Query         psy15736
Match_columns 70
No_of_seqs    75 out of 77
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 20:05:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15736.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15736hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05773 Ig8_hNephrin_like Eigh  98.1   3E-06 6.5E-11   53.6   2.5   36   34-69      1-40  (109)
  2 cd05851 Ig3_Contactin-1 Third   97.6 7.3E-05 1.6E-09   45.3   3.4   33   37-69      1-33  (88)
  3 cd05730 Ig3_NCAM-1_like Third   97.6 4.9E-05 1.1E-09   45.7   2.6   33   37-69      1-35  (95)
  4 cd05898 Ig5_KIRREL3 Fifth immu  97.6 0.00012 2.6E-09   46.8   3.9   31   37-68      2-32  (98)
  5 cd07693 Ig1_Robo First immunog  97.5 0.00011 2.4E-09   43.0   3.2   33   37-69      1-33  (100)
  6 cd05758 Ig5_KIRREL3-like Fifth  97.4 0.00019 4.1E-09   43.8   3.4   31   37-68      2-32  (98)
  7 cd05771 IgC_Tapasin_R Tapasin-  97.4 0.00055 1.2E-08   44.1   5.2   50   17-66     18-67  (139)
  8 cd05747 Ig5_Titin_like M5, fif  97.2 0.00036 7.7E-09   42.0   3.2   34   36-69      2-35  (92)
  9 KOG3513|consensus               97.2  0.0004 8.6E-09   60.1   4.1   54   16-69    310-363 (1051)
 10 cd04968 Ig3_Contactin_like Thi  97.1 0.00074 1.6E-08   40.1   3.7   33   37-69      1-33  (88)
 11 cd05870 Ig5_NCAM-2 Fifth immun  97.1 0.00076 1.6E-08   41.1   3.7   32   37-69      2-33  (98)
 12 cd05732 Ig5_NCAM-1_like Fifth   97.0 0.00098 2.1E-08   39.7   3.5   32   37-69      2-33  (96)
 13 PF07679 I-set:  Immunoglobulin  96.9  0.0015 3.2E-08   38.0   3.7   32   38-69      1-32  (90)
 14 cd05869 Ig5_NCAM-1 Fifth immun  96.6  0.0037 8.1E-08   38.0   3.7   33   37-69      2-34  (97)
 15 cd05856 Ig2_FGFRL1-like Second  96.5  0.0031 6.8E-08   35.9   3.0   26   44-69      1-26  (82)
 16 cd04972 Ig_TrkABC_d4 Fourth do  96.5   0.003 6.4E-08   37.8   2.9   26   43-69      7-32  (90)
 17 cd05762 Ig8_MLCK Eighth immuno  96.3  0.0067 1.5E-07   37.5   3.6   32   38-69      1-32  (98)
 18 cd05737 Ig_Myomesin_like_C C-t  96.0  0.0085 1.8E-07   36.0   3.1   24   46-69     10-33  (92)
 19 cd04975 Ig4_SCFR_like Fourth i  96.0    0.01 2.2E-07   37.5   3.5   26   44-69     10-36  (101)
 20 cd05752 Ig1_FcgammaR_like Frst  95.8   0.012 2.7E-07   35.3   3.2   30   38-67      1-30  (78)
 21 cd05894 Ig_C5_MyBP-C C5 immuno  95.8   0.011 2.3E-07   35.8   2.9   25   45-69      3-27  (86)
 22 PF13927 Ig_3:  Immunoglobulin   95.8  0.0068 1.5E-07   33.1   1.9   29   37-66      1-29  (75)
 23 PF13895 Ig_2:  Immunoglobulin   95.8   0.013 2.8E-07   32.6   3.0   31   37-69      1-31  (80)
 24 cd05891 Ig_M-protein_C C-termi  95.7   0.013 2.8E-07   35.6   3.0   24   46-69     10-33  (92)
 25 cd05859 Ig4_PDGFR-alpha Fourth  95.7   0.017 3.6E-07   36.3   3.5   26   44-69     10-35  (101)
 26 PHA02785 IL-beta-binding prote  95.6   0.031 6.6E-07   41.4   5.3   51   16-67    193-250 (326)
 27 cd05857 Ig2_FGFR Second immuno  95.5   0.011 2.4E-07   34.3   2.1   24   46-69      3-26  (85)
 28 cd05729 Ig2_FGFR_like Second i  95.3   0.017 3.7E-07   32.8   2.5   25   45-69      2-26  (85)
 29 cd05749 Ig2_Tyro3_like Second   95.1   0.024 5.2E-07   34.5   2.6   23   47-69      8-31  (81)
 30 cd05728 Ig4_Contactin-2-like F  95.0   0.025 5.3E-07   33.6   2.5   23   47-69      9-31  (85)
 31 cd05848 Ig1_Contactin-5 First   94.8   0.044 9.5E-07   33.5   3.4   19   51-69     18-36  (94)
 32 cd04977 Ig1_NCAM-1_like First   94.7    0.06 1.3E-06   32.7   3.8   27   40-66      3-29  (92)
 33 cd05866 Ig1_NCAM-2 First immun  94.7   0.062 1.3E-06   33.3   3.8   26   41-66      4-29  (92)
 34 cd05722 Ig1_Neogenin First imm  94.6   0.036 7.8E-07   33.3   2.5   20   50-69     12-31  (95)
 35 cd05850 Ig1_Contactin-2 First   94.4   0.065 1.4E-06   32.6   3.3   18   52-69     19-36  (94)
 36 cd07701 Ig1_Necl-3 First (N-te  94.1   0.055 1.2E-06   33.3   2.6   25   45-69      5-29  (95)
 37 cd05865 Ig1_NCAM-1 First immun  93.8   0.087 1.9E-06   32.7   3.2   22   48-69     11-33  (96)
 38 PF08205 C2-set_2:  CD80-like C  93.3     0.1 2.2E-06   30.7   2.7   31   38-69      1-32  (89)
 39 cd05724 Ig2_Robo Second immuno  93.2   0.073 1.6E-06   30.7   2.0   23   47-69      6-29  (86)
 40 cd05882 Ig1_Necl-1 First (N-te  93.0    0.11 2.4E-06   32.3   2.7   25   45-69      5-29  (95)
 41 cd05860 Ig4_SCFR Fourth immuno  92.9    0.15 3.3E-06   33.3   3.4   26   43-68      9-34  (101)
 42 cd07698 IgC_MHC_I_alpha3 Class  92.7     0.2 4.3E-06   30.5   3.5   28   37-67      2-30  (93)
 43 cd05849 Ig1_Contactin-1 First   92.4    0.13 2.8E-06   31.5   2.4   18   52-69     19-36  (93)
 44 KOG3513|consensus               92.3    0.13 2.9E-06   45.1   3.2   54   16-69    402-458 (1051)
 45 KOG4221|consensus               92.3   0.086 1.9E-06   47.2   2.1   53   17-69    308-360 (1381)
 46 cd05717 Ig1_Necl-1-3_like Firs  91.5    0.21 4.6E-06   29.8   2.6   25   45-69      5-29  (95)
 47 cd04979 Ig_Semaphorin_C Immuno  91.3     0.2 4.3E-06   29.7   2.3   24   45-69      4-27  (89)
 48 cd05740 Ig_CEACAM_D4 Fourth im  91.1    0.23 4.9E-06   30.3   2.5   32   37-69      1-34  (91)
 49 cd05754 Ig3_Perlecan_like Thir  90.8    0.34 7.4E-06   28.3   3.0   24   46-69     10-34  (85)
 50 PHA02826 IL-1 receptor-like pr  90.6     0.4 8.6E-06   34.4   3.7   42   16-63    114-155 (227)
 51 cd04967 Ig1_Contactin First Ig  90.4    0.49 1.1E-05   28.1   3.5   19   51-69     18-36  (91)
 52 cd05871 Ig_Semaphorin_classIII  90.2    0.28 6.1E-06   30.1   2.3   26   43-69      2-27  (91)
 53 cd05755 Ig2_ICAM-1_like Second  89.7    0.38 8.2E-06   31.0   2.7   27   40-68      6-33  (100)
 54 PF07686 V-set:  Immunoglobulin  89.1    0.99 2.1E-05   26.3   4.0   24   39-62      3-26  (114)
 55 cd04983 IgV_TCR_alpha_like Imm  88.0    0.59 1.3E-05   28.1   2.6   24   43-66      4-27  (109)
 56 cd04980 IgV_L_kappa Immunoglob  87.6    0.94   2E-05   27.6   3.4   26   40-65      3-28  (106)
 57 smart00410 IG_like Immunoglobu  87.2    0.83 1.8E-05   24.4   2.7   23   46-68      3-25  (86)
 58 smart00409 IG Immunoglobulin.   87.2    0.83 1.8E-05   24.4   2.7   23   46-68      3-25  (86)
 59 KOG4194|consensus               86.6    0.68 1.5E-05   39.9   3.0   47   23-69    598-644 (873)
 60 cd05767 IgC_MHC_II_alpha Class  86.1     1.8 3.9E-05   27.1   4.1   30   37-67      1-31  (94)
 61 cd05845 Ig2_L1-CAM_like Second  85.9    0.58 1.3E-05   29.8   1.8   26   44-69     10-36  (95)
 62 cd05770 IgC_beta2m Class I maj  85.2     1.9 4.2E-05   27.0   4.0   29   37-67      1-31  (93)
 63 cd05899 IgV_TCR_beta Immunoglo  85.1     1.1 2.4E-05   27.5   2.8   21   43-63      4-24  (110)
 64 cd05881 Ig1_Necl-2 First (N-te  84.0     1.1 2.3E-05   28.4   2.4   21   45-65      5-25  (95)
 65 cd04982 IgV_TCR_gamma Immunogl  83.4     1.2 2.6E-05   27.4   2.4   20   44-63      5-24  (116)
 66 cd04970 Ig6_Contactin_like Six  82.0     1.3 2.8E-05   25.8   2.1   23   16-38     63-85  (85)
 67 cd07690 Ig1_CD4 First immunogl  81.5     1.5 3.2E-05   27.5   2.3   23   47-69      2-24  (94)
 68 cd05711 Ig_FcalphaRI Immunoglo  81.4     1.9 4.1E-05   26.3   2.7   25   37-62      1-25  (94)
 69 cd00098 IgC Immunoglobulin Con  80.2     2.2 4.7E-05   24.9   2.6   17   50-66     11-28  (95)
 70 cd05751 Ig1_LILRB1_like First   79.9     2.1 4.5E-05   25.7   2.5   25   37-62      2-26  (91)
 71 cd07706 IgV_TCR_delta Immunogl  77.5     3.7 8.1E-05   25.3   3.2   24   40-63      2-25  (116)
 72 KOG3515|consensus               75.7     1.4 3.1E-05   37.5   1.2   35   34-68      1-38  (741)
 73 cd05715 Ig_P0-like Immunoglobu  75.3     4.1   9E-05   25.3   3.0   19   46-64      7-25  (116)
 74 cd04973 Ig1_FGFR First immunog  73.0     4.9 0.00011   23.3   2.8   19   47-65      4-22  (79)
 75 cd00099 IgV Immunoglobulin var  72.9     3.5 7.6E-05   24.3   2.2   17   48-64      2-18  (105)
 76 PHA02785 IL-beta-binding prote  71.7     5.2 0.00011   29.6   3.3   54   16-69     98-158 (326)
 77 cd05873 Ig_Sema4D_like Immunog  70.8     4.2   9E-05   25.2   2.2   21   48-69      7-27  (87)
 78 KOG4221|consensus               70.6       6 0.00013   36.1   3.8   44   27-70    221-270 (1381)
 79 cd05772 IgC_SIRP Signal-regula  70.2       6 0.00013   25.4   2.9   33   34-66      2-36  (111)
 80 cd07699 IgC_L Immunoglobulin C  69.5     4.6 9.9E-05   25.1   2.2   30   37-66      1-32  (100)
 81 KOG4222|consensus               68.4     4.2   9E-05   36.8   2.4   56   15-70    293-348 (1281)
 82 cd07696 IgC_CH3 CH3 domain (th  68.3     5.4 0.00012   24.9   2.4   17   51-67     13-31  (96)
 83 cd05756 Ig1_IL1R_like First im  68.0     2.9 6.3E-05   25.6   1.1   20   50-69     12-36  (94)
 84 cd07689 Ig2_VCAM-1 Second immu  67.5       4 8.6E-05   26.8   1.7   24   37-63      3-26  (99)
 85 cd05880 Ig_EVA1 Immunoglobulin  65.7     9.7 0.00021   24.0   3.2   21   45-65      6-26  (115)
 86 cd05854 Ig6_Contactin-2 Sixth   65.7       6 0.00013   23.5   2.1   23   16-38     63-85  (85)
 87 cd05773 Ig8_hNephrin_like Eigh  65.2       4 8.8E-05   25.4   1.3   25   15-39     85-109 (109)
 88 cd07700 IgV_CD8_beta Immunoglo  63.6       9 0.00019   23.5   2.7   16   49-64      3-18  (107)
 89 cd05753 Ig2_FcgammaR_like Seco  62.9       8 0.00017   22.9   2.3   16   48-63     10-25  (83)
 90 cd05768 IgC_CH4 CH4 domain (fo  62.9     9.1  0.0002   24.0   2.6   18   51-68     15-32  (102)
 91 cd04984 IgV_L_lambda Immunoglo  60.7       7 0.00015   23.3   1.8   16   49-64      3-18  (98)
 92 cd05716 Ig_pIgR Immunoglobulin  57.6     8.7 0.00019   22.8   1.8   17   47-63      2-18  (98)
 93 cd05720 Ig_CD8_alpha Immunoglo  57.5     9.1  0.0002   23.5   1.9   15   49-63      3-17  (104)
 94 KOG3515|consensus               56.4     9.2  0.0002   32.8   2.3   54   14-68    569-625 (741)
 95 cd05879 Ig_P0 Immunoglobulin (  53.1      18  0.0004   23.3   2.9   20   46-65      7-26  (116)
 96 cd04985 IgC_CH1 CH1 domain (fi  49.8      39 0.00085   20.9   3.9   15   52-66     16-31  (95)
 97 cd05735 Ig8_DSCAM Eight immuno  47.6      15 0.00032   21.8   1.7   24   16-39     63-86  (88)
 98 PF07654 C1-set:  Immunoglobuli  46.2      26 0.00057   20.3   2.6   17   51-67      7-23  (83)
 99 cd05727 Ig2_Contactin-2-like S  46.2      12 0.00026   23.8   1.2   26   44-69     10-36  (96)
100 cd05719 Ig2_PVR_like Second im  45.7      13 0.00029   23.1   1.3   29   41-69      4-33  (95)
101 cd04981 IgV_H Immunoglobulin (  43.9      29 0.00062   21.9   2.7   17   46-62      6-22  (117)
102 cd05853 Ig6_Contactin-4 Sixth   41.1      24 0.00053   21.6   2.0   23   16-38     63-85  (85)
103 cd05712 Ig_Siglec_N Immunoglob  40.9      26 0.00056   21.9   2.1   21   41-62      4-24  (119)
104 PHA02826 IL-1 receptor-like pr  40.1      21 0.00046   25.5   1.8   22   46-67     31-52  (227)
105 cd07697 IgC_TCR_gamma T cell r  36.2      44 0.00095   21.0   2.6   16   52-67     16-32  (96)
106 PHA03052 Hypothetical protein;  35.5      43 0.00092   21.0   2.4   22   45-66      5-26  (69)
107 cd05766 IgC_MHC_II_beta Class   35.4      51  0.0011   20.2   2.8   17   51-67     13-30  (94)
108 KOG4194|consensus               34.9      56  0.0012   28.7   3.7   57   10-66    679-735 (873)
109 cd04986 IgC_CH2 CH2 domain (se  34.3      38 0.00082   21.7   2.1   14   51-64     18-31  (99)
110 cd04978 Ig4_L1-NrCAM_like Four  34.1      30 0.00066   19.1   1.5   20   16-35     57-76  (76)
111 cd05721 IgV_CTLA-4 Immunoglobu  29.1      70  0.0015   21.4   2.8   23   42-64      3-25  (115)
112 cd07703 Ig2_Nectin-2_like Seco  28.8      56  0.0012   20.5   2.2   27   43-69      6-33  (95)
113 cd05868 Ig4_NrCAM Fourth immun  28.8      41 0.00089   19.2   1.5   20   16-35     57-76  (76)
114 cd05769 IgC_TCR_beta T cell re  28.6      67  0.0015   20.8   2.6   16   51-66     17-33  (115)
115 KOG4222|consensus               28.4      31 0.00068   31.6   1.3   48   22-69    210-257 (1281)
116 cd05763 Ig_1 Subgroup of the i  26.4      49  0.0011   18.5   1.5   20   16-35     56-75  (75)
117 cd05872 Ig_Sema4B_like Immunog  23.6      55  0.0012   20.2   1.5   20   47-66      6-25  (85)
118 PHA02865 MHC-like TNF binding   23.1 1.2E+02  0.0025   24.0   3.4   30   35-68    201-230 (338)
119 cd05748 Ig_Titin_like Immunogl  23.1      62  0.0013   17.9   1.5   19   16-34     56-74  (74)
120 cd05731 Ig3_L1-CAM_like Third   22.8      64  0.0014   17.4   1.5   20   16-35     52-71  (71)
121 PF14699 hGDE_N:  N-terminal do  21.7      63  0.0014   20.2   1.4   18   23-40      8-25  (86)
122 PF08603 CAP_C:  Adenylate cycl  21.5 2.3E+02  0.0049   19.8   4.3   34   27-60    116-156 (159)
123 cd05764 Ig_2 Subgroup of the i  20.5      75  0.0016   17.5   1.5   19   16-34     56-74  (74)

No 1  
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=98.05  E-value=3e-06  Score=53.61  Aligned_cols=36  Identities=22%  Similarity=0.332  Sum_probs=30.6

Q ss_pred             eecCCeEEEecc--eEEe--ccCCcEEEEEEEeeeCCCCC
Q psy15736         34 QKNLPEIEVERS--WVHS--GEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        34 V~ypPeI~v~~~--~Vha--~~G~~a~L~CiV~A~P~a~V   69 (70)
                      |+|+|.|+++.+  .|.+  -.|..++|.|.+.|.|.+.+
T Consensus         1 v~~~P~~~~~~~~~~~~~~~~~g~~v~L~C~a~G~P~p~i   40 (109)
T cd05773           1 VRFAPDLQKGPQLRKVASRGDGSSDANLVCQAQGVPRVQF   40 (109)
T ss_pred             CccccccccCCceEEEEEecCCCCEEEEEEECcccCCCEE
Confidence            789999999988  5544  26789999999999999865


No 2  
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.62  E-value=7.3e-05  Score=45.30  Aligned_cols=33  Identities=18%  Similarity=0.185  Sum_probs=30.6

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ||.|.+....+.+..|..++|.|.+.+.|.|.|
T Consensus         1 ~p~i~~~~~~~~~~~G~~v~l~C~~~G~P~P~v   33 (88)
T cd05851           1 PADINVKFKDTYALKGQNVTLECFALGNPVPVI   33 (88)
T ss_pred             CCceEEccccEEEeCCCcEEEEEEecccCCCEE
Confidence            799999988888999999999999999999875


No 3  
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=97.61  E-value=4.9e-05  Score=45.69  Aligned_cols=33  Identities=24%  Similarity=0.318  Sum_probs=29.1

Q ss_pred             CCeEEEecceE--EeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWV--HSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~V--ha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ||.|.+.++.+  .+..|..++|.|.+.|.|.|.|
T Consensus         1 pp~i~~~~~~~~~~~~~G~~v~L~C~~~g~P~p~v   35 (95)
T cd05730           1 PPTIRARQSEVNATANLGQSVTLACDADGFPEPTM   35 (95)
T ss_pred             CCccccCCcccceEEeCCCCEEEEEeccEeCCCEE
Confidence            79999988776  5688999999999999999875


No 4  
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=97.55  E-value=0.00012  Score=46.83  Aligned_cols=31  Identities=19%  Similarity=0.339  Sum_probs=28.0

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~   68 (70)
                      ||.| ..+..+++..|+.+.|.|.+.+.|.|+
T Consensus         2 pP~i-~~~~s~~~~~G~~~~L~C~~~s~P~P~   32 (98)
T cd05898           2 PPII-SSEQVQYAVRGERGKVKCFIGSTPPPD   32 (98)
T ss_pred             CCEE-ecCceEEEeCCCcEEEEEEEccCCCCc
Confidence            8999 666688889999999999999999985


No 5  
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=97.52  E-value=0.00011  Score=43.02  Aligned_cols=33  Identities=24%  Similarity=0.263  Sum_probs=29.7

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ||.|....+.+....|+.+.|.|.+.+.|.+.|
T Consensus         1 ~P~i~~~p~~~~v~~G~~~~l~C~~~g~P~p~i   33 (100)
T cd07693           1 PPRIVEHPSDLIVSKGDPATLNCKAEGRPTPTI   33 (100)
T ss_pred             CCeEEecCceeEEcCCCeEEEEeeCCcCCCCEE
Confidence            688888878888899999999999999999865


No 6  
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.42  E-value=0.00019  Score=43.80  Aligned_cols=31  Identities=23%  Similarity=0.324  Sum_probs=26.9

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~   68 (70)
                      ||.|..++ .+++.+|+.++|.|.+.|.|.|.
T Consensus         2 pp~i~~~~-~~~~~~G~~v~L~C~~~g~P~P~   32 (98)
T cd05758           2 PPIITSEA-TQYAILGDKGRVECFIFSTPPPD   32 (98)
T ss_pred             CCeEcCCC-cEEEeCCCcEEEEEEEcccCCCC
Confidence            78997765 56689999999999999999984


No 7  
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=97.37  E-value=0.00055  Score=44.08  Aligned_cols=50  Identities=8%  Similarity=0.030  Sum_probs=39.0

Q ss_pred             cCcCCCccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCC
Q psy15736         17 EEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        17 ~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~   66 (70)
                      |...+......+.+.|+|..||.|.+...-+....|..++|.|.+.+++.
T Consensus        18 C~~~~~~~~~~~~~~l~v~~~P~v~~~~~~~~~~~~~~~~L~C~a~g~~P   67 (139)
T cd05771          18 CSVSTPPHQAQQIIQLSVSEPPRVRLSLEKLVSMIEEPQTLICHIAGYYP   67 (139)
T ss_pred             EEEEccCcceeeEEEEEEecCCceEEeCCCceeecCCcEEEEEEECCCCC
Confidence            55544445578999999999999998765555457999999999999643


No 8  
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=97.25  E-value=0.00036  Score=42.01  Aligned_cols=34  Identities=24%  Similarity=0.269  Sum_probs=30.0

Q ss_pred             cCCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         36 NLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        36 ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .||.|..+-+-+.+..|..++|.|.+.|+|.|.|
T Consensus         2 ~~~~~~~~p~~~~~~~G~~~~L~C~~~g~P~p~v   35 (92)
T cd05747           2 LPATILTKPRSLTVSEGESARFSCDVDGEPAPTV   35 (92)
T ss_pred             CCCcccccCccEEEeCCCcEEEEEEEeecCCCEE
Confidence            5788887777888999999999999999999865


No 9  
>KOG3513|consensus
Probab=97.21  E-value=0.0004  Score=60.14  Aligned_cols=54  Identities=13%  Similarity=0.120  Sum_probs=52.2

Q ss_pred             hcCcCCCccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +|.++|+....+.++.|+|.++|......+-++...|.+++|+|-+.|.|.|.|
T Consensus       310 ~C~AeN~~G~~~~~~~v~v~a~P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p~v  363 (1051)
T KOG3513|consen  310 ECIAENSRGSATHSGHVTVYAPPYWLQKPQDTEADTGSNVTLECKASGKPNPTV  363 (1051)
T ss_pred             EEEEecccccceeeEEEEEecCchhhcccceeEecCCCCeEEEEEecCCCCCce
Confidence            799999999999999999999999999999999999999999999999999986


No 10 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=97.13  E-value=0.00074  Score=40.08  Aligned_cols=33  Identities=18%  Similarity=0.113  Sum_probs=27.2

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ||.|......+...+|..++|.|.+.+.|.+.|
T Consensus         1 p~~~~~~p~~~~~~~g~~v~l~C~~~g~P~p~v   33 (88)
T cd04968           1 PSIIVVFPKDTYALKGQNVTLECFALGNPVPQI   33 (88)
T ss_pred             CCcEEECCCceEEeCCCcEEEEEEeeEeCCCEE
Confidence            455666666777889999999999999998865


No 11 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=97.12  E-value=0.00076  Score=41.10  Aligned_cols=32  Identities=25%  Similarity=0.295  Sum_probs=27.3

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +|.|...++ +.+.+|..++|.|.+.+.|.|.|
T Consensus         2 ~p~i~~~~~-~~~~~G~~v~l~C~~~G~P~p~i   33 (98)
T cd05870           2 QPHIIQLKN-ETTVENGAATLSCKAEGEPIPEI   33 (98)
T ss_pred             CCEEEeecc-EEEcCCCcEEEEEecccCCCCeE
Confidence            688877665 66789999999999999999876


No 12 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=97.02  E-value=0.00098  Score=39.68  Aligned_cols=32  Identities=19%  Similarity=0.254  Sum_probs=26.4

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +|.|...++ +.+.+|..++|.|.+.++|.+.|
T Consensus         2 ~P~i~~~~~-~~~~~g~~v~l~C~~~g~p~p~v   33 (96)
T cd05732           2 QPKITYLEN-QTAVELEQITLTCEAEGDPIPEI   33 (96)
T ss_pred             CccceecCc-eeEecCCcEEEEEEEeEcCCCcE
Confidence            688876554 56688999999999999999875


No 13 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=96.94  E-value=0.0015  Score=37.99  Aligned_cols=32  Identities=25%  Similarity=0.308  Sum_probs=28.5

Q ss_pred             CeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         38 PEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        38 PeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      |.|.....-+...+|..++|.|.+.+.|.+.|
T Consensus         1 P~~~~~~~~~~v~~G~~~~l~c~~~~~p~~~v   32 (90)
T PF07679_consen    1 PVFTKKPKDVTVKEGESVTLECEVSGNPPPTV   32 (90)
T ss_dssp             EEEEEESSEEEEETTSEEEEEEEEEESSSSEE
T ss_pred             CEEEEecCCEEEeCCCEEEEEEEEEeCCCCcc
Confidence            67888888888899999999999999998865


No 14 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=96.59  E-value=0.0037  Score=37.95  Aligned_cols=33  Identities=15%  Similarity=0.177  Sum_probs=24.7

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|-|...+.-.....|..++|.|.+.+.|.|.|
T Consensus         2 ~p~i~~~~~~~~~~~g~~v~l~C~~~G~P~P~v   34 (97)
T cd05869           2 KPKITYVENQTAMELEEQITLTCEASGDPIPSI   34 (97)
T ss_pred             CceEEEccCceEEEcCCCEEEEEEeeEeCCCEE
Confidence            467765543333456899999999999999875


