ss_pred             CCccCcccCCCCCCcccCCCCCCcc
Q psy15724         38 SRLGDCEVCAIEPAKYTCPKCELKT   62 (360)
Q Consensus        38 ~~~~~C~vC~~~~~kY~CP~C~~~t   62 (360)
                      ..+..|.-|+.-..+.+||.|+.+|
T Consensus       623 v~~RKCPkCG~yTlk~rCP~CG~~T  647 (1095)
T TIGR00354       623 IAIRKCPQCGKESFWLKCPVCGELT  647 (1095)
T ss_pred             EEEEECCCCCcccccccCCCCCCcc
Confidence            3456799999988899999999886


No 30 
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=32.98  E-value=15  Score=38.62  Aligned_cols=35  Identities=26%  Similarity=0.607  Sum_probs=30.4

Q ss_pred             ccCcccCCCCCCcccCCCCCCccccccccccccccc
Q psy15724         40 LGDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKREL   75 (360)
Q Consensus        40 ~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~~~   75 (360)
                      ...|.+|+. -.-|=|-.=.-..|||+|...|-...
T Consensus        28 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~   62 (518)
T PLN00206         28 EPKCVVCGR-YGEYICDETDDDICSLECKQALLRRV   62 (518)
T ss_pred             CceEEEecC-ccceeccCCCCccccHHHHHHHHHHH
Confidence            345999997 78999999999999999999997544


No 31 
>PRK00420 hypothetical protein; Validated
Probab=32.93  E-value=29  Score=29.90  Aligned_cols=30  Identities=17%  Similarity=0.389  Sum_probs=21.1

Q ss_pred             ccCcccCCC-----CCCcccCCCCCCcccccccccccc
Q psy15724         40 LGDCEVCAI-----EPAKYTCPKCELKTCCLNCVNIHK   72 (360)
Q Consensus        40 ~~~C~vC~~-----~~~kY~CP~C~~~tCSl~C~k~Hk   72 (360)
                      ...|.+|+.     +..+.-||.|+.   .+.|...++
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~Cg~---~~~v~~~ee   57 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVHGK---VYIVKSDEE   57 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCCCC---eeeeccHHH
Confidence            357999996     455678999998   556655553


No 32 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=32.88  E-value=19  Score=24.52  Aligned_cols=35  Identities=26%  Similarity=0.426  Sum_probs=25.9

Q ss_pred             CccCcccCCCCCCcccCCCCCCccccccccccccc
Q psy15724         39 RLGDCEVCAIEPAKYTCPKCELKTCCLNCVNIHKR   73 (360)
Q Consensus        39 ~~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~Hk~   73 (360)
                      ++..|..|......|-|..|....|+.=-...|+.
T Consensus         2 ~~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~   36 (42)
T PF00643_consen    2 QEPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG   36 (42)
T ss_dssp             SSSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT
T ss_pred             cCccCccCCccceEEEecCCCCccCccCCCCCCCC
Confidence            46789999987799999999999987533333653


No 33 
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=32.47  E-value=24  Score=27.20  Aligned_cols=11  Identities=27%  Similarity=0.628  Sum_probs=5.8

Q ss_pred             CccccccCCCc
Q psy15724         82 NKVKFIPLQKF   92 (360)
Q Consensus        82 d~t~fVp~~~~   92 (360)
                      .|..|-|-..|
T Consensus        31 ~PprFSPeD~y   41 (59)
T COG2260          31 HPPRFSPEDKY   41 (59)
T ss_pred             CCCCCCccchH
Confidence            45566555444


No 34 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=31.77  E-value=20  Score=31.43  Aligned_cols=10  Identities=40%  Similarity=1.012  Sum_probs=7.6

Q ss_pred             cccCCCCCCc
Q psy15724         52 KYTCPKCELK   61 (360)
Q Consensus        52 kY~CP~C~~~   61 (360)
                      .++||.|+..
T Consensus       107 ~~~CP~Cgs~  116 (135)
T PRK03824        107 FLKCPKCGSR  116 (135)
T ss_pred             CcCCcCCCCC
Confidence            4679999864


No 35 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=31.55  E-value=24  Score=24.86  Aligned_cols=33  Identities=15%  Similarity=0.519  Sum_probs=17.1

Q ss_pred             CCCCCC-cccCCCCCCccccccccccccccccccCCC
Q psy15724         46 CAIEPA-KYTCPKCELKTCCLNCVNIHKRELECDGIR   81 (360)
Q Consensus        46 C~~~~~-kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~r   81 (360)
                      |..... .++|+.|+..+|+.-   ++..+.+|.+..
T Consensus         6 C~~~~~~~~~C~~C~~~FC~~H---r~~e~H~C~~~~   39 (43)
T PF01428_consen    6 CKKKDFLPFKCKHCGKSFCLKH---RLPEDHNCSKLQ   39 (43)
T ss_dssp             T--BCTSHEE-TTTS-EE-TTT---HSTTTCT-SSTT
T ss_pred             CcCccCCCeECCCCCcccCccc---cCccccCCcchh
Confidence            665444 899999999999742   223445666553


No 36 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=31.12  E-value=29  Score=26.24  Aligned_cols=21  Identities=29%  Similarity=0.898  Sum_probs=14.0

Q ss_pred             cCcccCCCCCC------cccCCCCCCc
Q psy15724         41 GDCEVCAIEPA------KYTCPKCELK   61 (360)
Q Consensus        41 ~~C~vC~~~~~------kY~CP~C~~~   61 (360)
                      ..|..|+....      .|+||.|+..
T Consensus        29 q~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   29 QTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             cCccCcccccccccccceEEcCCCCCE
Confidence            35778875433      4888888753


No 37 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=31.04  E-value=26  Score=41.22  Aligned_cols=22  Identities=32%  Similarity=0.807  Sum_probs=16.2

Q ss_pred             cCcccCCCCCCcccCCCCCCcc
Q psy15724         41 GDCEVCAIEPAKYTCPKCELKT   62 (360)
Q Consensus        41 ~~C~vC~~~~~kY~CP~C~~~t   62 (360)
                      ..|.-|+.......||.|+.++
T Consensus       668 rkCPkCG~~t~~~fCP~CGs~t  689 (1337)
T PRK14714        668 RRCPSCGTETYENRCPDCGTHT  689 (1337)
T ss_pred             EECCCCCCccccccCcccCCcC
Confidence            5688888766666888888776


No 38 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=31.02  E-value=27  Score=41.10  Aligned_cols=21  Identities=29%  Similarity=0.901  Sum_probs=17.0

Q ss_pred             cCcccCCCCC-CcccCCCCCCc
Q psy15724         41 GDCEVCAIEP-AKYTCPKCELK   61 (360)
Q Consensus        41 ~~C~vC~~~~-~kY~CP~C~~~   61 (360)
                      ..|..|+... ..|.||.|+..
T Consensus       680 ~fCP~CGs~te~vy~CPsCGae  701 (1337)
T PRK14714        680 NRCPDCGTHTEPVYVCPDCGAE  701 (1337)
T ss_pred             ccCcccCCcCCCceeCccCCCc
Confidence            4899999753 48999999985


No 39 
>KOG1356|consensus
Probab=30.92  E-value=22  Score=40.09  Aligned_cols=34  Identities=24%  Similarity=0.705  Sum_probs=27.6

Q ss_pred             CCccCcccCCCCCCc--ccCCCCCCcccccccccccc
Q psy15724         38 SRLGDCEVCAIEPAK--YTCPKCELKTCCLNCVNIHK   72 (360)
Q Consensus        38 ~~~~~C~vC~~~~~k--Y~CP~C~~~tCSl~C~k~Hk   72 (360)
                      .-...|.+|.....+  .+||+|+..+| +.|++.-+
T Consensus       227 g~~~mC~~C~~tlfn~hw~C~~C~~~~C-l~C~r~~~  262 (889)
T KOG1356|consen  227 GIREMCDRCETTLFNIHWRCPRCGFGVC-LDCYRKWY  262 (889)
T ss_pred             CcchhhhhhcccccceeEEccccCCeee-ecchhhcc
Confidence            334569999998875  79999999965 89998774


No 40 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=30.86  E-value=18  Score=27.11  Aligned_cols=23  Identities=26%  Similarity=0.608  Sum_probs=14.9

Q ss_pred             CccCcccCCCCCC--------cccCCCCCCc
Q psy15724         39 RLGDCEVCAIEPA--------KYTCPKCELK   61 (360)
Q Consensus        39 ~~~~C~vC~~~~~--------kY~CP~C~~~   61 (360)
                      +...|..|+.--+        .-+||||+.-
T Consensus         3 ~eiRC~~CnklLa~~g~~~~leIKCpRC~ti   33 (51)
T PF10122_consen    3 KEIRCGHCNKLLAKAGEVIELEIKCPRCKTI   33 (51)
T ss_pred             cceeccchhHHHhhhcCccEEEEECCCCCcc
Confidence            4456888874333        3479999863


