Diaphorina citri psyllid: psy15746

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760

MKDNDKKVFSEKFSLINECAVEDISLDVFYKPHTIAALLCSIFGVIVASFIRNEDVSETDNIWAGLIAVIFFLLLISTLAFPNGPFTRPHPAVWRMVFGLSIFYLLALLFLLFQNYETAICRNEDVSETDNIWAGLIAVIFFLLLISTLAFPNGPFTRPHPAVWRMVFGLSIFYLLALLFLLFQNYETANLRILFFGNYPKKRTHIFEMPPSHPIVIIRLSFLGIMVAPSARIDMDKEYGVNCSDISLEKIYNHLDVFALGHFVGWAFKAVLIRHMGILWAMSVMWEFTEIAFAHLLPNFIECWWDALILDILLCNGIGIWVGLKLCKWFEMREYKWVSIKDIHSTSGKLKRAMLQFTPQSWTHVRWLDPTCTYMRFIGVCQMVLFWQLSELNTFFLKHIFEMPPSHPIVIIRLSFLGIMVAPSARQYYSFVTDTQCKRLGTQCWIYGAIQLTEALLCIKNGKLLFGRTQAVNILAWLSVMFLLAVLCVYGCVLWHRYVSVMFFYCPYFDRQYYSFVTDTQCKRLGTQCWIYGAIQLTEALLCIKNGKLLFGRTQAVNILAWLSVMFLLAVLCVYGCVLWHRYVSILKYRQYYSFVTDTQCKRLGTQCWIYGAIQLTEALLCIKNGKLLFGRTQAVNILAWLSVMFLLAVLCVYGCVLWHRYVSEILETVVTKKPNRPQRRNEDVFTVFFSKSNNFRIDMDKEYGVNCSDISLEKIYNHLDVFALGHFVGWAFKAVLIRHMGILWAMSVMWEFTEFIIIN

cccccccccccccccccccccccccccEECcHHHHHHHHHHHHHHHHHHEECcccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEEEEccccccccccccEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEcEEEEEECccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

********FSEKFSLINECAVEDISLDVFYKPHTIAALLCSIFGVIVASFIRNEDVSETDNIWAGLIAVIFFLLLISTLAFPNGPFTRPHPAVWRMVFGLSIFYLLALLFLLFQNYETAICRNEDVSETDNIWAGLIAVIFFLLLISTLAFPNGPFTRPHPAVWRMVFGLSIFYLLALLFLLFQNYETANLRILFFGNYPKKRTHIFEMPPSHPIVIIRLSFLGIMVAPSARIDMDKEYGVNCSDISLEKIYNHLDVFALGHFVGWAFKAVLIRHMGILWAMSVMWEFTEIAFAHLLPNFIECWWDALILDILLCNGIGIWVGLKLCKWFEMREYKWVSIKDIHSTSGKLKRAMLQFTPQSWTHVRWLDPTCTYMRFIGVCQMVLFWQLSELNTFFLKHIFEMPPSHPIVIIRLSFLGIMVAPSARQYYSFVTDTQCKRLGTQCWIYGAIQLTEALLCIKNGKLLFGRTQAVNILAWLSVMFLLAVLCVYGCVLWHRYVSVMFFYCPYFDRQYYSFVTDTQCKRLGTQCWIYGAIQLTEALLCIKNGKLLFGRTQAVNILAWLSVMFLLAVLCVYGCVLWHRYVSILKYRQYYSFVTDTQCKRLGTQCWIYGAIQLTEALLCIKNGKLLFGRTQAVNILAWLSVMFLLAVLCVYGCVLWHRYVSEILETVVTK***RPQRRNEDVFTVFFSKSNNFRIDMDKEYGVNCSDISLEKIYNHLDVFALGHFVGWAFKAVLIRHMGILWAMSVMWEFTEFIIIN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHxxxHHHHHHHHHHHHHHHHHxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phosphatidylserine synthase 1	Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.	confident	Q00576

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted