Diaphorina citri psyllid: psy15740


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MRNVPQFPKSRFRVLSPKSDNYFQLPLCLGNLYKVMRKKGLIERLTCFRQFKFLLFVLHSWASDDWAKGVAKIKYTYTIELRDKGNYGFLLPASHILPVGRESLAAIKAIAREF
ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccEEEEcEEEEEEEcccccHHHHcccccccEEEEEEECccccccccccccccccHHHHHHHHHHHHHHHc
***VPQFPKSRFRVLSPKSDNYFQLPLCLGNLYKVMRKKGLIERLTCFRQFKFLLFVLHSWASDDWAKGVAKIKYTYTIELRDKGNYGFLLPASHILPVGRESLAAIKAIAREF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNVPQFPKSRFRVLSPKSDNYFQLPLCLGNLYKVMRKKGLIERLTCFRQFKFLLFVLHSWASDDWAKGVAKIKYTYTIELRDKGNYGFLLPASHILPVGRESLAAIKAIAREF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carboxypeptidase B confidentP55261
Carboxypeptidase B2 Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities. Down-regulates fibrinolysis by removing C-terminal lysine residues from fibrin that has already been partially degraded by plasmin.confidentQ9JHH6
Carboxypeptidase B2 Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities. Down-regulates fibrinolysis by removing C-terminal lysine residues from fibrin that has already been partially degraded by plasmin.confidentQ9EQV9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004181 [MF]metallocarboxypeptidase activityprobableGO:0016787, GO:0003824, GO:0004180, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0051918 [BP]negative regulation of fibrinolysisprobableGO:0050820, GO:0050818, GO:0051240, GO:0032101, GO:0048583, GO:1900046, GO:0080134, GO:0051917, GO:0061041, GO:0065007, GO:0008150, GO:0051239, GO:0048518, GO:0030193, GO:0048519, GO:1900048, GO:0050789, GO:0030194
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BO9, chain A
Confidence level:very confident
Coverage over the Query: 12-114
View the alignment between query and template
View the model in PyMOL