No 41 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=30.11  E-value=34  Score=24.17  Aligned_cols=24  Identities=25%  Similarity=0.643  Sum_probs=20.4

Q ss_pred             CcccCCCCCCcccCCCCCCccccc
Q psy15724         42 DCEVCAIEPAKYTCPKCELKTCCL   65 (360)
Q Consensus        42 ~C~vC~~~~~kY~CP~C~~~tCSl   65 (360)
                      .|..|+.....|-|..|+.-.|..
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c~~   24 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGCGR   24 (50)
T ss_pred             CcccCCCcCCeEEecCCCCcccCC
Confidence            489999888899999999888843


No 42 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=30.03  E-value=22  Score=30.21  Aligned_cols=25  Identities=20%  Similarity=0.388  Sum_probs=17.8

Q ss_pred             cCCccCcccCCCCC----CcccCCCCCCc
Q psy15724         37 VSRLGDCEVCAIEP----AKYTCPKCELK   61 (360)
Q Consensus        37 ~~~~~~C~vC~~~~----~kY~CP~C~~~   61 (360)
                      ......|..|+...    ..|.||.|+..
T Consensus        67 vp~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         67 KPAQAWCWDCSQVVEIHQHDAQCPHCHGE   95 (113)
T ss_pred             eCcEEEcccCCCEEecCCcCccCcCCCCC
Confidence            44556799998533    45779999965


No 43 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=29.74  E-value=26  Score=30.32  Aligned_cols=24  Identities=33%  Similarity=0.679  Sum_probs=16.2

Q ss_pred             cCCccCcccCCCC-----C------CcccCCCCCCc
Q psy15724         37 VSRLGDCEVCAIE-----P------AKYTCPKCELK   61 (360)
Q Consensus        37 ~~~~~~C~vC~~~-----~------~kY~CP~C~~~   61 (360)
                      ......| -|+..     .      +.+.||.|+-.
T Consensus        67 vp~~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs~  101 (124)
T PRK00762         67 IPVEIEC-ECGYEGVVDEDEIDHYAAVIECPVCGNK  101 (124)
T ss_pred             cCeeEEe-eCcCcccccccchhccccCCcCcCCCCC
Confidence            4445679 89965     1      23789999853


No 44 
>PF07150 DUF1390:  Protein of unknown function (DUF1390);  InterPro: IPR009820 This entry is represented by Paramecium bursaria Chlorella virus 1, A79R; it is a family of uncharacterised viral proteins.
Probab=29.70  E-value=27  Score=33.65  Aligned_cols=40  Identities=25%  Similarity=0.500  Sum_probs=29.9

Q ss_pred             CcccCCCCCCccccccccccccccccccCCCC--ccccccCCCc
Q psy15724         51 AKYTCPKCELKTCCLNCVNIHKRELECDGIRN--KVKFIPLQKF   92 (360)
Q Consensus        51 ~kY~CP~C~~~tCSl~C~k~Hk~~~~C~g~rd--~t~fVp~~~~   92 (360)
                      .-|.| +||-.|=+..+..+||+- .|.+.--  ...||..+++
T Consensus         6 ~lY~C-~CGYkT~~~gnAsKHkKt-sC~hem~~~~~~FVl~ed~   47 (229)
T PF07150_consen    6 TLYTC-GCGYKTTNKGNASKHKKT-SCGHEMKSETKEFVLKEDY   47 (229)
T ss_pred             EEEEe-cCCceecCCccccccCCC-cCCCeeeeeeeceeehhhh
Confidence            46999 899999999999999986 9987631  2255544333


No 45 
>KOG4850|consensus
Probab=29.17  E-value=24  Score=32.43  Aligned_cols=35  Identities=23%  Similarity=0.708  Sum_probs=26.4

Q ss_pred             cCCccCcccCCCCC---CcccCCCCCCcccccccccccc
Q psy15724         37 VSRLGDCEVCAIEP---AKYTCPKCELKTCCLNCVNIHK   72 (360)
Q Consensus        37 ~~~~~~C~vC~~~~---~kY~CP~C~~~tCSl~C~k~Hk   72 (360)
                      ...+-+|. |...+   -.|-||.|+.--|-..|-..-|
T Consensus       132 ~~G~DlCD-Cl~~eCdGC~Y~C~~CGSTkCG~~CR~nRK  169 (190)
T KOG4850|consen  132 TLGFDLCD-CLVVECDGCHYPCKQCGSTKCGIGCRQNRK  169 (190)
T ss_pred             eccccHHh-hhccccccceeccccccccccccccccchH
Confidence            45566777 65544   3899999999999999976555


