Query         psy1573
Match_columns 104
No_of_seqs    101 out of 445
Neff          6.4 
Searched_HMMs 46136
Date          Fri Aug 16 19:56:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1573.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1573hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2667|consensus              100.0 1.7E-36 3.6E-41  239.6  12.5  104    1-104   270-375 (379)
  2 PF07970 COPIIcoated_ERV:  Endo 100.0 6.6E-35 1.4E-39  216.7   8.3   88    1-89    134-222 (222)
  3 PF10399 UCR_Fe-S_N:  Ubiquitin  61.0     2.1 4.5E-05   24.1  -0.5   31   61-91      8-38  (41)
  4 KOG4085|consensus               57.7     9.3  0.0002   27.5   2.2   25   66-90     26-51  (175)
  5 PF11888 DUF3408:  Protein of u  53.9      22 0.00048   24.4   3.6   37   64-100    86-123 (136)
  6 PF01102 Glycophorin_A:  Glycop  51.8     8.5 0.00019   26.5   1.2   17   85-101    78-94  (122)
  7 PF05365 UCR_UQCRX_QCR9:  Ubiqu  44.0      18 0.00038   21.5   1.6   30   72-101    14-43  (55)
  8 TIGR03786 strep_pil_rpt strept  40.9      81  0.0018   19.0   4.5   31   23-64     11-41  (64)
  9 PF00673 Ribosomal_L5_C:  ribos  37.4      40 0.00087   21.8   2.7   23   55-77      1-23  (95)
 10 PF11118 DUF2627:  Protein of u  36.2      18  0.0004   23.0   0.9   22   67-88     40-61  (77)
 11 PF07413 Herpes_UL37_2:  Betahe  34.5      41 0.00089   26.3   2.7   43   58-100   228-273 (276)
 12 KOG2014|consensus               32.3      13 0.00028   29.7  -0.3   11   73-83    286-296 (331)
 13 PF02439 Adeno_E3_CR2:  Adenovi  29.6      36 0.00077   18.9   1.2   29   73-101     4-32  (38)
 14 PF00996 GDI:  GDP dissociation  28.8      46 0.00099   27.5   2.2   26   65-90    232-257 (438)
 15 PF05931 AgrD:  Staphylococcal   27.9      32 0.00069   19.7   0.9   24   67-90      7-33  (45)
 16 PRK08156 type III secretion sy  26.6      72  0.0016   25.7   2.9   30   67-96    174-203 (361)
 17 TIGR01404 FlhB_rel_III type II  26.2      74  0.0016   25.3   2.9   29   67-95    178-206 (342)
 18 COG3817 Predicted membrane pro  25.4      47   0.001   26.2   1.6   36   64-99    163-198 (313)
 19 COG0094 RplE Ribosomal protein  24.9      77  0.0017   23.3   2.6   25   54-78     83-107 (180)
 20 PF10661 EssA:  WXG100 protein   23.8      34 0.00073   24.0   0.6   13   81-93    129-141 (145)
 21 PRK09108 type III secretion sy  23.7      87  0.0019   25.1   2.9   30   67-96    181-210 (353)
 22 COG5056 ARE1 Acyl-CoA choleste  23.7      74  0.0016   26.8   2.6   33   63-95    298-330 (512)
 23 PRK12721 secretion system appa  23.7      88  0.0019   25.0   2.9   30   67-96    179-208 (349)
 24 smart00794 AgrD Staphylococcal  23.5      44 0.00096   19.2   0.9   20   71-90     14-33  (45)
 25 PRK00010 rplE 50S ribosomal pr  23.4      94   0.002   22.6   2.8   25   54-78     83-107 (179)
 26 COG3765 WzzB Chain length dete  23.2      55  0.0012   26.4   1.7   40   48-89    298-337 (347)
 27 KOG1652|consensus               23.0      57  0.0012   24.0   1.6   28   76-103    58-85  (183)
 28 PF09881 DUF2108:  Predicted me  22.8      65  0.0014   20.3   1.6   19   66-84      2-20  (72)
 29 PRK12468 flhB flagellar biosyn  22.6      94   0.002   25.3   2.9   30   67-96    186-215 (386)
 30 PF06459 RR_TM4-6:  Ryanodine R  22.1      51  0.0011   25.6   1.3   15   65-79    250-264 (274)
 31 PF11688 DUF3285:  Protein of u  22.0      35 0.00076   19.5   0.3   21   61-81     17-37  (45)
 32 PF15103 G0-G1_switch_2:  G0/G1  21.4      33 0.00072   23.0   0.1   23   77-99     28-50  (102)
 33 TIGR00328 flhB flagellar biosy  21.4   1E+02  0.0022   24.6   2.9   29   67-95    179-207 (347)
 34 PF02061 Lambda_CIII:  Lambda P  21.3 1.2E+02  0.0025   17.3   2.3   17   86-102    19-35  (45)
 35 PRK04219 rpl5p 50S ribosomal p  20.5 1.1E+02  0.0025   22.3   2.8   25   54-78     66-90  (177)
 36 KOG4405|consensus               20.3      53  0.0012   27.7   1.1   27   65-91    286-312 (547)
 37 PF06143 Baculo_11_kDa:  Baculo  20.2      64  0.0014   20.9   1.3   37   60-98     26-62  (84)

No 1  
>KOG2667|consensus
Probab=100.00  E-value=1.7e-36  Score=239.60  Aligned_cols=104  Identities=36%  Similarity=0.594  Sum_probs=95.7

