BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15747
(224 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3SJU|A Chain A, Hedamycin Polyketide Ketoreductase Bound To Nadph
pdb|3SJU|B Chain B, Hedamycin Polyketide Ketoreductase Bound To Nadph
Length = 279
Score = 30.8 bits (68), Expect = 0.56, Method: Compositional matrix adjust.
Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
Query: 16 DALILDILLCNGIGIW-VGLKLCKWFEMREYKWVSIKDIHSTSGKAKAGHASP 67
DAL D+L N G++ V ++ + MRE W I +I ST GK +A+P
Sbjct: 122 DALWADVLDTNLTGVFRVTREVLRAGGMREAGWGRIVNIASTGGKQGVMYAAP 174
>pdb|3GR0|A Chain A, Periplasmic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-362)
pdb|3GR0|B Chain B, Periplasmic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-362)
pdb|3GR0|C Chain C, Periplasmic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-362)
pdb|3GR0|D Chain D, Periplasmic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-362)
Length = 197
Score = 30.8 bits (68), Expect = 0.62, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%)
Query: 79 WLD---PTCTYMRIHWCVPKMVLFWQLSELNTFFLKHI 113
WLD P Y RIH+ P+ +FW + NT K +
Sbjct: 70 WLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKEL 107
>pdb|2Y9J|A Chain A, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|B Chain B, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|C Chain C, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|D Chain D, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|E Chain E, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|F Chain F, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|G Chain G, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|H Chain H, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|I Chain I, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|J Chain J, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|K Chain K, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|L Chain L, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|M Chain M, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|N Chain N, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|O Chain O, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|P Chain P, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|Q Chain Q, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|R Chain R, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|S Chain S, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|T Chain T, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|U Chain U, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|V Chain V, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|W Chain W, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
pdb|2Y9J|X Chain X, Three-Dimensional Model Of Salmonella's Needle Complex At
Subnanometer Resolution
Length = 186
Score = 30.8 bits (68), Expect = 0.63, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%)
Query: 79 WLD---PTCTYMRIHWCVPKMVLFWQLSELNTFFLKHI 113
WLD P Y RIH+ P+ +FW + NT K +
Sbjct: 59 WLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKEL 96
>pdb|3GR1|A Chain A, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
pdb|3GR1|B Chain B, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
pdb|3GR1|C Chain C, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
pdb|3GR1|D Chain D, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
pdb|3GR1|E Chain E, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
pdb|3GR1|F Chain F, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
pdb|3GR1|G Chain G, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
pdb|3GR1|H Chain H, Periplamic Domain Of The T3ss Inner Membrane Protein Prgh
From S.Typhimurium (Fragment 170-392)
Length = 227
Score = 30.8 bits (68), Expect = 0.70, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 3/38 (7%)
Query: 79 WLD---PTCTYMRIHWCVPKMVLFWQLSELNTFFLKHI 113
WLD P Y RIH+ P+ +FW + NT K +
Sbjct: 70 WLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKEL 107
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.330 0.141 0.498
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,926,239
Number of Sequences: 62578
Number of extensions: 262966
Number of successful extensions: 616
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 615
Number of HSP's gapped (non-prelim): 5
length of query: 224
length of database: 14,973,337
effective HSP length: 95
effective length of query: 129
effective length of database: 9,028,427
effective search space: 1164667083
effective search space used: 1164667083
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 49 (23.5 bits)