No 46 
>KOG4217|consensus
Probab=28.39  E-value=34  Score=36.44  Aligned_cols=24  Identities=38%  Similarity=0.819  Sum_probs=16.7

Q ss_pred             cCCccCcccCCCCCCcccCCCCCCccc
Q psy15724         37 VSRLGDCEVCAIEPAKYTCPKCELKTC   63 (360)
Q Consensus        37 ~~~~~~C~vC~~~~~kY~CP~C~~~tC   63 (360)
                      -...++|.||+.+.+   |--=|+|||
T Consensus       266 ~~~e~~CAVCgDnAa---CqHYGvRTC  289 (605)
T KOG4217|consen  266 LSAEGLCAVCGDNAA---CQHYGVRTC  289 (605)
T ss_pred             CCccceeeecCChHH---hhhcCcccc
Confidence            445789999998754   555566666


No 47 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=28.27  E-value=34  Score=31.43  Aligned_cols=22  Identities=32%  Similarity=0.641  Sum_probs=16.7

Q ss_pred             ccCcccCC---CCCCcccCCCCCCc
Q psy15724         40 LGDCEVCA---IEPAKYTCPKCELK   61 (360)
Q Consensus        40 ~~~C~vC~---~~~~kY~CP~C~~~   61 (360)
                      .-.|.||+   ..++.=.||-|+.+
T Consensus       134 ~~vC~vCGy~~~ge~P~~CPiCga~  158 (166)
T COG1592         134 VWVCPVCGYTHEGEAPEVCPICGAP  158 (166)
T ss_pred             EEEcCCCCCcccCCCCCcCCCCCCh
Confidence            45688887   34778899999865


No 48 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=28.09  E-value=23  Score=27.30  Aligned_cols=13  Identities=23%  Similarity=0.738  Sum_probs=10.4

Q ss_pred             CCCcccCCCCCCc
Q psy15724         49 EPAKYTCPKCELK   61 (360)
Q Consensus        49 ~~~kY~CP~C~~~   61 (360)
                      .+...+||+|+.-
T Consensus        14 GE~~lrCPRC~~~   26 (65)
T COG4049          14 GEEFLRCPRCGMV   26 (65)
T ss_pred             CceeeeCCchhHH
Confidence            4678999999864


No 49 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=27.53  E-value=50  Score=38.24  Aligned_cols=25  Identities=24%  Similarity=0.475  Sum_probs=19.8

Q ss_pred             cCCccCcccCCCCCCcccCCCCCCc
Q psy15724         37 VSRLGDCEVCAIEPAKYTCPKCELK   61 (360)
Q Consensus        37 ~~~~~~C~vC~~~~~kY~CP~C~~~   61 (360)
                      ......|.-|+......+||.|+..
T Consensus       623 EVg~RfCpsCG~~t~~frCP~CG~~  647 (1121)
T PRK04023        623 EIGRRKCPSCGKETFYRRCPFCGTH  647 (1121)
T ss_pred             cccCccCCCCCCcCCcccCCCCCCC
Confidence            4556679899988788899999864


No 50 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=27.42  E-value=13  Score=21.53  Aligned_cols=20  Identities=20%  Similarity=0.452  Sum_probs=11.8

Q ss_pred             ccCCCCCCcccccccccccc
Q psy15724         53 YTCPKCELKTCCLNCVNIHK   72 (360)
Q Consensus        53 Y~CP~C~~~tCSl~C~k~Hk   72 (360)
                      |.||.|+..+=+..-.+.|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~   20 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHM   20 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHH
Confidence            67888887776665555553


No 51 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=27.04  E-value=34  Score=29.23  Aligned_cols=25  Identities=28%  Similarity=0.541  Sum_probs=16.9

Q ss_pred             cCCccCcccCCCCC----Ccc-cCCCCCCc
Q psy15724         37 VSRLGDCEVCAIEP----AKY-TCPKCELK   61 (360)
Q Consensus        37 ~~~~~~C~vC~~~~----~kY-~CP~C~~~   61 (360)
                      ......|..|+...    ..| +||+|+.+
T Consensus        68 vp~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   97 (117)
T PRK00564         68 EKVELECKDCSHVFKPNALDYGVCEKCHSK   97 (117)
T ss_pred             cCCEEEhhhCCCccccCCccCCcCcCCCCC
Confidence            44556799998643    234 49999865