Q ss_pred             CceeEEEEEEEeeEEcC-CceEEEEeeeEEEEEEEeecCCCCCCceeEEEEEeccceEEEEEeeeccHHHHHHHHHhhhc
Q psy1573           1 MLFQYFIDVVPTDVDTM-FTTLRTYQYSAKELSRVIDHDVGSHGMSGIFFKYNTNALKVIVKETRDSFLNFFIRLSGVLG   79 (104)
Q Consensus         1 ~~~~YflkvVPT~y~~~-~~~~~t~QYSvt~~~~~~~~~~~~~~~PGIfF~Yd~sPi~v~~~~~~~s~~~flt~lcaIiG   79 (104)
                      .+|+||+|||||.|++. +..+.|||||||++++...+..+..++|||||+||+|||+|+++|+|.||+|||||+|||||
T Consensus       270 ~~~~Yf~KvVPT~y~~~~~~~~~T~QysVt~~~~~~~~~~~~~~~PGifF~YelSPl~V~v~E~r~sf~~Flt~lCAIiG  349 (379)
T KOG2667|consen  270 TTFQYFLKVVPTVYKYKSGRVIDTNQYSVTEYEYVLHSHRAKSGIPGIFFKYELSPLMVKVTEERQSFSHFLTRLCAIIG  349 (379)
T ss_pred             cceeeEEEEcceEEEeecCceecceeeeeeeeEEeccccccccCCCeEEEEEecCceEEEEEeccccHHHHHHHHHHHhc
Confidence            37999999999999954 56899999999999999875555669999999999999999999999999999999999999


Q ss_pred             ceeehhhhhHHHHHHHHHHHh-hhcC
Q psy1573          80 GVYIVTGTCSISQGALVEYFR-AMEM  104 (104)
Q Consensus        80 Gvf~v~g~id~~~~~~~~~~~-k~~~  104 (104)
                      |+||++||+|++++++.+.++ |.++
T Consensus       350 Gvftvagiid~~~~~~~~~i~~k~~~  375 (379)
T KOG2667|consen  350 GVFTVAGILDSLLYHILELIKGKIAL  375 (379)
T ss_pred             ceeehHHHHHHHHHHHHHHHhcchhh
Confidence            999999999999999999998 6653


No 2  
>PF07970 COPIIcoated_ERV:  Endoplasmic reticulum vesicle transporter ;  InterPro: IPR012936 This domain occurs in many hypothetical proteins, and also two partially characterised proteins. One of these proteins, PTX1 Q96RQ1 from SWISSPROT, is a homeodomain-containing transcription factor involved in regulating all pituitary hormone genes []. This protein is down regulated in prostate carcinoma []. The other protein, ERGIC-32 Q969X5 from SWISSPROT, is involved in protein transport from the ER to the Golgi [].
Probab=100.00  E-value=6.6e-35  Score=216.70  Aligned_cols=88  Identities=42%  Similarity=0.820  Sum_probs=81.7

Q ss_pred             CceeEEEEEEEeeEEcCCc-eEEEEeeeEEEEEEEeecCCCCCCceeEEEEEeccceEEEEEeeeccHHHHHHHHHhhhc
Q psy1573           1 MLFQYFIDVVPTDVDTMFT-TLRTYQYSAKELSRVIDHDVGSHGMSGIFFKYNTNALKVIVKETRDSFLNFFIRLSGVLG   79 (104)
Q Consensus         1 ~~~~YflkvVPT~y~~~~~-~~~t~QYSvt~~~~~~~~~~~~~~~PGIfF~Yd~sPi~v~~~~~~~s~~~flt~lcaIiG   79 (104)
                      ++|+||||||||+|...++ ..+|||||||++.+.++... +.++|||||+||||||+|+++|+|+||+|||++||||||
T Consensus       134 ~~~~YflkvVPT~y~~~~~~~~~t~qYsvt~~~~~~~~~~-~~~~PGI~F~Yd~SPi~v~~~~~r~s~~~flt~lcaIiG  212 (222)
T PF07970_consen  134 YMYQYFLKVVPTTYEDLDGFSIETYQYSVTEHSRPLNGGS-SGGLPGIFFKYDFSPIMVVITEDRKSFLHFLTRLCAIIG  212 (222)
T ss_pred             eeEEEEEEEeeeeeEeccccccccccccceeeeeeccCCC-CCCCceEEEEEeceeEEEEEEEecCCHHHHHHHHHHHhc
Confidence            4799999999999998864 47999999999999987642 479999999999999999999999999999999999999


Q ss_pred             ceeehhhhhH
Q psy1573          80 GVYIVTGTCS   89 (104)
Q Consensus        80 Gvf~v~g~id   89 (104)
                      |+||++|++|
T Consensus       213 Gvftv~gliD  222 (222)
T PF07970_consen  213 GVFTVAGLID  222 (222)
T ss_pred             hHheEEEecC
Confidence            9999999998


No 3  
>PF10399 UCR_Fe-S_N:  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal;  InterPro: IPR019470  This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex). This enzymex is an oligomeric membrane protein complex that is a component of respiratory and photosynthetic electron transfer chains. It couples the transfer of electrons from ubiquinol to cytochrome c with the generation of a protein gradient across the membrane []. This entry is associated with IPR017941 from INTERPRO, IPR004192 from INTERPRO and IPR015248 from INTERPRO. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0055114 oxidation-reduction process; PDB: 1ZRT_R 2QJY_R 2FYN_L 2QJK_O 2QJP_I 2YIU_F.
Probab=60.97  E-value=2.1  Score=24.09  Aligned_cols=31  Identities=23%  Similarity=0.207  Sum_probs=23.9

Q ss_pred             EeeeccHHHHHHHHHhhhcceeehhhhhHHH
Q psy1573          61 KETRDSFLNFFIRLSGVLGGVYIVTGTCSIS   91 (104)
Q Consensus        61 ~~~~~s~~~flt~lcaIiGGvf~v~g~id~~   91 (104)
                      ..+|+.|+...+...|-+|++.+..-+++++
T Consensus         8 ~~~RRdFL~~at~~~gavG~~~~a~Pfv~s~   38 (41)
T PF10399_consen    8 DPTRRDFLTIATSAVGAVGAAAAAWPFVSSM   38 (41)
T ss_dssp             --HHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            4567889989999999999888877777653


No 4  
>KOG4085|consensus
Probab=57.74  E-value=9.3  Score=27.48  Aligned_cols=25  Identities=28%  Similarity=0.539  Sum_probs=19.1

Q ss_pred             cHHHHHHHHHhhhcceee-hhhhhHH
Q psy1573          66 SFLNFFIRLSGVLGGVYI-VTGTCSI   90 (104)
Q Consensus        66 s~~~flt~lcaIiGGvf~-v~g~id~   90 (104)
                      =|+.++.|+.||+||++. ++|.++-
T Consensus        26 Ww~r~l~rl~gilgaf~~~~fGvf~~   51 (175)
T KOG4085|consen   26 WWYRWLCRLSGILGAFSCAIFGVFNC   51 (175)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhH
Confidence            358999999999999987 4444433


No 5  
>PF11888 DUF3408:  Protein of unknown function (DUF3408);  InterPro: IPR021823  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 128 to 160 amino acids in length. 
Probab=53.92  E-value=22  Score=24.37  Aligned_cols=37  Identities=16%  Similarity=0.168  Sum_probs=30.3

Q ss_pred             eccHHHHHHHHHhhhc-ceeehhhhhHHHHHHHHHHHh
Q psy1573          64 RDSFLNFFIRLSGVLG-GVYIVTGTCSISQGALVEYFR  100 (104)
Q Consensus        64 ~~s~~~flt~lcaIiG-Gvf~v~g~id~~~~~~~~~~~  100 (104)
                      +..+..=|.++..+|| +=.+++|+||.++..=++..+
T Consensus        86 ~~e~h~~l~~Iv~~ig~~~~si~~yidNIL~~Hle~~~  123 (136)
T PF11888_consen   86 SRETHERLSRIVRVIGERKMSISGYIDNILRHHLEEYR  123 (136)
T ss_pred             CHHHHHHHHHHHHHHCCCCCcHHHHHHHHHHHHHHHHH
Confidence            4677888999999999 669999999999987655443


No 6  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=51.83  E-value=8.5  Score=26.46  Aligned_cols=17  Identities=6%  Similarity=0.006  Sum_probs=6.8

Q ss_pred             hhhhHHHHHHHHHHHhh
Q psy1573          85 TGTCSISQGALVEYFRA  101 (104)
Q Consensus        85 ~g~id~~~~~~~~~~~k  101 (104)
                      .|+|--+.+...|..||
T Consensus        78 Ig~Illi~y~irR~~Kk   94 (122)
T PF01102_consen   78 IGIILLISYCIRRLRKK   94 (122)
T ss_dssp             HHHHHHHHHHHHHHS--
T ss_pred             HHHHHHHHHHHHHHhcc
Confidence            34443344444455554


No 7  
>PF05365 UCR_UQCRX_QCR9:  Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like;  InterPro: IPR008027 The UQCRX/QCR9 protein is the 9/10 subunit of complex III, and is a protein of about 7 kDa. Deletion of QCR9 results in the inability of Saccharomyces cerevisiae to grow on a fermentable carbon source []. The protein is part of the mitchondrial respiratory chain. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0006122 mitochondrial electron transport, ubiquinol to cytochrome c, 0005740 mitochondrial envelope; PDB: 3CX5_T 2IBZ_I 1KYO_I 3CXH_T 1EZV_I 1P84_I 1KB9_I 3H1L_W 3L71_W 3L73_W ....
Probab=44.01  E-value=18  Score=21.51  Aligned_cols=30  Identities=3%  Similarity=0.166  Sum_probs=24.4

Q ss_pred             HHHHhhhcceeehhhhhHHHHHHHHHHHhh
Q psy1573          72 IRLSGVLGGVYIVTGTCSISQGALVEYFRA  101 (104)
Q Consensus        72 t~lcaIiGGvf~v~g~id~~~~~~~~~~~k  101 (104)
                      +=+.+|++|.|+.-..+|......-+...|
T Consensus        14 ~y~~~i~~gaf~fe~~fd~~~d~~w~~~Nk   43 (55)
T PF05365_consen   14 TYVLTIFAGAFFFERAFDSATDKIWDSINK   43 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHHHhccC
Confidence            346789999999999999999988776643


No 8  
>TIGR03786 strep_pil_rpt streptococcal pilin isopeptide linkage domain. This model describes a domain that occurs once in the major pilin of Streptococcus pyogenes, Spy0128, but in higher copy numbers in other streptococcal proteins. The domain occurs nine times in a surface-anchored protein of Bifidobacterium longum. All members of this family have LPXTG-type sortase target sequences. The S. pyogenes major pilin has been shown to undergo isopeptide bond cross-linking, mediated by sortases, that are critical to maintaining pilus structural integrity. One such Lys-to-Asn isopeptide bond is to a near-invariant Asn near the C-terminal end of this domain (column 81 of the seed alignment). A Glu in the S. pyogenes major pilin (column 25 of the seed alignment), invariant as Glu or Gln, is described as catalytic for isopeptide bond formation.
Probab=40.92  E-value=81  Score=18.98  Aligned_cols=31  Identities=32%  Similarity=0.485  Sum_probs=21.1

Q ss_pred             EEeeeEEEEEEEeecCCCCCCceeEEEEEeccceEEEEEeee
Q psy1573          23 TYQYSAKELSRVIDHDVGSHGMSGIFFKYNTNALKVIVKETR   64 (104)
Q Consensus        23 t~QYSvt~~~~~~~~~~~~~~~PGIfF~Yd~sPi~v~~~~~~   64 (104)
                      +|.|.+.|..         ...||  +.||=+...|.++-..
T Consensus        11 ~Y~YtV~E~~---------g~~~g--vtYD~~~~~vtV~V~~   41 (64)
T TIGR03786        11 TYTYTITEVK---------GKEPG--VTYDTTVHTVTVTVTD   41 (64)
T ss_pred             EEEEEEEEeC---------CCCCC--eEecCCEEEEEEEEEE
Confidence            7888777763         34567  6899888666665443