No 15 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=96.54  E-value=0.0031  Score=35.90  Aligned_cols=26  Identities=23%  Similarity=0.460  Sum_probs=22.5

Q ss_pred             cceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         44 RSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        44 ~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ++.+.+.+|..++|.|.+.+.|.+.+
T Consensus         1 ~~~~~~~~G~~v~L~C~~~g~p~p~i   26 (82)
T cd05856           1 RRVIARPVGSSVRLKCVASGNPRPDI   26 (82)
T ss_pred             CcceeccCCCeEEEEEEeeEeCCCcE
Confidence            34677889999999999999999875


No 16 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=96.50  E-value=0.003  Score=37.82  Aligned_cols=26  Identities=23%  Similarity=0.282  Sum_probs=21.8

Q ss_pred             ecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         43 ERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        43 ~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +++.+ ..+|..++|.|.+.|+|.|.|
T Consensus         7 p~~~~-v~~G~~v~l~C~~~G~P~p~v   32 (90)
T cd04972           7 PNATV-VYEGGTATIRCTAEGSPLPKV   32 (90)
T ss_pred             CcCEE-EcCCCcEEEEEEEEEcCCCeE
Confidence            34444 688999999999999999976


No 17 
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=96.26  E-value=0.0067  Score=37.55  Aligned_cols=32  Identities=19%  Similarity=0.181  Sum_probs=27.0

Q ss_pred             CeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         38 PEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        38 PeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      |.|...-.-+.+..|+.+.|.|.+.|.|.+.|
T Consensus         1 p~~~~~p~~~~v~~G~~v~l~C~~~G~p~p~v   32 (98)
T cd05762           1 PQIIQFPEDMKVRAGESVELFCKVTGTQPITC   32 (98)
T ss_pred             CceEECCcCEEEECCCEEEEEEEEcccCCCce
Confidence            56666666677899999999999999999876


No 18 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=96.02  E-value=0.0085  Score=36.03  Aligned_cols=24  Identities=29%  Similarity=0.463  Sum_probs=20.9

Q ss_pred             eEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         46 WVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .+...+|..++|.|.+.+.|.|.|
T Consensus        10 ~v~v~~G~~v~L~C~v~G~P~p~v   33 (92)
T cd05737          10 VVTIMEGKTLNLTCTVFGDPDPEV   33 (92)
T ss_pred             eEEEeCCCcEEEEEEEEecCCCeE
Confidence            456678999999999999999875


No 19 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=96.00  E-value=0.01  Score=37.45  Aligned_cols=26  Identities=23%  Similarity=0.222  Sum_probs=22.9

Q ss_pred             cceEEeccCCcEEEEEEEee-eCCCCC
Q psy15736         44 RSWVHSGEGYEAQLVCIVHA-EPHADP   69 (70)
Q Consensus        44 ~~~Vha~~G~~a~L~CiV~A-~P~a~V   69 (70)
                      ++.+.+.+|..+.|.|.++| .|.|.|
T Consensus        10 ~~~~~v~~G~~v~L~c~v~g~~P~p~v   36 (101)
T cd04975          10 NTTIFVNLGENLNLVVEVEAYPPPPHI   36 (101)
T ss_pred             CceEEEECCCCEEEEEEEEecCCCCcc
Confidence            56788899999999999999 888865


No 20 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=95.85  E-value=0.012  Score=35.35  Aligned_cols=30  Identities=17%  Similarity=0.407  Sum_probs=26.6

Q ss_pred             CeEEEecceEEeccCCcEEEEEEEeeeCCC
Q psy15736         38 PEIEVERSWVHSGEGYEAQLVCIVHAEPHA   67 (70)
Q Consensus        38 PeI~v~~~~Vha~~G~~a~L~CiV~A~P~a   67 (70)
                      |.|++.-+|.....|..++|.|.+.+.|.+
T Consensus         1 ~vv~~~P~~~~v~~G~~V~L~C~~~~~p~~   30 (78)
T cd05752           1 AVVSLDPPWTTIFQGEKVTLTCNGFNSPEQ   30 (78)
T ss_pred             CeEEeCCCCeEeeCCCCEEEEEeCCCCCCC
Confidence            678888888899999999999999998864


No 21 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=95.83  E-value=0.011  Score=35.77  Aligned_cols=25  Identities=16%  Similarity=0.158  Sum_probs=21.9

Q ss_pred             ceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ..+.+..|+.+.|.|.+.|+|.|.|
T Consensus         3 ~~~~v~~G~~v~l~c~~~G~P~P~v   27 (86)
T cd05894           3 NTIVVVAGNKLRLDVPISGEPAPTV   27 (86)
T ss_pred             CEEEEEcCCEEEEEeeEeecCCCeE
Confidence            3566789999999999999999976


No 22 
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=95.81  E-value=0.0068  Score=33.12  Aligned_cols=29  Identities=28%  Similarity=0.421  Sum_probs=24.8

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~   66 (70)
                      ||.|.+..+.+.+..|. ++|.|.+.+.|.
T Consensus         1 kP~I~~~~~~~~~~~~~-~~l~C~~~~~~~   29 (75)
T PF13927_consen    1 KPQISVPPPPVVTSGGS-VTLTCSAEGGPP   29 (75)
T ss_dssp             ESEEEEESTSEEETTEE-EEEEEEESSEES
T ss_pred             CCEEEEcCCCcEeecee-EEEEEEEccccC
Confidence            69999998888876666 999999999983


No 23 
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=95.79  E-value=0.013  Score=32.58  Aligned_cols=31  Identities=26%  Similarity=0.392  Sum_probs=23.6

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +|.|+.+...|  ..|..++|.|.+.+.|...+
T Consensus         1 kP~l~~~~~~v--~~g~~~~l~C~~~~~p~~~~   31 (80)
T PF13895_consen    1 KPVLSSSPQSV--EEGDSVTLTCSVSGNPPPQV   31 (80)
T ss_dssp             --EEEEESSEE--ETTSEEEEEEEEESSSSSEE
T ss_pred             CcEEEccceEE--eCCCcEEEEEEEEcccceee
Confidence            48888888554  56999999999999987643


No 24 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=95.73  E-value=0.013  Score=35.62  Aligned_cols=24  Identities=29%  Similarity=0.439  Sum_probs=21.4

Q ss_pred             eEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         46 WVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|...+|+.+.|.|.+.+.|.+.+
T Consensus        10 ~v~v~eG~~v~L~C~v~g~P~p~i   33 (92)
T cd05891          10 VVTIMEGKTLNLTCTVFGNPDPEV   33 (92)
T ss_pred             cEEEcCCCEEEEEEEEEEeCCCeE
Confidence            677789999999999999998865


No 25 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=95.67  E-value=0.017  Score=36.30  Aligned_cols=26  Identities=15%  Similarity=0.026  Sum_probs=23.0

Q ss_pred             cceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         44 RSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        44 ~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ++.+.+.+|..+.|.|.|+|+|+|.|
T Consensus        10 ~~~~~~~~~~~~~l~~~v~g~P~P~v   35 (101)
T cd05859          10 GQLEFANLHEVKEFVVEVEAYPPPQI   35 (101)
T ss_pred             CceEEEecCCcEEEEEEEEEeCCCce
Confidence            34778889999999999999999976


No 26 
>PHA02785 IL-beta-binding protein; Provisional
Probab=95.65  E-value=0.031  Score=41.40  Aligned_cols=51  Identities=16%  Similarity=0.152  Sum_probs=37.7

Q ss_pred             hcCcCCCcc----ceeeeEEEEee---cCCeEEEecceEEeccCCcEEEEEEEeeeCCC
Q psy15736         16 EEEPEKDKE----EVRRRRRRNQK---NLPEIEVERSWVHSGEGYEAQLVCIVHAEPHA   67 (70)
Q Consensus        16 ~~~~~~~~~----pvs~~I~L~V~---ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a   67 (70)
                      -|.+++...    .+++.+.|.|.   .||.|..++ .+.+..|.+++|.|.+.+.|.+
T Consensus       193 ~C~~~n~~g~~~~~~t~~v~l~V~~~~~pp~~~~p~-~~~~~~G~~v~L~C~a~g~P~~  250 (326)
T PHA02785        193 TCVLKYIYGDKTYNVTRIVKLEVRDRIIPPTMQLPE-GVVTSIGSNLTIACRVSLRPPT  250 (326)
T ss_pred             EEEEEeccCCEEEeEEEEEEEEEeccCCCceecCCC-cEEecCCCcEEEEEEEECCCCC
Confidence            366665432    35667778886   588887775 5566789999999999999974


No 27 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=95.50  E-value=0.011  Score=34.30  Aligned_cols=24  Identities=8%  Similarity=0.131  Sum_probs=20.7

Q ss_pred             eEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         46 WVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ++....|..++|.|.+.|.|.+.|
T Consensus         3 ~~~v~~G~~~~L~C~~~g~P~p~i   26 (85)
T cd05857           3 LHAVPAANTVKFRCPAAGNPTPTM   26 (85)
T ss_pred             cEEcCCCCEEEEEEEcCCCCCCEE
Confidence            456688999999999999998865


No 28 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=95.35  E-value=0.017  Score=32.76  Aligned_cols=25  Identities=16%  Similarity=0.246  Sum_probs=21.7

Q ss_pred             ceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ..+.+..|..++|.|.+.+.|.+.|
T Consensus         2 ~~~~~~~G~~~~l~C~~~~~p~~~v   26 (85)
T cd05729           2 RLHAVPAGSTVRLKCPASGNPRPTI   26 (85)
T ss_pred             ceeEecCCCcEEEEEEcCCCCCCeE
Confidence            4677789999999999999998765


No 29 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=95.06  E-value=0.024  Score=34.46  Aligned_cols=23  Identities=13%  Similarity=0.234  Sum_probs=20.0

Q ss_pred             EEeccCCcEEEEEEEeeeCCC-CC
Q psy15736         47 VHSGEGYEAQLVCIVHAEPHA-DP   69 (70)
Q Consensus        47 Vha~~G~~a~L~CiV~A~P~a-~V   69 (70)
                      +....|..+.|.|.++|.|.| .|
T Consensus         8 ~~v~~G~~v~l~C~a~G~P~P~~I   31 (81)
T cd05749           8 LSVTANTPFNLTCQAVGPPEPVEI   31 (81)
T ss_pred             eEEcCCCCEEEEEEeeeecCCeEE
Confidence            556779999999999999998 45


No 30 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=94.99  E-value=0.025  Score=33.62  Aligned_cols=23  Identities=13%  Similarity=0.252  Sum_probs=19.9

Q ss_pred             EEeccCCcEEEEEEEeeeCCCCC
Q psy15736         47 VHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        47 Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +...+|..++|.|.+.|.|.|.+
T Consensus         9 ~~~~~G~~~~l~C~~~g~p~p~v   31 (85)
T cd05728           9 TEADIGSSLRWECKASGNPRPAY   31 (85)
T ss_pred             cEEcCCCcEEEEEEeeEeCCCEE
Confidence            44568999999999999999865


No 31 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=94.83  E-value=0.044  Score=33.46  Aligned_cols=19  Identities=16%  Similarity=0.260  Sum_probs=17.5

Q ss_pred             cCCcEEEEEEEeeeCCCCC
Q psy15736         51 EGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        51 ~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|+.++|.|.+.|.|.|.|
T Consensus        18 ~g~~v~l~C~~~G~P~P~i   36 (94)
T cd05848          18 DEKKVILNCEARGNPVPTY   36 (94)
T ss_pred             CCCEEEEEEEeeecCCCEE
Confidence            5899999999999999976


No 32 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=94.73  E-value=0.06  Score=32.65  Aligned_cols=27  Identities=22%  Similarity=0.340  Sum_probs=21.6

Q ss_pred             EEEecceEEeccCCcEEEEEEEeeeCC
Q psy15736         40 IEVERSWVHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        40 I~v~~~~Vha~~G~~a~L~CiV~A~P~   66 (70)
                      +.+..+-++...|+.+.|.|.+.+.|.
T Consensus         3 v~v~p~~~~v~~G~~~~l~C~~~G~p~   29 (92)
T cd04977           3 VDIVPSQGEISVGESKFFLCQVIGEPK   29 (92)
T ss_pred             EEEecCcEEECCCCeEEEEEEeEeeCC
Confidence            344445577889999999999999985


No 33 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=94.68  E-value=0.062  Score=33.33  Aligned_cols=26  Identities=23%  Similarity=0.312  Sum_probs=21.3

Q ss_pred             EEecceEEeccCCcEEEEEEEeeeCC
Q psy15736         41 EVERSWVHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        41 ~v~~~~Vha~~G~~a~L~CiV~A~P~   66 (70)
                      .++-+-+.+.+|..++|.|.+.+.|.
T Consensus         4 ~~~~~~~~v~~G~~v~l~C~~~G~P~   29 (92)
T cd05866           4 SISLSKVELSVGESKFFTCTAIGEPE   29 (92)
T ss_pred             EEEecceEEcCCCeEEEEEEEEEeCC
Confidence            34444566789999999999999997


No 34 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=94.55  E-value=0.036  Score=33.26  Aligned_cols=20  Identities=25%  Similarity=0.312  Sum_probs=18.0

Q ss_pred             ccCCcEEEEEEEeeeCCCCC
Q psy15736         50 GEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        50 ~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ..|+++.|.|.|.|.|.+.|
T Consensus        12 ~~g~~v~l~C~v~g~P~p~i   31 (95)
T cd05722          12 VRGGPVVLNCSAEGEPPPKI   31 (95)
T ss_pred             cCCCCEEEeeecccCCCCEE
Confidence            56999999999999998865