No 52 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=26.91  E-value=21  Score=21.04  Aligned_cols=10  Identities=40%  Similarity=1.045  Sum_probs=6.9

Q ss_pred             ccCCCCCCcc
Q psy15724         53 YTCPKCELKT   62 (360)
Q Consensus        53 Y~CP~C~~~t   62 (360)
                      |+||.|+..+
T Consensus         1 y~C~~C~~~f   10 (23)
T PF00096_consen    1 YKCPICGKSF   10 (23)
T ss_dssp             EEETTTTEEE
T ss_pred             CCCCCCCCcc
Confidence            6777777654


No 53 
>PRK01343 zinc-binding protein; Provisional
Probab=26.83  E-value=39  Score=25.84  Aligned_cols=29  Identities=17%  Similarity=0.414  Sum_probs=18.6

Q ss_pred             CCccCcccCCCCCCcccCCCCCCccccccccccc
Q psy15724         38 SRLGDCEVCAIEPAKYTCPKCELKTCCLNCVNIH   71 (360)
Q Consensus        38 ~~~~~C~vC~~~~~kY~CP~C~~~tCSl~C~k~H   71 (360)
                      .....|.+|++... ..    ..++||-.|-..-
T Consensus         7 ~p~~~CP~C~k~~~-~~----~rPFCS~RC~~iD   35 (57)
T PRK01343          7 RPTRPCPECGKPST-RE----AYPFCSERCRDID   35 (57)
T ss_pred             CCCCcCCCCCCcCc-CC----CCcccCHHHhhhh
Confidence            34567999987432 11    3588998886543


No 54 
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=26.49  E-value=39  Score=33.40  Aligned_cols=29  Identities=21%  Similarity=0.519  Sum_probs=22.6

Q ss_pred             cCCccCcccCCCCCCc--ccCCCCCCcccccc
Q psy15724         37 VSRLGDCEVCAIEPAK--YTCPKCELKTCCLN   66 (360)
Q Consensus        37 ~~~~~~C~vC~~~~~k--Y~CP~C~~~tCSl~   66 (360)
                      ..-...|. |+.+...  |-||.|...+|++.
T Consensus       239 vd~ra~Cf-Ch~k~v~~GyvCs~Clsi~C~~p  269 (279)
T TIGR00627       239 VDYRASCF-CHHQLVSIGFVCSVCLSVLCQYT  269 (279)
T ss_pred             CCCcceee-ecCccccceEECCCccCCcCCCC
Confidence            33445787 8877665  99999999999874


No 55 
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=26.36  E-value=29  Score=28.11  Aligned_cols=13  Identities=46%  Similarity=0.871  Sum_probs=11.0

Q ss_pred             cccCCCCCCcccc
Q psy15724         52 KYTCPKCELKTCC   64 (360)
Q Consensus        52 kY~CP~C~~~tCS   64 (360)
                      ||+||-|+.+|=.
T Consensus         1 K~~CPCCg~~Tl~   13 (78)
T PF14206_consen    1 KYPCPCCGYYTLE   13 (78)
T ss_pred             CccCCCCCcEEec
Confidence            7999999998843


No 56 
>PHA00616 hypothetical protein
Probab=26.15  E-value=12  Score=27.22  Aligned_cols=21  Identities=24%  Similarity=0.205  Sum_probs=15.2

Q ss_pred             cccCCCCCCcccccccccccc
Q psy15724         52 KYTCPKCELKTCCLNCVNIHK   72 (360)
Q Consensus        52 kY~CP~C~~~tCSl~C~k~Hk   72 (360)
                      .|+||+|+....-..=...|-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~   21 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHL   21 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHH
Confidence            389999998887665555553


No 57 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=25.18  E-value=31  Score=26.80  Aligned_cols=11  Identities=45%  Similarity=1.165  Sum_probs=7.7

Q ss_pred             ccCCCCCCccc
Q psy15724         53 YTCPKCELKTC   63 (360)
Q Consensus        53 Y~CP~C~~~tC   63 (360)
                      |+||+|+-..+
T Consensus         1 y~C~KCg~~~~   11 (64)
T PF09855_consen    1 YKCPKCGNEEY   11 (64)
T ss_pred             CCCCCCCCcce
Confidence            77888876543


No 58 
>PF14949 ARF7EP_C:  ARF7 effector protein C-terminus
Probab=25.15  E-value=37  Score=28.87  Aligned_cols=32  Identities=31%  Similarity=0.762  Sum_probs=23.3