No 9  
>PF00673 Ribosomal_L5_C:  ribosomal L5P family C-terminus;  InterPro: IPR002132 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L5, ~180 amino acids in length, is one of the proteins from the large ribosomal subunit. In Escherichia coli, L5 is known to be involved in binding 5S RNA to the large ribosomal subunit. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, , , ], groups:  Eubacterial L5. Algal chloroplast L5. Cyanelle L5. Archaebacterial L5. Mammalian L11.  Tetrahymena thermophila L21.  Dictyostelium discoideum (Slime mold) L5  Saccharomyces cerevisiae (Baker's yeast) L16 (39A). Plant mitochondrial L5. ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1IQ4_B 2ZJR_D 2ZJP_D 3PIO_D 3CF5_D 2ZJQ_D 3DLL_D 3PIP_D 2WDL_G 3UZN_G ....
Probab=37.42  E-value=40  Score=21.78  Aligned_cols=23  Identities=13%  Similarity=0.213  Sum_probs=21.7

Q ss_pred             ceEEEEEeeeccHHHHHHHHHhh
Q psy1573          55 ALKVIVKETRDSFLNFFIRLSGV   77 (104)
Q Consensus        55 Pi~v~~~~~~~s~~~flt~lcaI   77 (104)
                      |+.++++-+....+.||-+++.+
T Consensus         1 PiG~kvTLRg~~m~~FL~kli~~   23 (95)
T PF00673_consen    1 PIGCKVTLRGKKMYEFLDKLITI   23 (95)
T ss_dssp             EEEEEEEEEHHHHHHHHHHHHHT
T ss_pred             CeEEEEEEccHHHHHHHHHHHHH
Confidence            89999999999999999999887


No 10 
>PF11118 DUF2627:  Protein of unknown function (DUF2627);  InterPro: IPR020138 This entry represents uncharacterised membrane proteins with no known function.
Probab=36.17  E-value=18  Score=23.05  Aligned_cols=22  Identities=27%  Similarity=0.326  Sum_probs=20.6

Q ss_pred             HHHHHHHHHhhhcceeehhhhh
Q psy1573          67 FLNFFIRLSGVLGGVYIVTGTC   88 (104)
Q Consensus        67 ~~~flt~lcaIiGGvf~v~g~i   88 (104)
                      |.+|+..+...++|+.-++|+|
T Consensus        40 wlqfl~G~~lf~~G~~Fi~GfI   61 (77)
T PF11118_consen   40 WLQFLAGLLLFAIGVGFIAGFI   61 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHhHh
Confidence            8999999999999999999886


No 11 
>PF07413 Herpes_UL37_2:  Betaherpesvirus immediate-early glycoprotein UL37;  InterPro: IPR010880 This family consists of several Betaherpesvirus immediate-early glycoprotein UL37 sequences. The human cytomegalovirus (HCMV) UL37 immediate-early regulatory protein is a type I integral membrane N-glycoprotein which traffics through the ER and the Golgi network [].
Probab=34.51  E-value=41  Score=26.26  Aligned_cols=43  Identities=9%  Similarity=0.038  Sum_probs=31.1

Q ss_pred             EEEEeeeccHHHH---HHHHHhhhcceeehhhhhHHHHHHHHHHHh
Q psy1573          58 VIVKETRDSFLNF---FIRLSGVLGGVYIVTGTCSISQGALVEYFR  100 (104)
Q Consensus        58 v~~~~~~~s~~~f---lt~lcaIiGGvf~v~g~id~~~~~~~~~~~  100 (104)
                      ..+..+.+.+.+.   ++++|++.||.++..+++=-++.+..+.+-
T Consensus       228 ~~~~~~~~~l~~~~~~~~g~~~v~~G~~~lL~LFc~l~~~~Rr~i~  273 (276)
T PF07413_consen  228 FILRVDYRALGHWLAALIGMFFVASGAFMLLSLFCCLSIWRRRDII  273 (276)
T ss_pred             EEEecCCcchhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHhhhh
Confidence            3444555666655   889999999999999988777766655543


No 12 
>KOG2014|consensus
Probab=32.29  E-value=13  Score=29.66  Aligned_cols=11  Identities=27%  Similarity=0.673  Sum_probs=8.8

Q ss_pred             HHHhhhcceee
Q psy1573          73 RLSGVLGGVYI   83 (104)
Q Consensus        73 ~lcaIiGGvf~   83 (104)
                      -.||||||+.+
T Consensus       286 Pv~AvVGGiva  296 (331)
T KOG2014|consen  286 PVCAVVGGILA  296 (331)
T ss_pred             chhhhhhhHhH
Confidence            47999999853


No 13 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=29.58  E-value=36  Score=18.88  Aligned_cols=29  Identities=7%  Similarity=-0.015  Sum_probs=18.0

Q ss_pred             HHHhhhcceeehhhhhHHHHHHHHHHHhh
Q psy1573          73 RLSGVLGGVYIVTGTCSISQGALVEYFRA  101 (104)
Q Consensus        73 ~lcaIiGGvf~v~g~id~~~~~~~~~~~k  101 (104)
                      ++.|||.||.+...++--.+.--.--.||
T Consensus         4 s~IaIIv~V~vg~~iiii~~~~YaCcykk   32 (38)
T PF02439_consen    4 STIAIIVAVVVGMAIIIICMFYYACCYKK   32 (38)
T ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHHHcc
Confidence            46788888888777666554443333344


No 14 
>PF00996 GDI:  GDP dissociation inhibitor;  InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function. This post-translational modification is catalysed by Rab geranylgeranyl transferase (Rab-GGTase), a multi-subunit enzyme that contains a catalytic heterodimer and an accessory component, termed Rab escort protein (REP)-1 []. REP-1 presents newly- synthesised Rab proteins to the catalytic component, and forms a stable complex with the prenylated proteins following the transfer reaction. The mechanism of REP-1-mediated membrane association of Rab5 is similar to that mediated by Rab GDP dissociation inhibitor (GDI). REP-1 and Rab GDI also share other functional properties, including the ability to inhibit the release of GDP and to remove Rab proteins from membranes. The crystal structure of the bovine alpha-isoform of Rab GDI has been determined to a resolution of 1.81A []. The protein is composed of two main structural units: a large complex multi-sheet domain I, and a smaller alpha-helical domain II. The structural organisation of domain I is closely related to FAD-containing monooxygenases and oxidases []. Conserved regions common to GDI and the choroideraemia gene product, which delivers Rab to catalytic subunits of Rab geranylgeranyltransferase II, are clustered on one face of the domain []. The two most conserved regions form a compact structure at the apex of the molecule; site-directed mutagenesis has shown these regions to play a critical role in the binding of Rab proteins [].; PDB: 1VG9_C 1VG0_A 1LTX_R 3P1W_A 3CPH_H 3CPJ_G 3CPI_H 1UKV_G 2BCG_G 1GND_A ....
Probab=28.76  E-value=46  Score=27.46  Aligned_cols=26  Identities=31%  Similarity=0.523  Sum_probs=18.8