No 35 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=94.36  E-value=0.065  Score=32.61  Aligned_cols=18  Identities=28%  Similarity=0.311  Sum_probs=16.0

Q ss_pred             CCcEEEEEEEeeeCCCCC
Q psy15736         52 GYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        52 G~~a~L~CiV~A~P~a~V   69 (70)
                      |..++|.|.+.|.|.|.|
T Consensus        19 g~~v~l~C~a~g~P~p~i   36 (94)
T cd05850          19 EEKVTLGCRARASPPATY   36 (94)
T ss_pred             CCeEEEEeEceeCCCCEE
Confidence            468999999999999875


No 36 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=94.06  E-value=0.055  Score=33.34  Aligned_cols=25  Identities=28%  Similarity=0.288  Sum_probs=21.6

Q ss_pred             ceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +-+++.+|+.++|.|.+.+.|.+.|
T Consensus         5 ~~v~v~eG~~v~L~C~~~~~p~~~v   29 (95)
T cd07701           5 QNVTVVEGGTANLTCRVDQNDNTSL   29 (95)
T ss_pred             ceEEEecCCcEEEEEEEecCCceEE
Confidence            4577899999999999999998765


No 37 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=93.82  E-value=0.087  Score=32.73  Aligned_cols=22  Identities=23%  Similarity=0.318  Sum_probs=18.3

Q ss_pred             EeccCCcEEEEEEEeeeCC-CCC
Q psy15736         48 HSGEGYEAQLVCIVHAEPH-ADP   69 (70)
Q Consensus        48 ha~~G~~a~L~CiV~A~P~-a~V   69 (70)
                      ...+|..++|.|.|.|.|. +.|
T Consensus        11 ~v~~G~~v~l~C~v~G~P~~p~i   33 (96)
T cd05865          11 EISVGESKFFLCQVAGEAKDKDI   33 (96)
T ss_pred             EECCCCeEEEEEEEeCCCCCCEE
Confidence            4577999999999999995 454


No 38 
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=93.26  E-value=0.1  Score=30.74  Aligned_cols=31  Identities=29%  Similarity=0.414  Sum_probs=24.0

Q ss_pred             CeEEEecceEEeccCCcEEEEE-EEeeeCCCCC
Q psy15736         38 PEIEVERSWVHSGEGYEAQLVC-IVHAEPHADP   69 (70)
Q Consensus        38 PeI~v~~~~Vha~~G~~a~L~C-iV~A~P~a~V   69 (70)
                      |+|+.....+... |..+.|.| ...++|+|.|
T Consensus         1 p~I~~~~~~~~~~-~~~~~~~C~s~~~~P~~~i   32 (89)
T PF08205_consen    1 PEITPNPSLLEGE-GEEVTLTCSSSGGYPPPQI   32 (89)
T ss_dssp             EEEEEECSEEESS-TEEEEEEEEEEEEBS-EEE
T ss_pred             CEeeCCCeeEccc-ceEEEEEEEeCCeECCeEE
Confidence            7899998777755 89999999 4556787764


No 39 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=93.18  E-value=0.073  Score=30.67  Aligned_cols=23  Identities=22%  Similarity=0.286  Sum_probs=18.9

Q ss_pred             EEeccCCcEEEEEEE-eeeCCCCC
Q psy15736         47 VHSGEGYEAQLVCIV-HAEPHADP   69 (70)
Q Consensus        47 Vha~~G~~a~L~CiV-~A~P~a~V   69 (70)
                      +....|+.+.|.|.+ .+.|.+.|
T Consensus         6 ~~~~~G~~v~l~C~~~~g~p~p~i   29 (86)
T cd05724           6 TQVAVGEMAVLECSPPRGHPEPTV   29 (86)
T ss_pred             EEEeCCCCEEEEEECCCCCCCCEE
Confidence            444679999999998 79998865


No 40 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=92.95  E-value=0.11  Score=32.31  Aligned_cols=25  Identities=16%  Similarity=0.089  Sum_probs=21.5

Q ss_pred             ceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +-+...+|..|.|.|.+.+.|.+.|
T Consensus         5 ~~~tv~~G~tv~L~C~v~g~~~~~v   29 (95)
T cd05882           5 QDETVAVGGTVTLKCGVKEHDNSSL   29 (95)
T ss_pred             ccEEEecCCcEEEEEEEeCCCCCeE
Confidence            4566788999999999999998865


No 41 
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=92.88  E-value=0.15  Score=33.29  Aligned_cols=26  Identities=15%  Similarity=0.221  Sum_probs=23.5

Q ss_pred             ecceEEeccCCcEEEEEEEeeeCCCC
Q psy15736         43 ERSWVHSGEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        43 ~~~~Vha~~G~~a~L~CiV~A~P~a~   68 (70)
                      .++.+.+.+|..+.|.|.++|+|++.
T Consensus         9 ~~~~~~v~~gE~~~L~V~ieAYP~p~   34 (101)
T cd05860           9 INTTIFVNAGENLDLIVEYEAYPKPE   34 (101)
T ss_pred             CCceEEEECCCCEEEEEEEEeCCCCe
Confidence            46788889999999999999999985


No 42 
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=92.68  E-value=0.2  Score=30.45  Aligned_cols=28  Identities=25%  Similarity=0.354  Sum_probs=21.4

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEeee-CCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHAE-PHA   67 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A~-P~a   67 (70)
                      ||.|.+..+-..   |..++|.|.+.++ |+.
T Consensus         2 pP~v~v~~~~~~---~~~~~L~C~a~gF~P~~   30 (93)
T cd07698           2 PPEVRVTRKRAP---DGSLTLSCHATGFYPRD   30 (93)
T ss_pred             CCEEEEEecCCC---CCcEEEEEEEEEEeCCC
Confidence            688887765443   7889999999996 543


No 43 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=92.41  E-value=0.13  Score=31.52  Aligned_cols=18  Identities=17%  Similarity=0.193  Sum_probs=16.1

Q ss_pred             CCcEEEEEEEeeeCCCCC
Q psy15736         52 GYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        52 G~~a~L~CiV~A~P~a~V   69 (70)
                      |..+.|.|.+.|.|.|+|
T Consensus        19 ~~~v~l~C~a~G~P~P~i   36 (93)
T cd05849          19 EGKVSVNCRARANPFPIY   36 (93)
T ss_pred             CCeEEEeCcCccCCCCEE
Confidence            568999999999999976


No 44 
>KOG3513|consensus
Probab=92.34  E-value=0.13  Score=45.06  Aligned_cols=54  Identities=13%  Similarity=0.095  Sum_probs=48.7

Q ss_pred             hcCcCCCccceeeeEEEEeecC-CeEEEe--cceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNL-PEIEVE--RSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~yp-PeI~v~--~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|.|+|.=..+.+...|+|+=. |.+...  +..+.+..|.++.|.|...|.|+|.+
T Consensus       402 QC~A~Nk~G~i~anA~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~  458 (1051)
T KOG3513|consen  402 QCIAENKYGTIYANAELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKV  458 (1051)
T ss_pred             EeeeecccceEeeeeEEEEEccCCCCCCCccceEEEEEeCCeEEEeeccCCCCcceE
Confidence            4999999999999999999987 777665  77889999999999999999999875


No 45 
>KOG4221|consensus
Probab=92.30  E-value=0.086  Score=47.20  Aligned_cols=53  Identities=9%  Similarity=0.153  Sum_probs=47.5

Q ss_pred             cCcCCCccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         17 EEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        17 ~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      |-+++-.+...+...|+|+-||.|...-....+-++.++.|+|-+++.|.+.|
T Consensus       308 C~Atn~~D~idasaev~V~a~P~~~~~p~~l~A~e~~die~ec~~~g~p~p~v  360 (1381)
T KOG4221|consen  308 CRATNTNDSIDASAEVTVLAPPGFTKAPTTLVAHESMDIEFECPVSGKPIPTV  360 (1381)
T ss_pred             EEecCCCcccccceEEEEEcCCCCCCCCcceeeeeccceeEeCCCCCCCcceE
Confidence            77888778888888999999999999988888888999999999999998865


No 46 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=91.52  E-value=0.21  Score=29.84  Aligned_cols=25  Identities=28%  Similarity=0.243  Sum_probs=19.7

Q ss_pred             ceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +-+...+|..++|.|.+.+.|.+.|
T Consensus         5 ~~~~v~~G~~v~L~C~~~~~~~~~v   29 (95)
T cd05717           5 QDVTVVEGGTATLKCRVKNNDNSSL   29 (95)
T ss_pred             CcEEEcCCCCEEEEEEECCCCCceE
Confidence            3456688999999999998876543


No 47 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=91.27  E-value=0.2  Score=29.66  Aligned_cols=24  Identities=25%  Similarity=0.180  Sum_probs=19.4

Q ss_pred             ceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ..+....|+.+.|.|.+.+ |.+.+
T Consensus         4 ~~~~v~~g~~v~L~C~~~~-p~~~i   27 (89)
T cd04979           4 KVVTVVEGNSVFLECSPKS-NLASV   27 (89)
T ss_pred             eEEEEECCCcEEEEEeCCC-CCceE
Confidence            4566788999999999988 77654


No 48 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=91.12  E-value=0.23  Score=30.32  Aligned_cols=32  Identities=16%  Similarity=0.160  Sum_probs=22.8

Q ss_pred             CCeEEEecc--eEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         37 LPEIEVERS--WVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        37 pPeI~v~~~--~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|.|+..++  -....+|+.++|.|.+.+. .+.|
T Consensus         1 ~p~~~~~~~~~~~~v~~g~~v~l~C~a~g~-~p~i   34 (91)
T cd05740           1 KPVINSNNSVGNQPPEDNQPVTLTCEAEGQ-ATYI   34 (91)
T ss_pred             CCEeecccccCccccccCCcEEEEEEeCCC-CCEE
Confidence            477764443  2344579999999999998 6654


No 49 
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=90.84  E-value=0.34  Score=28.28  Aligned_cols=24  Identities=13%  Similarity=0.265  Sum_probs=18.1

Q ss_pred             eEEeccCCcEEEEEEEee-eCCCCC
Q psy15736         46 WVHSGEGYEAQLVCIVHA-EPHADP   69 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A-~P~a~V   69 (70)
                      .+....|..++|.|.+.+ .|.+.|
T Consensus        10 ~~~v~~G~~v~L~C~~~~~~~~~~i   34 (85)
T cd05754          10 SQEVRPGADVSFICRAKSKSPAYTL   34 (85)
T ss_pred             ceEEcCCCCEEEEEEcCCCCCCcEE
Confidence            445678999999999975 666543


No 50 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=90.57  E-value=0.4  Score=34.39  Aligned_cols=42  Identities=12%  Similarity=-0.019  Sum_probs=31.0

Q ss_pred             hcCcCCCccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEee
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHA   63 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A   63 (70)
                      .|.+.++...+...+.|.|.-++ +     -.....|..+.|.|.+.+
T Consensus       114 ~C~a~N~~~~~~~~i~L~V~~~~-~-----~~~~~~G~~v~L~C~~~~  155 (227)
T PHA02826        114 ICTISSGNICEESTIRLTFDSGT-I-----NYQFNSGKDSKLHCYGTD  155 (227)
T ss_pred             EEEEEECCcceEEEEEEEEecCC-c-----cceEecCCCEEEEeeCCC
Confidence            47888888888899999995332 1     123457999999999863


No 51 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=90.42  E-value=0.49  Score=28.12  Aligned_cols=19  Identities=16%  Similarity=0.272  Sum_probs=16.2

Q ss_pred             cCCcEEEEEEEeeeCCCCC
Q psy15736         51 EGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        51 ~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|..+.|.|.+.+.|.|.|
T Consensus        18 ~~~~~~l~C~~~g~p~p~i   36 (91)
T cd04967          18 DEGKVSLNCRARGSPPPTY   36 (91)
T ss_pred             CCCEEEEEEeeeEcCCCEE
Confidence            4567999999999998865


No 52 
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=90.20  E-value=0.28  Score=30.06  Aligned_cols=26  Identities=27%  Similarity=0.321  Sum_probs=21.2

Q ss_pred             ecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         43 ERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        43 ~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      +.+.|+..+|+.++|.|.. ..|.+.|
T Consensus         2 ~~~~~~~~eG~~v~L~C~~-~~p~p~v   27 (91)
T cd05871           2 EEKVVYGVENNSTFLECLP-KSPQASV   27 (91)
T ss_pred             cceEEEEecCCcEEEEEEC-CCCCceE
Confidence            4568899999999999996 4787754


No 53 
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=89.67  E-value=0.38  Score=31.02  Aligned_cols=27  Identities=26%  Similarity=0.437  Sum_probs=20.5

Q ss_pred             EEEecceEEeccCCcEEEEEEEee-eCCCC
Q psy15736         40 IEVERSWVHSGEGYEAQLVCIVHA-EPHAD   68 (70)
Q Consensus        40 I~v~~~~Vha~~G~~a~L~CiV~A-~P~a~   68 (70)
                      |....+|+  .+|+..+|.|.|.+ .|.+.
T Consensus         6 l~~~p~~~--~eG~~~tL~C~v~g~~P~a~   33 (100)
T cd05755           6 LSPLPSWQ--PVGKNYTLQCDVPGVAPRQN   33 (100)
T ss_pred             EecCCCcc--cCCCcEEEEEEEcCcCCCCc
Confidence            44445666  57999999999988 67665


No 54 
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=89.11  E-value=0.99  Score=26.25  Aligned_cols=24  Identities=25%  Similarity=0.259  Sum_probs=21.2