Q ss_pred             CCccCcccCCCCC---CcccCCCCCCcccccccccc
Q psy15724         38 SRLGDCEVCAIEP---AKYTCPKCELKTCCLNCVNI   70 (360)
Q Consensus        38 ~~~~~C~vC~~~~---~kY~CP~C~~~tCSl~C~k~   70 (360)
                      ...-+|+ |....   -.|-||+|+.+-|...|-..
T Consensus        58 ~~~DlCD-CL~~~C~GC~~PC~~C~S~KCG~~CR~n   92 (103)
T PF14949_consen   58 NGKDLCD-CLDEDCPGCHYPCPKCGSRKCGPECRCN   92 (103)
T ss_pred             CCCcccc-ccCCCCCCccccCCCCCCCccChhhCcC
Confidence            3345677 65433   27999999999999999543


No 59 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=24.94  E-value=21  Score=27.19  Aligned_cols=9  Identities=22%  Similarity=0.486  Sum_probs=5.9

Q ss_pred             ccccccccc
Q psy15724         61 KTCCLNCVN   69 (360)
Q Consensus        61 ~tCSl~C~k   69 (360)
                      ++||-.|-.
T Consensus        22 PFCS~RCk~   30 (57)
T PF03884_consen   22 PFCSERCKL   30 (57)
T ss_dssp             SSSSHHHHH
T ss_pred             CcccHhhcc
Confidence            458877754


No 60 
>COG4640 Predicted membrane protein [Function unknown]
Probab=24.89  E-value=38  Score=35.28  Aligned_cols=26  Identities=19%  Similarity=0.453  Sum_probs=19.6

Q ss_pred             ccCcccCC--CCCCcccCCCCCCccccc
Q psy15724         40 LGDCEVCA--IEPAKYTCPKCELKTCCL   65 (360)
Q Consensus        40 ~~~C~vC~--~~~~kY~CP~C~~~tCSl   65 (360)
                      |..|..|+  .++.-|.||.||.+.=+-
T Consensus         1 M~fC~kcG~qk~Ed~~qC~qCG~~~t~~   28 (465)
T COG4640           1 MKFCPKCGSQKAEDDVQCTQCGHKFTSR   28 (465)
T ss_pred             CCcccccccccccccccccccCCcCCch
Confidence            67899999  344567799999876543


No 61 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=24.76  E-value=22  Score=22.26  Aligned_cols=13  Identities=31%  Similarity=0.802  Sum_probs=9.6

Q ss_pred             CCCcccCCCCCCc
Q psy15724         49 EPAKYTCPKCELK   61 (360)
Q Consensus        49 ~~~kY~CP~C~~~   61 (360)
                      ++-.|.||.|+..
T Consensus        11 ~~k~~~C~~C~k~   23 (26)
T PF13465_consen   11 GEKPYKCPYCGKS   23 (26)
T ss_dssp             SSSSEEESSSSEE
T ss_pred             CCCCCCCCCCcCe
Confidence            4567999988764


No 62 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=23.89  E-value=40  Score=35.30  Aligned_cols=23  Identities=22%  Similarity=0.592  Sum_probs=15.9

Q ss_pred             ccCcccCCCC---CC--cccCCCCCCcc
Q psy15724         40 LGDCEVCAIE---PA--KYTCPKCELKT   62 (360)
Q Consensus        40 ~~~C~vC~~~---~~--kY~CP~C~~~t   62 (360)
                      ..+|..|+..   ..  =||||+|+.+.
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~  377 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRA  377 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccC
Confidence            3478888732   12  59999998876


No 63 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=23.35  E-value=38  Score=21.83  Aligned_cols=20  Identities=25%  Similarity=0.855  Sum_probs=9.1

Q ss_pred             CcccCCCCC---CcccCCCCCCc
Q psy15724         42 DCEVCAIEP---AKYTCPKCELK   61 (360)
Q Consensus        42 ~C~vC~~~~---~kY~CP~C~~~   61 (360)
                      .|.+|+...   ..|.|+.|..-
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf~   24 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDFD   24 (30)
T ss_dssp             --TTTS----S--EEE-TTT---
T ss_pred             cCCcCCCcCCCCceEECccCCCc
Confidence            588898765   47999999753


No 64 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.92  E-value=40  Score=23.54  Aligned_cols=10  Identities=40%  Similarity=1.049  Sum_probs=8.2