Q ss_pred             ccHHHHHHHHHhhhcceeehhhhhHH
Q psy1573          65 DSFLNFFIRLSGVLGGVYIVTGTCSI   90 (104)
Q Consensus        65 ~s~~~flt~lcaIiGGvf~v~g~id~   90 (104)
                      .-+-|=+-|+||+-||+|..-.-++.
T Consensus       232 GELpQ~FcRl~AV~GG~Y~L~~~i~~  257 (438)
T PF00996_consen  232 GELPQAFCRLSAVYGGTYMLNRPIDE  257 (438)
T ss_dssp             THHHHHHHHHHHHTT-EEESS--EEE
T ss_pred             ccHHHHHHHHhhhcCcEEEeCCccce
Confidence            35778899999999999987665554


No 15 
>PF05931 AgrD:  Staphylococcal AgrD protein;  InterPro: IPR009229 This family consists of several AgrD proteins from many Staphylococcus species. The agr locus was initially described in Staphylococcus aureus as an element controlling the production of exoproteins implicated in virulence. Its pattern of action has been shown to be complex, upregulating certain extracellular toxins and enzymes expressed post-exponentially and repressing some exponential-phase surface components. AgrD encodes the precursor of the autoinducing peptide (AIP).The AIP derived from AgrD by the action of AgrB interacts with AgrC in the membrane to activate AgrA, which upregulates transcription both from promoter P2, amplifying the response, and from P3, initiating the production of a novel effector: RNAIII. In S. aureus, delta-hemolysin is the only translation product of RNA III and is not involved in the regulatory functions of the transcript, which is therefore the primary agent for modulating the expression of other operons controlled by agr [].
Probab=27.89  E-value=32  Score=19.70  Aligned_cols=24  Identities=25%  Similarity=0.519  Sum_probs=14.8

Q ss_pred             HHHHHHHHH---hhhcceeehhhhhHH
Q psy1573          67 FLNFFIRLS---GVLGGVYIVTGTCSI   90 (104)
Q Consensus        67 ~~~flt~lc---aIiGGvf~v~g~id~   90 (104)
                      +..+++.+.   |.++|.-+|.++.|-
T Consensus         7 ~~~~~t~~f~~IG~~a~~~~C~~~~DE   33 (45)
T PF05931_consen    7 FFKFFTKIFEFIGNVAGYNPCSGYFDE   33 (45)
T ss_pred             HHHHHHHHHHHHHhhhccCccceeccC
Confidence            445555554   455566778888773


No 16 
>PRK08156 type III secretion system protein SpaS; Validated
Probab=26.55  E-value=72  Score=25.72  Aligned_cols=30  Identities=3%  Similarity=0.072  Sum_probs=25.7

Q ss_pred             HHHHHHHHHhhhcceeehhhhhHHHHHHHH
Q psy1573          67 FLNFFIRLSGVLGGVYIVTGTCSISQGALV   96 (104)
Q Consensus        67 ~~~flt~lcaIiGGvf~v~g~id~~~~~~~   96 (104)
                      +.+.+..+|..+++++.+.+++|-...+..
T Consensus       174 ~~~~~~~l~~~~~~~~lvia~~D~~~Qr~~  203 (361)
T PRK08156        174 WRELLVKLVLTFLACALIVLILDFIAEYFL  203 (361)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            567788999999999999999999887753


No 17 
>TIGR01404 FlhB_rel_III type III secretion protein, YscU/HrpY family. This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FlhB (TIGRFAMs model TIGR00328). This model may not identify all type III secretion system FlhB homologs.
Probab=26.16  E-value=74  Score=25.31  Aligned_cols=29  Identities=17%  Similarity=0.161  Sum_probs=25.5

Q ss_pred             HHHHHHHHHhhhcceeehhhhhHHHHHHH
Q psy1573          67 FLNFFIRLSGVLGGVYIVTGTCSISQGAL   95 (104)
Q Consensus        67 ~~~flt~lcaIiGGvf~v~g~id~~~~~~   95 (104)
                      +.+.+..+|..+++++.+.+++|-...+.
T Consensus       178 ~~~~~~~l~~~~~~~~~via~~D~~~qr~  206 (342)
T TIGR01404       178 VGELLKLLILVCLGFFLVVGLADFAFQRY  206 (342)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56888899999999999999999988764


No 18 
>COG3817 Predicted membrane protein [Function unknown]
Probab=25.40  E-value=47  Score=26.16  Aligned_cols=36  Identities=17%  Similarity=0.314  Sum_probs=30.4

Q ss_pred             eccHHHHHHHHHhhhcceeehhhhhHHHHHHHHHHH
Q psy1573          64 RDSFLNFFIRLSGVLGGVYIVTGTCSISQGALVEYF   99 (104)
Q Consensus        64 ~~s~~~flt~lcaIiGGvf~v~g~id~~~~~~~~~~   99 (104)
                      +.+|.-.+-++.|-+|-+|+.+|.=|.+-+-..+.+
T Consensus       163 ~v~wa~iLPQ~LaaLG~vFa~aGvG~~ia~L~~~~i  198 (313)
T COG3817         163 QVSWAAILPQMLAALGAVFASAGVGDVIAHLISEII  198 (313)
T ss_pred             HhhHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHc
Confidence            468999999999999999999999888777665543


No 19 
>COG0094 RplE Ribosomal protein L5 [Translation, ribosomal structure and biogenesis]
Probab=24.87  E-value=77  Score=23.30  Aligned_cols=25  Identities=20%  Similarity=0.264  Sum_probs=23.4