Q ss_pred             eEEEecceEEeccCCcEEEEEEEe
Q psy15736         39 EIEVERSWVHSGEGYEAQLVCIVH   62 (70)
Q Consensus        39 eI~v~~~~Vha~~G~~a~L~CiV~   62 (70)
                      .|+.+..+|.+.+|..+.|.|...
T Consensus         3 ~vt~~~~~v~~~~G~~v~L~C~~~   26 (114)
T PF07686_consen    3 QVTQPPSPVTVQEGESVTLPCSYS   26 (114)
T ss_dssp             EEEEEESEEEEETTSEEEEEEEEE
T ss_pred             eEEEeCCeEEEecCCCEEEEEEEe
Confidence            366777899999999999999998


No 55 
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=88.01  E-value=0.59  Score=28.11  Aligned_cols=24  Identities=17%  Similarity=0.200  Sum_probs=19.2

Q ss_pred             ecceEEeccCCcEEEEEEEeeeCC
Q psy15736         43 ERSWVHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        43 ~~~~Vha~~G~~a~L~CiV~A~P~   66 (70)
                      +...+.+..|+.++|.|.+.+.+.
T Consensus         4 ~~~~v~~~~G~~v~L~C~~~~~~~   27 (109)
T cd04983           4 SPQSLSVQEGENVTLNCNYSTSTF   27 (109)
T ss_pred             cCCceEEcCCCCEEEEEEECCCCc
Confidence            445677899999999999987643


No 56 
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=87.62  E-value=0.94  Score=27.58  Aligned_cols=26  Identities=12%  Similarity=0.187  Sum_probs=19.8

Q ss_pred             EEEecceEEeccCCcEEEEEEEeeeC
Q psy15736         40 IEVERSWVHSGEGYEAQLVCIVHAEP   65 (70)
Q Consensus        40 I~v~~~~Vha~~G~~a~L~CiV~A~P   65 (70)
                      |+...+.+.+.+|+.++|.|.+.+.+
T Consensus         3 v~Q~p~~~~v~~G~~v~L~C~~~~~~   28 (106)
T cd04980           3 LTQSPATLSVSPGESATISCKASQSV   28 (106)
T ss_pred             EEECCCcEEECCCCCEEEEEEECCCC
Confidence            34444567779999999999997654


No 57 
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=87.18  E-value=0.83  Score=24.37  Aligned_cols=23  Identities=30%  Similarity=0.446  Sum_probs=17.9

Q ss_pred             eEEeccCCcEEEEEEEeeeCCCC
Q psy15736         46 WVHSGEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~P~a~   68 (70)
                      .+....|+.++|.|.+.+.+.+.
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~   25 (86)
T smart00410        3 SVTVKEGESVTLSCEVSGSPPPE   25 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCe
Confidence            34557899999999999875554


No 58 
>smart00409 IG Immunoglobulin.
Probab=87.18  E-value=0.83  Score=24.37  Aligned_cols=23  Identities=30%  Similarity=0.446  Sum_probs=17.9

Q ss_pred             eEEeccCCcEEEEEEEeeeCCCC
Q psy15736         46 WVHSGEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~P~a~   68 (70)
                      .+....|+.++|.|.+.+.+.+.
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~   25 (86)
T smart00409        3 SVTVKEGESVTLSCEVSGSPPPE   25 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCe
Confidence            34557899999999999875554


No 59 
>KOG4194|consensus
Probab=86.57  E-value=0.68  Score=39.86  Aligned_cols=47  Identities=13%  Similarity=0.210  Sum_probs=40.3

Q ss_pred             ccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         23 KEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        23 ~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      |..-+...+|.|+-.|..+--..-..-..|+-|.|+|...|+|+|++
T Consensus       598 GStysqk~KltV~~~PsFtktP~dltl~tg~mArl~CaAtG~P~PeI  644 (873)
T KOG4194|consen  598 GSTYSQKAKLTVNQAPSFTKTPEDLTLRTGQMARLECAATGHPRPEI  644 (873)
T ss_pred             CcchhheeEEEeeccCccccCcccceeecccceeeeeeccCCCCcce
Confidence            55667889999999999887766666677999999999999999976


No 60 
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=86.06  E-value=1.8  Score=27.11  Aligned_cols=30  Identities=27%  Similarity=0.322  Sum_probs=20.0

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEee-eCCC
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHA-EPHA   67 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A-~P~a   67 (70)
                      ||.+.+-..- ....|..++|.|.|.+ +|+.
T Consensus         1 ~P~V~v~~~~-~~~~~~~~tL~C~a~gFyP~~   31 (94)
T cd05767           1 PPEVTVFSLK-PVELGEPNTLICFVDNFFPPV   31 (94)
T ss_pred             CCEEEEEeCC-cccCCCCeEEEEEEEEEECCc
Confidence            5777665332 2245677899999999 5654


No 61 
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=85.90  E-value=0.58  Score=29.85  Aligned_cols=26  Identities=19%  Similarity=0.059  Sum_probs=22.8

Q ss_pred             cceEEeccCCcEEEEEE-EeeeCCCCC
Q psy15736         44 RSWVHSGEGYEAQLVCI-VHAEPHADP   69 (70)
Q Consensus        44 ~~~Vha~~G~~a~L~Ci-V~A~P~a~V   69 (70)
                      ++.|.+.+|+.+.|.|. ..++|.+.|
T Consensus        10 ~~~v~V~eG~~~~L~C~pP~g~P~P~i   36 (95)
T cd05845          10 IRPVEVEEGDSVVLPCNPPKSAVPLRI   36 (95)
T ss_pred             cceeEEecCCCEEEEecCCCCCCCCEE
Confidence            57788899999999997 699999875


No 62 
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=85.19  E-value=1.9  Score=27.03  Aligned_cols=29  Identities=28%  Similarity=0.416  Sum_probs=20.9

Q ss_pred             CCeEEEe-cceEEeccCCcEEEEEEEee-eCCC
Q psy15736         37 LPEIEVE-RSWVHSGEGYEAQLVCIVHA-EPHA   67 (70)
Q Consensus        37 pPeI~v~-~~~Vha~~G~~a~L~CiV~A-~P~a   67 (70)
                      ||.+.|- +..  ...|..++|.|.|.+ +|+.
T Consensus         1 pP~v~v~~~~~--~~~g~~~~L~C~a~gFyP~~   31 (93)
T cd05770           1 TPKVQVYSRFP--AENGKPNVLNCYVTGFHPPD   31 (93)
T ss_pred             CCEEEEEecCC--CcCCCceEEEEEEEEEeCCC
Confidence            6888885 333  345788899999999 5554


No 63 
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=85.11  E-value=1.1  Score=27.47  Aligned_cols=21  Identities=19%  Similarity=0.415  Sum_probs=17.7

Q ss_pred             ecceEEeccCCcEEEEEEEee
Q psy15736         43 ERSWVHSGEGYEAQLVCIVHA   63 (70)
Q Consensus        43 ~~~~Vha~~G~~a~L~CiV~A   63 (70)
                      ....+.+.+|..++|.|.+.+
T Consensus         4 ~p~~~~v~~G~~v~l~C~~~~   24 (110)
T cd05899           4 SPRYLIKGRGQSVTLRCSQTS   24 (110)
T ss_pred             CCCceEEcCCCcEEEEEEECC
Confidence            345677889999999999987


No 64 
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=83.99  E-value=1.1  Score=28.39  Aligned_cols=21  Identities=29%  Similarity=0.235  Sum_probs=17.9

Q ss_pred             ceEEeccCCcEEEEEEEeeeC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEP   65 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P   65 (70)
                      +-|...+|+.|+|.|.|....
T Consensus         5 ~nvtv~~G~ta~L~C~v~~~~   25 (95)
T cd05881           5 EDVTVVEGEVAIISCRVKNND   25 (95)
T ss_pred             CceEEcCCCcEEEEEEEccCC
Confidence            457789999999999999864


No 65 
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=83.37  E-value=1.2  Score=27.37  Aligned_cols=20  Identities=15%  Similarity=0.252  Sum_probs=17.2

Q ss_pred             cceEEeccCCcEEEEEEEee
Q psy15736         44 RSWVHSGEGYEAQLVCIVHA   63 (70)
Q Consensus        44 ~~~Vha~~G~~a~L~CiV~A   63 (70)
                      ...+.+.+|..++|.|.+..
T Consensus         5 p~~~~~~~G~~v~l~C~~~~   24 (116)
T cd04982           5 QLSITREESKSVTISCKVSG   24 (116)
T ss_pred             CCeEEeCCCCCEEEEEEEeC
Confidence            45777889999999999977


No 66 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=82.02  E-value=1.3  Score=25.84  Aligned_cols=23  Identities=4%  Similarity=-0.012  Sum_probs=20.9

Q ss_pred             hcCcCCCccceeeeEEEEeecCC
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNLP   38 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~ypP   38 (70)
                      .|.+++....+++...|.|..||
T Consensus        63 ~C~a~n~~g~~~~~~~l~V~~pP   85 (85)
T cd04970          63 TCTAQTVVDSLSASADLIVRGPP   85 (85)
T ss_pred             EEEEecCCCcEEEEEEEEEECCC
Confidence            48889988899999999999998


No 67 
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=81.51  E-value=1.5  Score=27.50  Aligned_cols=23  Identities=22%  Similarity=0.281  Sum_probs=18.9

Q ss_pred             EEeccCCcEEEEEEEeeeCCCCC
Q psy15736         47 VHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        47 Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      |-+.+|.+|+|.|...+.|.+.+
T Consensus         2 v~~~~G~~VtL~C~~s~~~~~~i   24 (94)
T cd07690           2 VLGKKGDTAELPCTASQKKSIQF   24 (94)
T ss_pred             eEeeCCCCEEEEEEeCCCCCcEE
Confidence            56788999999999988776543


No 68 
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=81.37  E-value=1.9  Score=26.33  Aligned_cols=25  Identities=24%  Similarity=0.262  Sum_probs=20.4

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEe
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVH   62 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~   62 (70)
                      +|.|+.+.+.|-+ .|.+++|.|...
T Consensus         1 kP~l~a~p~~vV~-~G~~VTL~C~~~   25 (94)
T cd05711           1 KPFLSAHPSPVVP-SGENVTLQCHSD   25 (94)
T ss_pred             CCEEEecCCCccC-CCCeEEEEEecC
Confidence            5889998877774 699999999654


No 69 
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=80.17  E-value=2.2  Score=24.90  Aligned_cols=17  Identities=24%  Similarity=0.333  Sum_probs=14.6

Q ss_pred             ccCCcEEEEEEEeee-CC
Q psy15736         50 GEGYEAQLVCIVHAE-PH   66 (70)
Q Consensus        50 ~~G~~a~L~CiV~A~-P~   66 (70)
                      ..|..++|.|.+.++ |.
T Consensus        11 ~~~~~~~L~C~a~g~~P~   28 (95)
T cd00098          11 LLGGSVTLTCLATGFYPP   28 (95)
T ss_pred             HcCCCeEEEEEEeeEECC
Confidence            358999999999998 64


No 70 
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=79.90  E-value=2.1  Score=25.75  Aligned_cols=25  Identities=28%  Similarity=0.191  Sum_probs=20.1

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEe
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVH   62 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~   62 (70)
                      .|.|++..++|. ..|.+++|.|...
T Consensus         2 kP~L~a~p~~vV-~~G~~VtL~C~~~   26 (91)
T cd05751           2 KPSLWAEPSSVV-PLGKPVTLRCQGP   26 (91)
T ss_pred             CCEEEecCCCcc-CCCCcEEEEEecC
Confidence            588888877666 4699999999765


No 71 
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=77.47  E-value=3.7  Score=25.30  Aligned_cols=24  Identities=21%  Similarity=0.223  Sum_probs=19.1

Q ss_pred             EEEecceEEeccCCcEEEEEEEee
Q psy15736         40 IEVERSWVHSGEGYEAQLVCIVHA   63 (70)
Q Consensus        40 I~v~~~~Vha~~G~~a~L~CiV~A   63 (70)
                      |....+.|-+..|..++|.|....
T Consensus         2 v~q~~~~v~~~~G~~v~L~C~~~~   25 (116)
T cd07706           2 VTQAQPDVSVQVGEEVTLNCRYET   25 (116)
T ss_pred             cEEeCCceEEcCCCCEEEEEEEeC
Confidence            345556778899999999999865


No 72 
>KOG3515|consensus
Probab=75.67  E-value=1.4  Score=37.50  Aligned_cols=35  Identities=23%  Similarity=0.219  Sum_probs=26.8

Q ss_pred             eecCCeE---EEecceEEeccCCcEEEEEEEeeeCCCC
Q psy15736         34 QKNLPEI---EVERSWVHSGEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        34 V~ypPeI---~v~~~~Vha~~G~~a~L~CiV~A~P~a~   68 (70)
                      |+|||-+   ...+-.++...|+.+.|.|.|-+.|++.
T Consensus         1 vl~~p~~pv~~~~~l~~~~~~g~~v~l~C~v~~~pp~~   38 (741)
T KOG3515|consen    1 VLFPPNVPVCESSSLTVGLRLGEDVPLPCRVNSNPPEI   38 (741)
T ss_pred             CCcCCCCccccCCCCChhhccCCcceeeeecCCCCCCc
Confidence            5666654   4444455889999999999999999863


No 73 
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=75.30  E-value=4.1  Score=25.30  Aligned_cols=19  Identities=21%  Similarity=0.335  Sum_probs=14.6