Q ss_pred             ccCCCCCCcc
Q psy15724         53 YTCPKCELKT   62 (360)
Q Consensus        53 Y~CP~C~~~t   62 (360)
                      |+||.|+...
T Consensus         1 m~Cp~Cg~~~   10 (43)
T PF08271_consen    1 MKCPNCGSKE   10 (43)
T ss_dssp             ESBTTTSSSE
T ss_pred             CCCcCCcCCc
Confidence            7899998876


No 65 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=22.33  E-value=43  Score=28.50  Aligned_cols=26  Identities=35%  Similarity=0.649  Sum_probs=18.1

Q ss_pred             cCCccCcccCCCCC----CcccCCCCCCcc
Q psy15724         37 VSRLGDCEVCAIEP----AKYTCPKCELKT   62 (360)
Q Consensus        37 ~~~~~~C~vC~~~~----~kY~CP~C~~~t   62 (360)
                      ......|..|+...    ..+.||.|+...
T Consensus        67 ~p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (115)
T TIGR00100        67 EPVECECEDCSEEVSPEIDLYRCPKCHGIM   96 (115)
T ss_pred             eCcEEEcccCCCEEecCCcCccCcCCcCCC
Confidence            34456799998643    356799999764


No 66 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=22.19  E-value=50  Score=33.69  Aligned_cols=20  Identities=30%  Similarity=0.818  Sum_probs=16.5

Q ss_pred             CcccCCCCCCcc--cCCCCCCc
Q psy15724         42 DCEVCAIEPAKY--TCPKCELK   61 (360)
Q Consensus        42 ~C~vC~~~~~kY--~CP~C~~~   61 (360)
                      .|..|+...+|+  +||.|+.=
T Consensus         2 ~c~~cg~~~~~~~g~cp~c~~w   23 (372)
T cd01121           2 VCSECGYVSPKWLGKCPECGEW   23 (372)
T ss_pred             CCCCCCCCCCCccEECcCCCCc
Confidence            599999888776  89999853


No 67 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=22.07  E-value=36  Score=25.41  Aligned_cols=29  Identities=41%  Similarity=1.047  Sum_probs=14.3

Q ss_pred             CCcccCCCCCCccccccc-cccccccccccC
Q psy15724         50 PAKYTCPKCELKTCCLNC-VNIHKRELECDG   79 (360)
Q Consensus        50 ~~kY~CP~C~~~tCSl~C-~k~Hk~~~~C~g   79 (360)
                      ...|+||+|...+|- .| +..|-.-.+|-|
T Consensus        19 ~~~y~C~~C~~~FC~-dCD~fiHE~LH~CPG   48 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCI-DCDVFIHETLHNCPG   48 (51)
T ss_dssp             -EEE--TTTT--B-H-HHHHTTTTTS-SSST
T ss_pred             CCeEECCCCCCcccc-CcChhhhccccCCcC
Confidence            468999999999984 33 344665555554


No 68 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.96  E-value=48  Score=31.36  Aligned_cols=20  Identities=25%  Similarity=0.904  Sum_probs=11.6

Q ss_pred             cCcccCCCCC-CcccCCCCCC
Q psy15724         41 GDCEVCAIEP-AKYTCPKCEL   60 (360)
Q Consensus        41 ~~C~vC~~~~-~kY~CP~C~~   60 (360)
                      ..|..|+.-. ..|.||+|+.
T Consensus       310 ~~C~~cg~~~~r~~~C~~cg~  330 (364)
T COG0675         310 KTCPCCGHLSGRLFKCPRCGF  330 (364)
T ss_pred             ccccccCCccceeEECCCCCC
Confidence            3577777521 2467777763


No 69 
>PRK12496 hypothetical protein; Provisional
Probab=21.83  E-value=40  Score=30.50  Aligned_cols=7  Identities=29%  Similarity=0.804  Sum_probs=4.0

Q ss_pred             CCCCCCc
Q psy15724         55 CPKCELK   61 (360)
Q Consensus        55 CP~C~~~   61 (360)
                      ||.||.+
T Consensus       146 C~~CG~~  152 (164)
T PRK12496        146 CEICGSP  152 (164)
T ss_pred             CCCCCCh
Confidence            6666544


No 70 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=21.02  E-value=47  Score=27.64  Aligned_cols=13  Identities=38%  Similarity=0.715  Sum_probs=10.1

Q ss_pred             CCcccCCCCCCcc
Q psy15724         50 PAKYTCPKCELKT   62 (360)
Q Consensus        50 ~~kY~CP~C~~~t   62 (360)
                      -++|+||.|+...
T Consensus        34 ~a~y~CpfCgk~~   46 (90)
T PRK03976         34 RAKHVCPVCGRPK   46 (90)
T ss_pred             hcCccCCCCCCCc
Confidence            4799999996543