Q ss_pred             cceEEEEEeeeccHHHHHHHHHhhh
Q psy1573          54 NALKVIVKETRDSFLNFFIRLSGVL   78 (104)
Q Consensus        54 sPi~v~~~~~~~s~~~flt~lcaIi   78 (104)
                      .||.+++|-+....+.||-+++.|.
T Consensus        83 ~pIG~KVTLRg~rm~eFL~rl~~i~  107 (180)
T COG0094          83 MPIGVKVTLRGERMYEFLDRLLNIA  107 (180)
T ss_pred             CeeeEEEEEchHHHHHHHHHHHHhh
Confidence            5899999999999999999999886


No 20 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=23.84  E-value=34  Score=24.04  Aligned_cols=13  Identities=8%  Similarity=0.146  Sum_probs=5.6

Q ss_pred             eeehhhhhHHHHH
Q psy1573          81 VYIVTGTCSISQG   93 (104)
Q Consensus        81 vf~v~g~id~~~~   93 (104)
                      +.++++.|-..++
T Consensus       129 ll~i~~giy~~~r  141 (145)
T PF10661_consen  129 LLAICGGIYVVLR  141 (145)
T ss_pred             HHHHHHHHHHHHH
Confidence            3444444444444


No 21 
>PRK09108 type III secretion system protein HrcU; Validated
Probab=23.74  E-value=87  Score=25.07  Aligned_cols=30  Identities=17%  Similarity=0.423  Sum_probs=25.7

Q ss_pred             HHHHHHHHHhhhcceeehhhhhHHHHHHHH
Q psy1573          67 FLNFFIRLSGVLGGVYIVTGTCSISQGALV   96 (104)
Q Consensus        67 ~~~flt~lcaIiGGvf~v~g~id~~~~~~~   96 (104)
                      +.+++..++..+++++.+.+++|-...+..
T Consensus       181 ~~~~~~~l~~~~~~~~~via~~D~~~qr~~  210 (353)
T PRK09108        181 LWTVLMKLLAVAAGVFLLVGAADWKIQRWL  210 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            567888999999999999999999887653


No 22 
>COG5056 ARE1 Acyl-CoA cholesterol acyltransferase [Lipid metabolism]
Probab=23.71  E-value=74  Score=26.76  Aligned_cols=33  Identities=6%  Similarity=0.137  Sum_probs=28.3

Q ss_pred             eeccHHHHHHHHHhhhcceeehhhhhHHHHHHH
Q psy1573          63 TRDSFLNFFIRLSGVLGGVYIVTGTCSISQGAL   95 (104)
Q Consensus        63 ~~~s~~~flt~lcaIiGGvf~v~g~id~~~~~~   95 (104)
                      .|..|.-.+-..||++|++|-.+-..|..+.-+
T Consensus       298 a~~rw~yvleK~~~~fg~ifL~vi~~d~ymvPv  330 (512)
T COG5056         298 ARIRWRYVLEKACATFGTIFLMVIVADQYMVPV  330 (512)
T ss_pred             heeeHHHHHHHHHHHHHHHHHHHHHHHHHhhHH
Confidence            457888999999999999999999999877653


No 23 
>PRK12721 secretion system apparatus protein SsaU; Reviewed
Probab=23.70  E-value=88  Score=25.01  Aligned_cols=30  Identities=23%  Similarity=0.195  Sum_probs=25.6

Q ss_pred             HHHHHHHHHhhhcceeehhhhhHHHHHHHH
Q psy1573          67 FLNFFIRLSGVLGGVYIVTGTCSISQGALV   96 (104)
Q Consensus        67 ~~~flt~lcaIiGGvf~v~g~id~~~~~~~   96 (104)
                      +.+.+..++..+.+++.+.+++|-+..+..
T Consensus       179 ~~~~~~~l~~~~~~~~~via~~D~~~qr~~  208 (349)
T PRK12721        179 VSTLIFWLWGGLLACYLVFGILDYSFQRYK  208 (349)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            568888999999999999999998887653


No 24 
>smart00794 AgrD Staphylococcal AgrD protein. This family consists of several AgrD proteins from many Staphylococcus species. The agr locus was initially described in Staphylococcus aureus as an element controlling the production of exoproteins implicated in virulence. Its pattern of action has been shown to be complex, upregulating certain extracellular toxins and enzymes expressed post-exponentially and repressing some exponential-phase surface components. AgrD encodes the precursor of the autoinducing peptide (AIP).The AIP derived from AgrD by the action of AgrB interacts with AgrC in the membrane to activate AgrA, which upregulates transcription both from promoter P2, amplifying the response, and from P3, initiating the production of a novel effector: RNAIII. In S. aureus, delta-hemolysin is the only translation product of RNA III and is not involved in the regulatory functions of the transcript, which is therefore the primary agent for modulating the expression of other operons con
Probab=23.51  E-value=44  Score=19.15  Aligned_cols=20  Identities=25%  Similarity=0.283  Sum_probs=13.6

Q ss_pred             HHHHHhhhcceeehhhhhHH
Q psy1573          71 FIRLSGVLGGVYIVTGTCSI   90 (104)
Q Consensus        71 lt~lcaIiGGvf~v~g~id~   90 (104)
                      +-...|.++|.-+|.++.|-
T Consensus        14 ~f~~IG~~a~~~~C~~~fDE   33 (45)
T smart00794       14 FFESIGNVAGYNPCTGYFDE   33 (45)
T ss_pred             HHHHHHHHhcCCcccccCCC
Confidence            33445666677889988873


No 25 
>PRK00010 rplE 50S ribosomal protein L5; Validated
Probab=23.40  E-value=94  Score=22.55  Aligned_cols=25  Identities=16%  Similarity=0.223  Sum_probs=23.0

