BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15727
         (195 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DNS|A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60
           Provides Insight Into The Various Cross-Allergenicity Of
           The Pollen Group 4 Allergens
 pdb|4DNS|B Chain B, Crystal Structure Of Bermuda Grass Isoallergen Bg60
           Provides Insight Into The Various Cross-Allergenicity Of
           The Pollen Group 4 Allergens
          Length = 497

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 98  MIWLRYSAFIILYPLGTAGELLCFYSSQQYFSQYPKWYLDLPEP---WDSVFSY 148
           M W+    +I + P GT  +LL   S+ + F +Y   Y+  P P   W+ +F++
Sbjct: 307 MTWIESVPYIPMGPKGTVRDLLNRTSNIKAFGKYKSDYVLEPIPKSDWEKIFTW 360


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.143    0.469 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,131,646
Number of Sequences: 62578
Number of extensions: 190533
Number of successful extensions: 396
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 394
Number of HSP's gapped (non-prelim): 3
length of query: 195
length of database: 14,973,337
effective HSP length: 94
effective length of query: 101
effective length of database: 9,091,005
effective search space: 918191505
effective search space used: 918191505
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 49 (23.5 bits)