Q ss_pred             eEEeccCCcEEEEEEEeee
Q psy15736         46 WVHSGEGYEAQLVCIVHAE   64 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~   64 (70)
                      .+.+..|..|+|.|.....
T Consensus         7 ~v~v~~G~~vtL~C~~s~~   25 (116)
T cd05715           7 EVYAVNGSDVRLKCTFSSS   25 (116)
T ss_pred             eEEEEcCCCeEEEeEEeCC
Confidence            3455689999999998653


No 74 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=73.03  E-value=4.9  Score=23.32  Aligned_cols=19  Identities=21%  Similarity=0.256  Sum_probs=15.6

Q ss_pred             EEeccCCcEEEEEEEeeeC
Q psy15736         47 VHSGEGYEAQLVCIVHAEP   65 (70)
Q Consensus        47 Vha~~G~~a~L~CiV~A~P   65 (70)
                      ....+|..++|.|.+.+.+
T Consensus         4 ~~~~~G~~v~l~C~~~~~~   22 (79)
T cd04973           4 YSAHPGDLLQLRCRLRDDV   22 (79)
T ss_pred             EEecCCCCEEEEEEecCCC
Confidence            3457899999999999864


No 75 
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=72.91  E-value=3.5  Score=24.26  Aligned_cols=17  Identities=24%  Similarity=0.399  Sum_probs=14.4

Q ss_pred             EeccCCcEEEEEEEeee
Q psy15736         48 HSGEGYEAQLVCIVHAE   64 (70)
Q Consensus        48 ha~~G~~a~L~CiV~A~   64 (70)
                      .+..|..++|.|.+...
T Consensus         2 ~v~~G~~v~L~C~~~~~   18 (105)
T cd00099           2 SVSEGESVTLSCTYSGS   18 (105)
T ss_pred             eecCCCCEEEEEEEeCC
Confidence            45689999999999875


No 76 
>PHA02785 IL-beta-binding protein; Provisional
Probab=71.68  E-value=5.2  Score=29.63  Aligned_cols=54  Identities=11%  Similarity=0.012  Sum_probs=33.2

Q ss_pred             hcCcCCCccceeeeEEEEeecC--CeEEEecceEEeccCCcEEEEEE-----EeeeCCCCC
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNL--PEIEVERSWVHSGEGYEAQLVCI-----VHAEPHADP   69 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~yp--PeI~v~~~~Vha~~G~~a~L~Ci-----V~A~P~a~V   69 (70)
                      .|.+.|+....+..+.|+|...  |-|.....-....+|..+.|.|.     ..+.|.+.|
T Consensus        98 ~C~a~N~~g~~~~s~~L~V~~~~~~~~~~~~~~~~~~~g~~~~i~C~~~~~~~~~~~~~~i  158 (326)
T PHA02785         98 ICITKNETYCDMMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFIASNVNADI  158 (326)
T ss_pred             EEEEECCCcceEEEEEEEEEecCCCccceeeccceecccCcEEEECCChhhcccCCCCceE
Confidence            4778887766777788877653  32322211122458999999996     245566654


No 77 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=70.85  E-value=4.2  Score=25.21  Aligned_cols=21  Identities=24%  Similarity=0.202  Sum_probs=15.6

Q ss_pred             EeccCCcEEEEEEEeeeCCCCC
Q psy15736         48 HSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        48 ha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ....|..+.|.|.+.+ |.+.|
T Consensus         7 ~v~~G~~v~L~C~~~~-~~~~i   27 (87)
T cd05873           7 TFKLGNNAELKCSPKS-NLARV   27 (87)
T ss_pred             EEECCCCEEEEEECCC-CCCeE
Confidence            3466999999999875 55543


No 78 
>KOG4221|consensus
Probab=70.56  E-value=6  Score=36.09  Aligned_cols=44  Identities=18%  Similarity=0.128  Sum_probs=30.6

Q ss_pred             eeeEEEEeecCCeEEEec------ceEEeccCCcEEEEEEEeeeCCCCCC
Q psy15736         27 RRRRRRNQKNLPEIEVER------SWVHSGEGYEAQLVCIVHAEPHADPL   70 (70)
Q Consensus        27 s~~I~L~V~ypPeI~v~~------~~Vha~~G~~a~L~CiV~A~P~a~V~   70 (70)
                      +..-.|+|+--|......      +......|+++.|+|.|.+.|+|.|.
T Consensus       221 S~~a~ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v~leCvvs~~p~p~v~  270 (1381)
T KOG4221|consen  221 SNEAELTVLSDPGALNKLVFLDEPSNAVVVEGDDVVLECVVSGVPKPSVK  270 (1381)
T ss_pred             cceeEEEecCCcccccceeeecCCCccccccCCcEEEEEEecCCCCCceE
Confidence            556677777555443322      12234679999999999999999873


No 79 
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=70.20  E-value=6  Score=25.41  Aligned_cols=33  Identities=18%  Similarity=0.349  Sum_probs=20.4

Q ss_pred             eecCCeEEEec-ceEEeccCCcEEEEEEEeee-CC
Q psy15736         34 QKNLPEIEVER-SWVHSGEGYEAQLVCIVHAE-PH   66 (70)
Q Consensus        34 V~ypPeI~v~~-~~Vha~~G~~a~L~CiV~A~-P~   66 (70)
                      |..+|++-+=. +..-...|..++|.|.+.++ |+
T Consensus         2 v~~~P~~p~i~~~~~~~~~g~~~tL~C~a~gF~P~   36 (111)
T cd05772           2 VRAKPSVPVVSGPSGRANPGQSVNFTCSAHGFSPR   36 (111)
T ss_pred             cccCCCCcEeCCchhccCCCCCEEEEEEEeeEeCC
Confidence            45555554332 23333468889999999984 54


No 80 
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=69.48  E-value=4.6  Score=25.08  Aligned_cols=30  Identities=20%  Similarity=0.356  Sum_probs=19.0

Q ss_pred             CCeEEEecceE-EeccCCcEEEEEEEee-eCC
Q psy15736         37 LPEIEVERSWV-HSGEGYEAQLVCIVHA-EPH   66 (70)
Q Consensus        37 pPeI~v~~~~V-ha~~G~~a~L~CiV~A-~P~   66 (70)
                      ||.|.+-.+-. ....|..++|.|.|.+ +|.
T Consensus         1 pP~V~v~~p~~~~~~~~~~~~L~C~~~gfyP~   32 (100)
T cd07699           1 APSVTIFPPSSEELEKSGKATLVCLINDFYPG   32 (100)
T ss_pred             CCeEEEECCCHHHHccCCCcEEEEEEEeEECC
Confidence            45565543322 2335778999999998 553


No 81 
>KOG4222|consensus
Probab=68.36  E-value=4.2  Score=36.81  Aligned_cols=56  Identities=9%  Similarity=0.005  Sum_probs=46.6

Q ss_pred             hhcCcCCCccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCCCCCC
Q psy15736         15 EEEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADPL   70 (70)
Q Consensus        15 ~~~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V~   70 (70)
                      .-|.+++--.-..++-.|+|+=||-..+...-=-.++|..++|.|++-+.|.+.|+
T Consensus       293 y~C~a~n~vG~l~asa~ltV~apP~f~kkp~dq~v~lg~~vt~pc~~~gnP~Pavf  348 (1281)
T KOG4222|consen  293 YVCPAENLVGGLEASATLTVQAPPSFGKKPRDQKVALGGTVTFPCETLGNPPPAVF  348 (1281)
T ss_pred             eeeeccccccccccccceEEecCcccccccCccccccCceEEeeeecCCCCCcceE
Confidence            45778887777889999999999999887544444679999999999999999874


No 82 
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=68.27  E-value=5.4  Score=24.89  Aligned_cols=17  Identities=24%  Similarity=0.444  Sum_probs=14.5

Q ss_pred             cCCcEEEEEEEeee--CCC
Q psy15736         51 EGYEAQLVCIVHAE--PHA   67 (70)
Q Consensus        51 ~G~~a~L~CiV~A~--P~a   67 (70)
                      .|..++|.|.|.++  |..
T Consensus        13 ~~~~~tLtC~v~gf~yP~~   31 (96)
T cd07696          13 LTKSVKLTCLVTNLTSPEG   31 (96)
T ss_pred             cCCCeEEEEEEeCCCCCCC
Confidence            47899999999998  654


No 83 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=68.03  E-value=2.9  Score=25.63  Aligned_cols=20  Identities=20%  Similarity=0.265  Sum_probs=16.6

Q ss_pred             ccCCcEEEEEEEee-----eCCCCC
Q psy15736         50 GEGYEAQLVCIVHA-----EPHADP   69 (70)
Q Consensus        50 ~~G~~a~L~CiV~A-----~P~a~V   69 (70)
                      .+|..+.|.|.+.+     .|.+.|
T Consensus        12 ~~G~~~~L~C~~~g~~~~~~p~~~v   36 (94)
T cd05756          12 LEGEPVVIKCPLFYSYIAQSPGLNL   36 (94)
T ss_pred             ecCCCeEEECCCCCcccccCCCceE
Confidence            47999999999999     577654


No 84 
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=67.53  E-value=4  Score=26.79  Aligned_cols=24  Identities=29%  Similarity=0.375  Sum_probs=19.8

Q ss_pred             CCeEEEecceEEeccCCcEEEEEEEee
Q psy15736         37 LPEIEVERSWVHSGEGYEAQLVCIVHA   63 (70)
Q Consensus        37 pPeI~v~~~~Vha~~G~~a~L~CiV~A   63 (70)
                      +|+|..+.++   .+|..++|.|.|++
T Consensus         3 ~p~i~~~~~l---~~G~~vtv~C~v~~   26 (99)
T cd07689           3 DPEILLSGPL---EEGKPVTVKCEVPD   26 (99)
T ss_pred             CccCcccCcc---cCCceEEEEEEecC
Confidence            6778887777   45999999999983


No 85 
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=65.67  E-value=9.7  Score=23.97  Aligned_cols=21  Identities=19%  Similarity=0.351  Sum_probs=16.9

Q ss_pred             ceEEeccCCcEEEEEEEeeeC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEP   65 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P   65 (70)
                      +.|.+..|..++|.|.....+
T Consensus         6 ~~v~~~~G~~v~L~C~~s~~~   26 (115)
T cd05880           6 KEVEAVNGTDVRLKCTFSSSA   26 (115)
T ss_pred             ceEEEEcCCCEEEEEEEEeCC
Confidence            367778899999999987543


No 86 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=65.66  E-value=6  Score=23.51  Aligned_cols=23  Identities=4%  Similarity=-0.026  Sum_probs=21.0

Q ss_pred             hcCcCCCccceeeeEEEEeecCC
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNLP   38 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~ypP   38 (70)
                      .|.|.++...+++.+.|.|+-||
T Consensus        63 tC~A~n~~g~~~~~~~L~V~~~P   85 (85)
T cd05854          63 TCTAQTVVDSASASATLVVRGPP   85 (85)
T ss_pred             EEEEecCCCCEEEEEEEEEECCC
Confidence            58899999999999999999887


No 87 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=65.17  E-value=4  Score=25.44  Aligned_cols=25  Identities=8%  Similarity=-0.077  Sum_probs=22.6

Q ss_pred             hhcCcCCCccceeeeEEEEeecCCe
Q psy15736         15 EEEEPEKDKEEVRRRRRRNQKNLPE   39 (70)
Q Consensus        15 ~~~~~~~~~~pvs~~I~L~V~ypPe   39 (70)
                      =.|.+.|+-..++..|.|.|..+|+
T Consensus        85 Y~C~A~N~~G~~~~~i~L~~~~~p~  109 (109)
T cd05773          85 FTCTAHNSLGEDSLDIQLVSTSRPD  109 (109)
T ss_pred             EEEEEEeCCccCcEEEEEEecCCCC
Confidence            3699999999999999999999985


No 88 
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=63.57  E-value=9  Score=23.50  Aligned_cols=16  Identities=13%  Similarity=0.183  Sum_probs=13.4

Q ss_pred             eccCCcEEEEEEEeee
Q psy15736         49 SGEGYEAQLVCIVHAE   64 (70)
Q Consensus        49 a~~G~~a~L~CiV~A~   64 (70)
                      +..|+.++|.|.+...
T Consensus         3 v~~G~~vtL~C~~~~~   18 (107)
T cd07700           3 VQTNNTVKLSCEAKGI   18 (107)
T ss_pred             EcCCCCEEEEEEEecC
Confidence            4679999999998753


No 89 
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=62.86  E-value=8  Score=22.94  Aligned_cols=16  Identities=25%  Similarity=0.063  Sum_probs=13.2

Q ss_pred             EeccCCcEEEEEEEee
Q psy15736         48 HSGEGYEAQLVCIVHA   63 (70)
Q Consensus        48 ha~~G~~a~L~CiV~A   63 (70)
                      ...+|..++|.|.+.+
T Consensus        10 ~V~~G~~vtL~C~~~~   25 (83)
T cd05753          10 VVFEGEPLVLRCHGWK   25 (83)
T ss_pred             eecCCCCEEEEeeCCC
Confidence            4567999999999854


No 90 
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=62.86  E-value=9.1  Score=23.98  Aligned_cols=18  Identities=28%  Similarity=0.368  Sum_probs=13.7

Q ss_pred             cCCcEEEEEEEeeeCCCC
Q psy15736         51 EGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        51 ~G~~a~L~CiV~A~P~a~   68 (70)
                      .|..++|.|.|.++-.+.
T Consensus        15 ~~~~~tL~C~a~gFyP~~   32 (102)
T cd05768          15 LQETATLTCLVKGFSPSD   32 (102)
T ss_pred             cCCceEEEEEEeeEeCCC
Confidence            467899999999954443