No 71 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=20.96  E-value=47  Score=29.27  Aligned_cols=14  Identities=43%  Similarity=0.930  Sum_probs=9.8

Q ss_pred             CCcccCCCCCCccc
Q psy15724         50 PAKYTCPKCELKTC   63 (360)
Q Consensus        50 ~~kY~CP~C~~~tC   63 (360)
                      ...|.||.|+.++=
T Consensus        97 ~~~Y~Cp~C~~~y~  110 (147)
T smart00531       97 NAYYKCPNCQSKYT  110 (147)
T ss_pred             CcEEECcCCCCEee
Confidence            45788888876653


No 72 
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=20.94  E-value=54  Score=35.90  Aligned_cols=24  Identities=21%  Similarity=0.625  Sum_probs=17.7

Q ss_pred             cCCccCcccCCCC-CCcccCCCCCC
Q psy15724         37 VSRLGDCEVCAIE-PAKYTCPKCEL   60 (360)
Q Consensus        37 ~~~~~~C~vC~~~-~~kY~CP~C~~   60 (360)
                      ......|..|+-. +..++||.|+.
T Consensus       556 n~~~~~C~~CGy~g~~~~~CP~CG~  580 (618)
T PRK14704        556 NHPVDRCKCCSYHGVIGNECPSCGN  580 (618)
T ss_pred             CCCCeecCCCCCCCCcCccCcCCCC
Confidence            4456689999853 34589999986


No 73 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=20.89  E-value=43  Score=28.49  Aligned_cols=26  Identities=23%  Similarity=0.424  Sum_probs=17.7

Q ss_pred             cCCccCcccCCCCCC-----cccCCCCCCcc
Q psy15724         37 VSRLGDCEVCAIEPA-----KYTCPKCELKT   62 (360)
Q Consensus        37 ~~~~~~C~vC~~~~~-----kY~CP~C~~~t   62 (360)
                      ......|.-|+....     .+.||.|+...
T Consensus        67 ~p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~~   97 (114)
T PRK03681         67 QEAECWCETCQQYVTLLTQRVRRCPQCHGDM   97 (114)
T ss_pred             eCcEEEcccCCCeeecCCccCCcCcCcCCCC
Confidence            445567999986532     26699999653


No 74 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=20.70  E-value=47  Score=27.57  Aligned_cols=13  Identities=46%  Similarity=0.754  Sum_probs=10.8

Q ss_pred             CCcccCCCCCCcc
Q psy15724         50 PAKYTCPKCELKT   62 (360)
Q Consensus        50 ~~kY~CP~C~~~t   62 (360)
                      -++|.||.|+.++
T Consensus        33 ~~~~~Cp~C~~~~   45 (89)
T COG1997          33 RAKHVCPFCGRTT   45 (89)
T ss_pred             hcCCcCCCCCCcc
Confidence            4789999999875


No 75 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=20.54  E-value=43  Score=27.90  Aligned_cols=13  Identities=54%  Similarity=1.045  Sum_probs=9.7

Q ss_pred             CCcccCCCCCCcc
Q psy15724         50 PAKYTCPKCELKT   62 (360)
Q Consensus        50 ~~kY~CP~C~~~t   62 (360)
                      -++|+||.|+...
T Consensus        33 ~~ky~Cp~Cgk~~   45 (90)
T PF01780_consen   33 HAKYTCPFCGKTS   45 (90)
T ss_dssp             HS-BEESSSSSSE
T ss_pred             hCCCcCCCCCCce
Confidence            3689999999765


No 76 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=20.24  E-value=33  Score=29.08  Aligned_cols=26  Identities=27%  Similarity=0.698  Sum_probs=15.3

Q ss_pred             cCCccCcccCCCCC----CcccCCCCCCcc
Q psy15724         37 VSRLGDCEVCAIEP----AKYTCPKCELKT   62 (360)
Q Consensus        37 ~~~~~~C~vC~~~~----~kY~CP~C~~~t   62 (360)
                      ......|..|+...    ..|.||.|+...
T Consensus        67 ~p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (113)
T PF01155_consen   67 VPARARCRDCGHEFEPDEFDFSCPRCGSPD   96 (113)
T ss_dssp             E--EEEETTTS-EEECHHCCHH-SSSSSS-
T ss_pred             cCCcEECCCCCCEEecCCCCCCCcCCcCCC
Confidence            34456799999643    257899998753


Done!