Q ss_pred             cceEEEEEeeeccHHHHHHHHHhhh
Q psy1573          54 NALKVIVKETRDSFLNFFIRLSGVL   78 (104)
Q Consensus        54 sPi~v~~~~~~~s~~~flt~lcaIi   78 (104)
                      .|+.++++-+....++||-+++.++
T Consensus        83 ~piG~kVTLRg~~my~FL~kli~~v  107 (179)
T PRK00010         83 MPIGCKVTLRGERMYEFLDRLINIA  107 (179)
T ss_pred             CEEEEEEEECcHHHHHHHHHHHHHh
Confidence            5799999999999999999999876


No 26 
>COG3765 WzzB Chain length determinant protein [Cell envelope biogenesis, outer membrane]
Probab=23.24  E-value=55  Score=26.44  Aligned_cols=40  Identities=10%  Similarity=0.190  Sum_probs=28.5

Q ss_pred             EEEEeccceEEEEEeeeccHHHHHHHHHhhhcceeehhhhhH
Q psy1573          48 FFKYNTNALKVIVKETRDSFLNFFIRLSGVLGGVYIVTGTCS   89 (104)
Q Consensus        48 fF~Yd~sPi~v~~~~~~~s~~~flt~lcaIiGGvf~v~g~id   89 (104)
                      -|+|+-+|-.=....  .|=..+++-+.|+|||++.+...+=
T Consensus       298 ~yRYl~~P~~Pvkrd--~PrrA~ilil~~LiGgm~g~g~vL~  337 (347)
T COG3765         298 TYRYLQKPTLPVKRD--SPRRAIILILGALIGGMLGAGVVLL  337 (347)
T ss_pred             EEEecCCCCCCCcCC--CcchHHHHHHHHHHHHHHHHHHHHH
Confidence            478888886544332  3446788899999999988776543


No 27 
>KOG1652|consensus
Probab=23.00  E-value=57  Score=24.05  Aligned_cols=28  Identities=21%  Similarity=0.183  Sum_probs=23.4

Q ss_pred             hhhcceeehhhhhHHHHHHHHHHHhhhc
Q psy1573          76 GVLGGVYIVTGTCSISQGALVEYFRAME  103 (104)
Q Consensus        76 aIiGGvf~v~g~id~~~~~~~~~~~k~~  103 (104)
                      .-+||-|++-|-+.+.++-++..+||.|
T Consensus        58 p~~ggsFAvwgglfSt~dC~Lv~~R~Ke   85 (183)
T KOG1652|consen   58 PQSGGSFAVWGGLFSTVDCALVAIRKKE   85 (183)
T ss_pred             cccccceeeeechhhHHHHHHHHHhccc
Confidence            5679999999999999988888887655


No 28 
>PF09881 DUF2108:  Predicted membrane protein (DUF2108);  InterPro: IPR019213  This entry is found in various hypothetical archaeal proteins, has no known function. 
Probab=22.76  E-value=65  Score=20.26  Aligned_cols=19  Identities=11%  Similarity=0.329  Sum_probs=14.5

Q ss_pred             cHHHHHHHHHhhhcceeeh
Q psy1573          66 SFLNFFIRLSGVLGGVYIV   84 (104)
Q Consensus        66 s~~~flt~lcaIiGGvf~v   84 (104)
                      .+...+.-.||++||+-++
T Consensus         2 ~~l~li~~~~~iiG~ig~i   20 (72)
T PF09881_consen    2 EILPLISAACAIIGAIGAI   20 (72)
T ss_pred             ccHHHHHHHHHHHhhheee
Confidence            3456777889999998765


No 29 
>PRK12468 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=22.62  E-value=94  Score=25.25  Aligned_cols=30  Identities=10%  Similarity=-0.208  Sum_probs=25.3

Q ss_pred             HHHHHHHHHhhhcceeehhhhhHHHHHHHH
Q psy1573          67 FLNFFIRLSGVLGGVYIVTGTCSISQGALV   96 (104)
Q Consensus        67 ~~~flt~lcaIiGGvf~v~g~id~~~~~~~   96 (104)
                      +.+++..++..++.++.+.+++|-+..+..
T Consensus       186 ~~~~~~~l~~~~~~~~~via~~D~~~qr~~  215 (386)
T PRK12468        186 ALHLIIFCGLVVVLGLSPMVGFDVFYQITS  215 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            467888899999999999999999887653


No 30 
>PF06459 RR_TM4-6:  Ryanodine Receptor TM 4-6;  InterPro: IPR009460  The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity []. This region covers TM regions 4-6 of the ryanodine receptor 1 family.; GO: 0005219 ryanodine-sensitive calcium-release channel activity, 0006874 cellular calcium ion homeostasis, 0016021 integral to membrane
Probab=22.07  E-value=51  Score=25.59  Aligned_cols=15  Identities=20%  Similarity=0.386  Sum_probs=11.1

Q ss_pred             ccHHHHHHHHHhhhc
Q psy1573          65 DSFLNFFIRLSGVLG   79 (104)
Q Consensus        65 ~s~~~flt~lcaIiG   79 (104)
                      -++.|.|+++|.|||
T Consensus       250 lAvlHtiiSf~clIg  264 (274)
T PF06459_consen  250 LAVLHTIISFACLIG  264 (274)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            346788888888876


No 31 
>PF11688 DUF3285:  Protein of unknown function (DUF3285);  InterPro: IPR021702  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=22.02  E-value=35  Score=19.53  Aligned_cols=21  Identities=24%  Similarity=0.430  Sum_probs=16.0

Q ss_pred             EeeeccHHHHHHHHHhhhcce
Q psy1573          61 KETRDSFLNFFIRLSGVLGGV   81 (104)
Q Consensus        61 ~~~~~s~~~flt~lcaIiGGv   81 (104)
                      +..++|+.||.....|.+|=+
T Consensus        17 RKg~~SL~HF~LT~~gll~~l   37 (45)
T PF11688_consen   17 RKGGTSLFHFGLTAVGLLGFL   37 (45)
T ss_pred             HccCcchhHHHHHHHHHHHHH
Confidence            345689999999888887643


No 32 
>PF15103 G0-G1_switch_2:  G0/G1 switch protein 2
Probab=21.40  E-value=33  Score=22.98  Aligned_cols=23  Identities=26%  Similarity=0.252  Sum_probs=18.4