No 91 
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=60.72  E-value=7  Score=23.33  Aligned_cols=16  Identities=13%  Similarity=0.279  Sum_probs=13.6

Q ss_pred             eccCCcEEEEEEEeee
Q psy15736         49 SGEGYEAQLVCIVHAE   64 (70)
Q Consensus        49 a~~G~~a~L~CiV~A~   64 (70)
                      +.+|+.|+|.|.+.+.
T Consensus         3 v~~G~~v~l~C~~~~~   18 (98)
T cd04984           3 VSPGETVTITCTGSSG   18 (98)
T ss_pred             cCCCCCEEEEEEEcCC
Confidence            4689999999998764


No 92 
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=57.56  E-value=8.7  Score=22.78  Aligned_cols=17  Identities=18%  Similarity=0.214  Sum_probs=14.4

Q ss_pred             EEeccCCcEEEEEEEee
Q psy15736         47 VHSGEGYEAQLVCIVHA   63 (70)
Q Consensus        47 Vha~~G~~a~L~CiV~A   63 (70)
                      |.+.+|+.++|.|....
T Consensus         2 v~~~~G~~vtl~C~~~~   18 (98)
T cd05716           2 VTGELGGSVTIPCPYPP   18 (98)
T ss_pred             EEEEeCCeEEEEeeCCC
Confidence            56678999999999875


No 93 
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=57.48  E-value=9.1  Score=23.55  Aligned_cols=15  Identities=27%  Similarity=0.395  Sum_probs=12.5

Q ss_pred             eccCCcEEEEEEEee
Q psy15736         49 SGEGYEAQLVCIVHA   63 (70)
Q Consensus        49 a~~G~~a~L~CiV~A   63 (70)
                      +.+|+.|+|.|.+..
T Consensus         3 v~~G~~vtL~C~~~~   17 (104)
T cd05720           3 AELGQKVELKCEVLN   17 (104)
T ss_pred             ccCCCeEEEEEEecC
Confidence            467999999999854


No 94 
>KOG3515|consensus
Probab=56.42  E-value=9.2  Score=32.81  Aligned_cols=54  Identities=11%  Similarity=0.029  Sum_probs=46.1

Q ss_pred             hhhcCcCCCccceeeeEEEEeecCCeEEEecceEEe---ccCCcEEEEEEEeeeCCCC
Q psy15736         14 EEEEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHS---GEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        14 ~~~~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha---~~G~~a~L~CiV~A~P~a~   68 (70)
                      +--|...|++.|+..+-+|.+.++|.++...+.+.+   +.| .+++.|.+.+.|...
T Consensus       569 ~~~~~~d~~~~pA~~~~~l~~~s~~~v~~~tp~~~~~~~g~v-~as~~~~a~~~~~~~  625 (741)
T KOG3515|consen  569 ETACVVDGSSPPAGLSLVLKAYSALIVTVRTPNMYTAQEGCV-NASDDCVASGVPSTS  625 (741)
T ss_pred             ceEEeecCCCCccccceEEEecccccccccCCceeeeccCcc-cccccceecccccce
Confidence            445788899999999999999999999999998887   334 899999888888654


No 95 
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=53.15  E-value=18  Score=23.27  Aligned_cols=20  Identities=20%  Similarity=0.245  Sum_probs=16.4

Q ss_pred             eEEeccCCcEEEEEEEeeeC
Q psy15736         46 WVHSGEGYEAQLVCIVHAEP   65 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~P   65 (70)
                      .+.+..|..+.|.|.....+
T Consensus         7 ev~a~~G~~v~L~C~f~~~~   26 (116)
T cd05879           7 EVYGTVGSDVTLSCSFWSSE   26 (116)
T ss_pred             eEEEEcCCcEEEEEEEecCC
Confidence            56778899999999997643


No 96 
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=49.81  E-value=39  Score=20.91  Aligned_cols=15  Identities=20%  Similarity=0.410  Sum_probs=9.9

Q ss_pred             CCcEEEEEEEee-eCC
Q psy15736         52 GYEAQLVCIVHA-EPH   66 (70)
Q Consensus        52 G~~a~L~CiV~A-~P~   66 (70)
                      +..++|.|.|.+ +|+
T Consensus        16 ~~~~~L~C~a~gFyP~   31 (95)
T cd04985          16 SDSVTLGCLATGFLPE   31 (95)
T ss_pred             CCcEEEEEEEeeEECC
Confidence            455777787777 444


No 97 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=47.57  E-value=15  Score=21.83  Aligned_cols=24  Identities=13%  Similarity=0.029  Sum_probs=21.6

Q ss_pred             hcCcCCCccceeeeEEEEeecCCe
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNLPE   39 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~ypPe   39 (70)
                      .|.++|+-..++..+.|.|.-+|.
T Consensus        63 tC~A~N~~G~~~~~~~L~V~~~P~   86 (88)
T cd05735          63 SCHAINSYGEDRGIIQLTVQEPPD   86 (88)
T ss_pred             EEEEEcCCCcceEEEEEEEeCCCC
Confidence            689999999999999999998874


No 98 
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=46.20  E-value=26  Score=20.33  Aligned_cols=17  Identities=24%  Similarity=0.268  Sum_probs=13.6

Q ss_pred             cCCcEEEEEEEeeeCCC
Q psy15736         51 EGYEAQLVCIVHAEPHA   67 (70)
Q Consensus        51 ~G~~a~L~CiV~A~P~a   67 (70)
                      .|..++|.|.|.++=..
T Consensus         7 ~~~~~~L~C~v~~f~P~   23 (83)
T PF07654_consen    7 LGGSVTLTCLVSGFYPK   23 (83)
T ss_dssp             STSEEEEEEEEEEEBSS
T ss_pred             CCCCEEEEEEEEEEECC
Confidence            48899999999985444


No 99 
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=46.20  E-value=12  Score=23.79  Aligned_cols=26  Identities=27%  Similarity=0.331  Sum_probs=19.1

Q ss_pred             cceEEeccCCcEEEEE-EEeeeCCCCC
Q psy15736         44 RSWVHSGEGYEAQLVC-IVHAEPHADP   69 (70)
Q Consensus        44 ~~~Vha~~G~~a~L~C-iV~A~P~a~V   69 (70)
                      ++-+-..+|..+.|.| .-.++|.+.+
T Consensus        10 ~~~~~v~eG~~~~L~C~pP~g~P~p~~   36 (96)
T cd05727          10 RDEVKVKEGWGVVLFCDPPPHYPDLSY   36 (96)
T ss_pred             cCceeeeeCCcEEEeeCCCCCCCCCEE
Confidence            3445567799999999 5567777654


No 100
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=45.71  E-value=13  Score=23.08  Aligned_cols=29  Identities=21%  Similarity=0.231  Sum_probs=20.2

Q ss_pred             EEecceEEeccCCcEEEEEEE-eeeCCCCC
Q psy15736         41 EVERSWVHSGEGYEAQLVCIV-HAEPHADP   69 (70)
Q Consensus        41 ~v~~~~Vha~~G~~a~L~CiV-~A~P~a~V   69 (70)
                      +.+..-+-++......+.|.+ .|.|.|.|
T Consensus         4 ~~~~~~~~~~~~~~~va~C~s~~gkP~a~I   33 (95)
T cd05719           4 SAEAGPVALGGEPVTVATCVSANGKPPATI   33 (95)
T ss_pred             ccceeccccCCCccEEEEEECCCCcCCCEE
Confidence            333334445666688899999 68999876


No 101
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=43.94  E-value=29  Score=21.86  Aligned_cols=17  Identities=18%  Similarity=0.098  Sum_probs=13.7

Q ss_pred             eEEeccCCcEEEEEEEe
Q psy15736         46 WVHSGEGYEAQLVCIVH   62 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~   62 (70)
                      .+-+..|+.++|.|...
T Consensus         6 ~~~v~~G~~vtL~C~~~   22 (117)
T cd04981           6 PGLVKPGQSLKLSCKAS   22 (117)
T ss_pred             CeEEcCCCCEEEEEEEe
Confidence            44557899999999875


No 102
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=41.10  E-value=24  Score=21.59  Aligned_cols=23  Identities=4%  Similarity=-0.038  Sum_probs=21.1

Q ss_pred             hcCcCCCccceeeeEEEEeecCC
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNLP   38 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~ypP   38 (70)
                      .|.+.+.-+.+++...|.|+=||
T Consensus        63 tC~a~n~~~~~~a~a~L~V~~pP   85 (85)
T cd05853          63 VCMVQTSVDKLSAAADLIVRGPP   85 (85)
T ss_pred             EEEEEcccCceEEEEEEEEecCC
Confidence            58899999999999999999888


No 103
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=40.90  E-value=26  Score=21.87  Aligned_cols=21  Identities=24%  Similarity=0.306  Sum_probs=14.7

Q ss_pred             EEecceEEeccCCcEEEEEEEe
Q psy15736         41 EVERSWVHSGEGYEAQLVCIVH   62 (70)
Q Consensus        41 ~v~~~~Vha~~G~~a~L~CiV~   62 (70)
                      ..|+. +.+.+|..++|.|.-.
T Consensus         4 q~P~~-v~~~~G~~VtL~C~f~   24 (119)
T cd05712           4 WMPKS-VSVQEGLCVLIPCSFS   24 (119)
T ss_pred             cCCCE-EEEeccccEEEEEEee
Confidence            33443 3457799999999764


No 104
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=40.11  E-value=21  Score=25.54  Aligned_cols=22  Identities=18%  Similarity=0.078  Sum_probs=18.6

Q ss_pred             eEEeccCCcEEEEEEEeeeCCC
Q psy15736         46 WVHSGEGYEAQLVCIVHAEPHA   67 (70)
Q Consensus        46 ~Vha~~G~~a~L~CiV~A~P~a   67 (70)
                      -|.+.+|..+.|.|.+..+|++
T Consensus        31 ~~~v~eGe~v~L~C~~~~~~~~   52 (227)
T PHA02826         31 PVYAKFGDPMVLLCTGKHYKKS   52 (227)
T ss_pred             eEEecCCCCEEEEccccccccc
Confidence            4667899999999999988765


No 105
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=36.18  E-value=44  Score=20.98  Aligned_cols=16  Identities=13%  Similarity=0.366  Sum_probs=12.8

Q ss_pred             CCcEEEEEEEee-eCCC
Q psy15736         52 GYEAQLVCIVHA-EPHA   67 (70)
Q Consensus        52 G~~a~L~CiV~A-~P~a   67 (70)
                      |..++|.|.+.+ +|..
T Consensus        16 ~~~~tL~C~a~gFyP~~   32 (96)
T cd07697          16 QGQGIYLCLLENFFPDV   32 (96)
T ss_pred             CCCEEEEEEEEEEeCCC
Confidence            567899999999 5654


No 106
>PHA03052 Hypothetical protein; Provisional
Probab=35.53  E-value=43  Score=21.02  Aligned_cols=22  Identities=18%  Similarity=0.333  Sum_probs=17.0

Q ss_pred             ceEEeccCCcEEEEEEEeeeCC
Q psy15736         45 SWVHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        45 ~~Vha~~G~~a~L~CiV~A~P~   66 (70)
                      ..+-+.+|.+++|.|-|.=-|.
T Consensus         5 ~~i~~slGs~ltI~Ckv~lg~g   26 (69)
T PHA03052          5 EGIVTSLGSNLTITCKVSLRPP   26 (69)
T ss_pred             ccEEEEccCCceEeEEEEecCC
Confidence            4556689999999999975544


No 107
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=35.41  E-value=51  Score=20.19  Aligned_cols=17  Identities=29%  Similarity=0.317  Sum_probs=14.1

Q ss_pred             cCCcEEEEEEEee-eCCC
Q psy15736         51 EGYEAQLVCIVHA-EPHA   67 (70)
Q Consensus        51 ~G~~a~L~CiV~A-~P~a   67 (70)
                      +|..++|.|.|.+ +|..
T Consensus        13 ~~~~~~L~C~~~gFyP~~   30 (94)
T cd05766          13 LSHPHLLVCHVWGFYPPE   30 (94)
T ss_pred             CCCCeEEEEEEeeecCCC
Confidence            5889999999999 5544


No 108
>KOG4194|consensus
Probab=34.87  E-value=56  Score=28.68  Aligned_cols=57  Identities=12%  Similarity=0.067  Sum_probs=46.0

Q ss_pred             hhhhhhhcCcCCCccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCC
Q psy15736         10 EYQEEEEEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        10 ~~~~~~~~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~   66 (70)
                      +.|----|-|-++....++.-.|.|+=.|-..+|-.---...|..+-|.|..++.|+
T Consensus       679 eD~GiYtC~A~n~AG~isanAtL~V~e~p~f~~PL~~~~V~~get~vlqC~a~~~~a  735 (873)
T KOG4194|consen  679 EDQGIYTCTAQNVAGQISANATLTVLETPSFSIPLEDQLVVVGETLVLQCLAEGAPA  735 (873)
T ss_pred             cccceeEEeeeccccceeeceEEEEecCCcccccccceEEEecceEEEEEecCCCCC
Confidence            334444688889999999999999999998888844444466999999999999987


No 109
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=34.26  E-value=38  Score=21.67  Aligned_cols=14  Identities=29%  Similarity=0.451  Sum_probs=12.1

Q ss_pred             cCCcEEEEEEEeee
Q psy15736         51 EGYEAQLVCIVHAE   64 (70)
Q Consensus        51 ~G~~a~L~CiV~A~   64 (70)
                      .|..++|.|.|.++
T Consensus        18 ~~~~atLtClV~~f   31 (99)
T cd04986          18 LGSSASLTCTLSGL   31 (99)
T ss_pred             cCCccEEEEEEecc
Confidence            57889999999984