Q ss_pred             hhcceeehhhhhHHHHHHHHHHH
Q psy1573          77 VLGGVYIVTGTCSISQGALVEYF   99 (104)
Q Consensus        77 IiGGvf~v~g~id~~~~~~~~~~   99 (104)
                      ++|+++++.|++-.++..+...|
T Consensus        28 vLGSvLA~~Gvv~GLVEtVCsPF   50 (102)
T PF15103_consen   28 VLGSVLAFFGVVIGLVETVCSPF   50 (102)
T ss_pred             hhhhHHHHHHHHHHHHHHHhCcc
Confidence            67999999999888888776544


No 33 
>TIGR00328 flhB flagellar biosynthetic protein FlhB. FlhB and its functionally equivalent orthologs, from among a larger superfamily of proteins involved in type III protein export systems, are specifically involved in flagellar protein export. The seed members are restricted and the trusted cutoff is set high such that the proteins gathered by this model play roles specifically related to flagellar structures. Full-length homologs scoring below the trusted cutoff are involved in peptide export but not necessarily in the creation of flagella.
Probab=21.40  E-value=1e+02  Score=24.58  Aligned_cols=29  Identities=14%  Similarity=0.014  Sum_probs=24.9

Q ss_pred             HHHHHHHHHhhhcceeehhhhhHHHHHHH
Q psy1573          67 FLNFFIRLSGVLGGVYIVTGTCSISQGAL   95 (104)
Q Consensus        67 ~~~flt~lcaIiGGvf~v~g~id~~~~~~   95 (104)
                      +.+.+..++..+++++.+.+++|-...+.
T Consensus       179 ~~~~~~~l~~~~~~~~~via~~D~~~qr~  207 (347)
T TIGR00328       179 FLDIAKSLLILVLLLLLVIAVFDYFFQRW  207 (347)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56788899999999999999999887764


No 34 
>PF02061 Lambda_CIII:  Lambda Phage CIII;  InterPro: IPR013056  Bacteriophage lambda regulatory protein CIII is a small protein that plays a role in stabilising the CII transcriptional activator, via a mechanism that is not yet fully understood [, ]. Stabilised CII activates CI, the gene for the repressor protein that prevents transcription of proteins required for lytic development. The central portion of the protein is well conserved and is both necessary and sufficient for the activity of the protein []. Comparative analysis of the CIII sequence in lambda, Bacteriophage HK022 and the lambdoid Enterobacteria phage P22 has led to the suggestion that this central region assumes an amphipathic alpha-helical structure []. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=21.30  E-value=1.2e+02  Score=17.26  Aligned_cols=17  Identities=6%  Similarity=0.036  Sum_probs=11.4

Q ss_pred             hhhHHHHHHHHHHHhhh
Q psy1573          86 GTCSISQGALVEYFRAM  102 (104)
Q Consensus        86 g~id~~~~~~~~~~~k~  102 (104)
                      +++|++..++..-|||+
T Consensus        19 SLLdrItRklr~gwKRl   35 (45)
T PF02061_consen   19 SLLDRITRKLRDGWKRL   35 (45)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            56677777776667653


No 35 
>PRK04219 rpl5p 50S ribosomal protein L5P; Reviewed
Probab=20.54  E-value=1.1e+02  Score=22.26  Aligned_cols=25  Identities=12%  Similarity=0.093  Sum_probs=23.3

Q ss_pred             cceEEEEEeeeccHHHHHHHHHhhh
Q psy1573          54 NALKVIVKETRDSFLNFFIRLSGVL   78 (104)
Q Consensus        54 sPi~v~~~~~~~s~~~flt~lcaIi   78 (104)
                      .|+.++++-+....++||-+|+.++
T Consensus        66 ~pIG~kVTLRg~~m~~FL~rli~iv   90 (177)
T PRK04219         66 EPIGVKVTLRGEKAEEFLKTALEAV   90 (177)
T ss_pred             CEEEEEEEEccHHHHHHHHHHHHhh
Confidence            5999999999999999999999986


No 36 
>KOG4405|consensus
Probab=20.32  E-value=53  Score=27.70  Aligned_cols=27  Identities=26%  Similarity=0.517  Sum_probs=20.9

Q ss_pred             ccHHHHHHHHHhhhcceeehhhhhHHH
Q psy1573          65 DSFLNFFIRLSGVLGGVYIVTGTCSIS   91 (104)
Q Consensus        65 ~s~~~flt~lcaIiGGvf~v~g~id~~   91 (104)
                      .-+-|=+-|+||+.||++..-.-++.+
T Consensus       286 GELpQcFCRlcAVfGgIYcLr~~Vq~i  312 (547)
T KOG4405|consen  286 GELPQCFCRLCAVFGGIYCLRRPVQAI  312 (547)
T ss_pred             CcchHHHHHHHHHhcceEEeccchhhe
Confidence            456688889999999999876555543


No 37 
>PF06143 Baculo_11_kDa:  Baculovirus 11 kDa family;  InterPro: IPR009313 This is a family of uncharacterised Baculovirus proteins that are all about 11 kDa in size.
Probab=20.17  E-value=64  Score=20.85  Aligned_cols=37  Identities=14%  Similarity=0.207  Sum_probs=27.5

Q ss_pred             EEeeeccHHHHHHHHHhhhcceeehhhhhHHHHHHHHHH
Q psy1573          60 VKETRDSFLNFFIRLSGVLGGVYIVTGTCSISQGALVEY   98 (104)
Q Consensus        60 ~~~~~~s~~~flt~lcaIiGGvf~v~g~id~~~~~~~~~   98 (104)
                      +++.+.=+-+|+.=+||++  +|.+.-++--++......
T Consensus        26 VsrN~sfirdFvLVic~~l--VfVii~lFi~ll~~i~~~   62 (84)
T PF06143_consen   26 VSRNRSFIRDFVLVICCFL--VFVIIVLFILLLYNINKN   62 (84)
T ss_pred             HHhChHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHH
Confidence            3556666789999999997  888777777777665543


Done!