No 110
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=34.15  E-value=30  Score=19.06  Aligned_cols=20  Identities=0%  Similarity=-0.220  Sum_probs=17.1

Q ss_pred             hcCcCCCccceeeeEEEEee
Q psy15736         16 EEEPEKDKEEVRRRRRRNQK   35 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~   35 (70)
                      .|.++|....+++.+.|+|.
T Consensus        57 ~C~A~N~~G~~~~~~~l~V~   76 (76)
T cd04978          57 QCNASNVHGYLLANAFVHVV   76 (76)
T ss_pred             EEEEEccCCeEEEeEEEEEC
Confidence            48889989999999999884


No 111
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=29.12  E-value=70  Score=21.37  Aligned_cols=23  Identities=30%  Similarity=0.284  Sum_probs=15.8

Q ss_pred             EecceEEeccCCcEEEEEEEeee
Q psy15736         42 VERSWVHSGEGYEAQLVCIVHAE   64 (70)
Q Consensus        42 v~~~~Vha~~G~~a~L~CiV~A~   64 (70)
                      ++..-+-+..|..++|.|.+.+.
T Consensus         3 ~~~~~~lv~p~~sv~LsC~~sg~   25 (115)
T cd05721           3 VQQSPVLASSNGAASLVCEYTYN   25 (115)
T ss_pred             eecCCeEEcCCCCEEEEEEecCC
Confidence            33444455668889999998664


No 112
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=28.83  E-value=56  Score=20.47  Aligned_cols=27  Identities=22%  Similarity=0.182  Sum_probs=18.7

Q ss_pred             ecceEEeccCCcEEEEEEEe-eeCCCCC
Q psy15736         43 ERSWVHSGEGYEAQLVCIVH-AEPHADP   69 (70)
Q Consensus        43 ~~~~Vha~~G~~a~L~CiV~-A~P~a~V   69 (70)
                      +..-|-++.--...|.|++. |.|+|.|
T Consensus         6 ~~~~~~~~~~~~~va~C~s~~gkPaa~I   33 (95)
T cd07703           6 EAVEVSAGTIPVPVAKCVSANGRPPARI   33 (95)
T ss_pred             eEEEeecCCCccEEEEEEcCCCCCCcEE
Confidence            33445555555788999887 8888865


No 113
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=28.81  E-value=41  Score=19.22  Aligned_cols=20  Identities=5%  Similarity=-0.135  Sum_probs=17.5

Q ss_pred             hcCcCCCccceeeeEEEEee
Q psy15736         16 EEEPEKDKEEVRRRRRRNQK   35 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~   35 (70)
                      .|.++|....+++++.|+|+
T Consensus        57 ~C~A~N~~G~~~~~~~l~v~   76 (76)
T cd05868          57 QCNASNEYGYLLANAFVNVL   76 (76)
T ss_pred             EEEEEcCCCEEEEEEEEEeC
Confidence            58899999999999999985


No 114
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=28.60  E-value=67  Score=20.82  Aligned_cols=16  Identities=31%  Similarity=0.578  Sum_probs=12.2

Q ss_pred             cCCcEEEEEEEeee-CC
Q psy15736         51 EGYEAQLVCIVHAE-PH   66 (70)
Q Consensus        51 ~G~~a~L~CiV~A~-P~   66 (70)
                      .+..++|.|.|.++ |+
T Consensus        17 ~~~~~tL~Cla~gFyP~   33 (115)
T cd05769          17 NKRKATLVCLATGFYPD   33 (115)
T ss_pred             cCCCcEEEEEEEeEeCC
Confidence            45678999999984 44


No 115
>KOG4222|consensus
Probab=28.43  E-value=31  Score=31.55  Aligned_cols=48  Identities=17%  Similarity=0.084  Sum_probs=40.0

Q ss_pred             CccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         22 DKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        22 ~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|...+.--+|.|+=+|..+.+-..-...+|..+...|-|-++|.+.|
T Consensus       210 vG~ReS~~A~lsv~e~P~f~~rp~~~~v~~g~~~~f~c~v~GdP~P~V  257 (1281)
T KOG4222|consen  210 VGERESIPARLSVQEKPWFWKRPKDLAVLVGAAAEFDCRVGGDPQPTV  257 (1281)
T ss_pred             ccccccccceeeeccCCccccccccceeecccccccccccCCCCCCce
Confidence            355666677899999999998865555678999999999999999987


No 116
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=26.45  E-value=49  Score=18.48  Aligned_cols=20  Identities=0%  Similarity=-0.074  Sum_probs=15.9

Q ss_pred             hcCcCCCccceeeeEEEEee
Q psy15736         16 EEEPEKDKEEVRRRRRRNQK   35 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~   35 (70)
                      .|.++|....++..+.|+|+
T Consensus        56 ~C~A~N~~G~~~~~~~l~V~   75 (75)
T cd05763          56 SCTAQNTAGSISANATLTVL   75 (75)
T ss_pred             EEEEEcCCCEEEeeEEEEEC
Confidence            47788888888888888874


No 117
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=23.61  E-value=55  Score=20.17  Aligned_cols=20  Identities=15%  Similarity=0.260  Sum_probs=16.0

Q ss_pred             EEeccCCcEEEEEEEeeeCC
Q psy15736         47 VHSGEGYEAQLVCIVHAEPH   66 (70)
Q Consensus        47 Vha~~G~~a~L~CiV~A~P~   66 (70)
                      +....|..+.|.|...+..+
T Consensus         6 ~tv~~g~~v~L~C~~~s~~A   25 (85)
T cd05872           6 RTVAPGADVVLPCQLRSNLA   25 (85)
T ss_pred             EEEecCCCEEEECCCCCCCc
Confidence            45577999999999988644


No 118
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=23.14  E-value=1.2e+02  Score=23.96  Aligned_cols=30  Identities=13%  Similarity=0.237  Sum_probs=20.8

Q ss_pred             ecCCeEEEecceEEeccCCcEEEEEEEeeeCCCC
Q psy15736         35 KNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHAD   68 (70)
Q Consensus        35 ~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~   68 (70)
                      .-||.+.|-+.   ...+ .++|.|.+.++=++.
T Consensus       201 ~vpP~V~Vt~k---~~~~-~~tL~C~A~GFYP~~  230 (338)
T PHA02865        201 PVTPTVKVTGE---ELGD-NTTLFCTFDSHYPSS  230 (338)
T ss_pred             CCCCceEEecc---cCCC-CceEEEEEEeEeCCc
Confidence            45899988654   2224 789999999864443


No 119
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=23.09  E-value=62  Score=17.92  Aligned_cols=19  Identities=5%  Similarity=-0.156  Sum_probs=14.8

Q ss_pred             hcCcCCCccceeeeEEEEe
Q psy15736         16 EEEPEKDKEEVRRRRRRNQ   34 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V   34 (70)
                      .|.++|....++..+.|+|
T Consensus        56 ~C~a~N~~G~~~~~~~l~V   74 (74)
T cd05748          56 TLTLKNPAGEKSATINVKV   74 (74)
T ss_pred             EEEEECCCccEEEEEEEEC
Confidence            4777888888888888876


No 120
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=22.78  E-value=64  Score=17.37  Aligned_cols=20  Identities=5%  Similarity=-0.044  Sum_probs=15.6

Q ss_pred             hcCcCCCccceeeeEEEEee
Q psy15736         16 EEEPEKDKEEVRRRRRRNQK   35 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~   35 (70)
                      .|.+.|.-..+++.+.|.|.
T Consensus        52 ~C~a~N~~G~~~~~~~l~V~   71 (71)
T cd05731          52 RCTASNSLGSARHTISVTVE   71 (71)
T ss_pred             EEEEEeCCceEEEEEEEEEC
Confidence            47788888888888888773


No 121
>PF14699 hGDE_N:  N-terminal domain from the human glycogen debranching enzyme
Probab=21.70  E-value=63  Score=20.18  Aligned_cols=18  Identities=17%  Similarity=0.019  Sum_probs=15.4

Q ss_pred             ccceeeeEEEEeecCCeE
Q psy15736         23 KEEVRRRRRRNQKNLPEI   40 (70)
Q Consensus        23 ~~pvs~~I~L~V~ypPeI   40 (70)
                      ++++.+.+.|-+|||++=
T Consensus         8 ~S~~~r~g~l~tN~P~~g   25 (86)
T PF14699_consen    8 ASLIGRNGSLWTNYPPEG   25 (86)
T ss_pred             CcccCCceEEEEECCCCC
Confidence            378899999999999963


No 122
>PF08603 CAP_C:  Adenylate cyclase associated (CAP) C terminal;  InterPro: IPR013912  Cyclase-associated proteins (CAPs) are highly conserved actin-binding proteins present in a wide range of organisms including yeast, fly, plants, and mammals. CAPs are multifunctional proteins that contain several structural domains. CAP is involved in species-specific signalling pathways [, , , ]. In Drosophila, CAP functions in Hedgehog-mediated eye development and in establishing oocyte polarity. In Dictyostelium (slim mold), CAP is involved in microfilament reorganisation near the plasma membrane in a PIP2-regulated manner and is required to perpetuate the cAMP relay signal to organise fruitbody formation. In plants, CAP is involved in plant signalling pathways required for co-ordinated organ expansion. In yeast, CAP is involved in adenylate cyclase activation, as well as in vesicle trafficking and endocytosis. In both yeast and mammals, CAPs appear to be involved in recycling G-actin monomers from ADF/cofilins for subsequent rounds of filament assembly [, ]. In mammals, there are two different CAPs (CAP1 and CAP2) that share 64% amino acid identity.  All CAPs appear to contain a C-terminal actin-binding domain that regulates actin remodelling in response to cellular signals and is required for normal cellular morphology, cell division, growth and locomotion in eukaryotes. CAP directly regulates actin filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localisation and the establishment of cell polarity. Actin exists both as globular (G) (monomeric) actin subunits and assembled into filamentous (F) actin. In cells, actin cycles between these two forms. Proteins that bind F-actin often regulate F-actin assembly and its interaction with other proteins, while proteins that interact with G-actin often control the availability of unpolymerised actin. CAPs bind G-actin.  In addition to actin-binding, CAPs can have additional roles, and may act as bifunctional proteins. In Saccharomyces cerevisiae (Baker's yeast), CAP is a component of the adenylyl cyclase complex (Cyr1p) that serves as an effector of Ras during normal cell signalling. S. cerevisiae CAP functions to expose adenylate cyclase binding sites to Ras, thereby enabling adenylate cyclase to be activated by Ras regulatory signals. In Schizosaccharomyces pombe (Fission yeast), CAP is also required for adenylate cyclase activity, but not through the Ras pathway. In both organisms, the N-terminal domain is responsible for adenylate cyclase activation, but the S cerevisiae and S. pombe N-termini cannot complement one another. Yeast CAPs are unique among the CAP family of proteins, because they are the only ones to directly interact with and activate adenylate cyclase []. S. cerevisiae CAP has four major domains. In addition to the N-terminal adenylate cyclase-interacting domain, and the C-terminal actin-binding domain, it possesses two other domains: a proline-rich domain that interacts with Src homology 3 (SH3) domains of specific proteins, and a domain that is responsible for CAP oligomerisation to form multimeric complexes (although oligomerisation appears to involve the N- and C-terminal domains as well). The proline-rich domain interacts with profilin, a protein that catalyses nucleotide exchange on G-actin monomers and promotes addition to barbed ends of filamentous F-actin []. Since CAP can bind profilin via a proline-rich domain, and G-actin via a C-terminal domain, it has been suggested that a ternary G-actin/CAP/profilin complex could be formed. This entry represents the C-terminal domain of CAP proteins, which is responsible for G-actin-binding. This domain has a superhelical structure, where the superhelix turns are made of two beta-strands each []. ; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1K4Z_B 1KQ5_A 2B0R_A 1K8F_B.
Probab=21.51  E-value=2.3e+02  Score=19.78  Aligned_cols=34  Identities=9%  Similarity=0.038  Sum_probs=23.3

Q ss_pred             eeeEEEEeecCC-------eEEEecceEEeccCCcEEEEEE
Q psy15736         27 RRRRRRNQKNLP-------EIEVERSWVHSGEGYEAQLVCI   60 (70)
Q Consensus        27 s~~I~L~V~ypP-------eI~v~~~~Vha~~G~~a~L~Ci   60 (70)
                      ++.=.++|+||.       |..+|.|..|+-.|....=+..
T Consensus       116 skss~mNv~~p~~~~~D~~E~piPEQf~~~~~~~kl~t~~~  156 (159)
T PF08603_consen  116 SKSSEMNVNVPDGEDGDYVEHPIPEQFKTTIKGGKLVTEVV  156 (159)
T ss_dssp             ES-EEEEEEEECSCTTEEEEEEE--EEEEEECCTEEEEEEE
T ss_pred             EccccEEEEecCCCCCCceeCCCchhEEEEEECCEEEEEEE
Confidence            456679999998       7888999999887766544433


No 123
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=20.47  E-value=75  Score=17.51  Aligned_cols=19  Identities=5%  Similarity=-0.134  Sum_probs=13.9

Q ss_pred             hcCcCCCccceeeeEEEEe
Q psy15736         16 EEEPEKDKEEVRRRRRRNQ   34 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V   34 (70)
                      .|-+++....++.++.|+|
T Consensus        56 ~C~a~N~~G~~~~~~~l~v   74 (74)
T cd05764          56 TCIASNAAGEATATVELHI   74 (74)
T ss_pred             EEEEECCCCeEEEEEEEEC
Confidence            4667777777788887775


Done!