BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15749
         (164 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1KN9|A Chain A, Crystal Structure Of A Bacterial Signal Peptidase Apo-
          Enzyme, Implications For Signal Peptide Binding And The
          Ser-Lys Dyad Mechanism.
 pdb|1KN9|B Chain B, Crystal Structure Of A Bacterial Signal Peptidase Apo-
          Enzyme, Implications For Signal Peptide Binding And The
          Ser-Lys Dyad Mechanism.
 pdb|1KN9|C Chain C, Crystal Structure Of A Bacterial Signal Peptidase Apo-
          Enzyme, Implications For Signal Peptide Binding And The
          Ser-Lys Dyad Mechanism.
 pdb|1KN9|D Chain D, Crystal Structure Of A Bacterial Signal Peptidase Apo-
          Enzyme, Implications For Signal Peptide Binding And The
          Ser-Lys Dyad Mechanism.
 pdb|3IIQ|A Chain A, Crystallographic Analysis Of Bacterial Signal Peptidase
          In Ternary Complex With Arylomycin A2 And A Beta-Sultam
          Inhibitor
 pdb|3IIQ|B Chain B, Crystallographic Analysis Of Bacterial Signal Peptidase
          In Ternary Complex With Arylomycin A2 And A Beta-Sultam
          Inhibitor
          Length = 249

 Score = 33.1 bits (74), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 62 QRGDIVSLVSPKDPGQKIIKRIVGVEGDVVS 92
          +RGDIV    P+DP    IKR VG+ GD V+
Sbjct: 52 KRGDIVVFKYPEDPKLDYIKRAVGLPGDKVT 82


>pdb|1T7D|A Chain A, Crystal Structure Of Escherichia Coli Type I Signal
          Peptidase In Complex With A Lipopeptide Inhibitor
 pdb|1T7D|B Chain B, Crystal Structure Of Escherichia Coli Type I Signal
          Peptidase In Complex With A Lipopeptide Inhibitor
 pdb|3S04|A Chain A, Crystal Structure Of Escherichia Coli Type I Signal
          Peptidase In Complex With An Arylomycin
          Lipoglycopeptide Antibiotic
 pdb|3S04|B Chain B, Crystal Structure Of Escherichia Coli Type I Signal
          Peptidase In Complex With An Arylomycin
          Lipoglycopeptide Antibiotic
          Length = 250

 Score = 33.1 bits (74), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 62 QRGDIVSLVSPKDPGQKIIKRIVGVEGDVVS 92
          +RGDIV    P+DP    IKR VG+ GD V+
Sbjct: 53 KRGDIVVFKYPEDPKLDYIKRAVGLPGDKVT 83


>pdb|1B12|A Chain A, Crystal Structure Of Type 1 Signal Peptidase From
          Escherichia Coli In Complex With A Beta-Lactam
          Inhibitor
 pdb|1B12|B Chain B, Crystal Structure Of Type 1 Signal Peptidase From
          Escherichia Coli In Complex With A Beta-Lactam
          Inhibitor
 pdb|1B12|C Chain C, Crystal Structure Of Type 1 Signal Peptidase From
          Escherichia Coli In Complex With A Beta-Lactam
          Inhibitor
 pdb|1B12|D Chain D, Crystal Structure Of Type 1 Signal Peptidase From
          Escherichia Coli In Complex With A Beta-Lactam
          Inhibitor
          Length = 248

 Score = 33.1 bits (74), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 62 QRGDIVSLVSPKDPGQKIIKRIVGVEGDVVS 92
          +RGDIV    P+DP    IKR VG+ GD V+
Sbjct: 51 KRGDIVVFKYPEDPKLDYIKRAVGLPGDKVT 81


>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex
           Aeolicus Vf5
 pdb|2PCJ|B Chain B, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex
           Aeolicus Vf5
 pdb|2PCL|A Chain A, Crystal Structure Of Abc Transporter With Complex (Aq_297)
           From Aquifex Aeolicus Vf5
          Length = 224

 Score = 28.1 bits (61), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 15/72 (20%)

Query: 53  IIKGDDIGLQRGDIVSLVSPKDPGQKIIKRIVGVEGDVVSTLDYKSNVVKVP-QGHIWVE 111
           I+KG  + +++G+ VS              I+G  G   STL Y   ++  P +G +++E
Sbjct: 19  ILKGISLSVKKGEFVS--------------IIGASGSGKSTLLYILGLLDAPTEGKVFLE 64

Query: 112 GDHVGHSMDSNM 123
           G  V ++ +  +
Sbjct: 65  GKEVDYTNEKEL 76


>pdb|1C3Q|A Chain A, Crystal Structure Of Native Thiazole Kinase In The
           Monoclinic Form
 pdb|1C3Q|B Chain B, Crystal Structure Of Native Thiazole Kinase In The
           Monoclinic Form
 pdb|1C3Q|C Chain C, Crystal Structure Of Native Thiazole Kinase In The
           Monoclinic Form
          Length = 284

 Score = 27.7 bits (60), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 47  VFLNRWIIKGDDIGLQRGDIVSLVSPKDPGQKIIKRIVGVEGDVVSTLDYKSNVVKVPQG 106
           V +  W+IKG D G   GDI+ L   +   QK +  ++ + G+V    D  S+V  +  G
Sbjct: 143 VGVTDWLIKGVDAGEGGGDIIRL--AQQAAQK-LNTVIAITGEVDVIAD-TSHVYTLHNG 198

Query: 107 H 107
           H
Sbjct: 199 H 199


>pdb|1ESJ|A Chain A, Crystal Structure Of Thiazole Kinase Mutant (C198s)
 pdb|1ESJ|B Chain B, Crystal Structure Of Thiazole Kinase Mutant (C198s)
 pdb|1ESJ|C Chain C, Crystal Structure Of Thiazole Kinase Mutant (C198s)
 pdb|1ESQ|A Chain A, Crystal Structure Of Thiazole Kinase Mutant (C198s) With
           Atp And Thiazole Phosphate.
 pdb|1ESQ|B Chain B, Crystal Structure Of Thiazole Kinase Mutant (C198s) With
           Atp And Thiazole Phosphate.
 pdb|1ESQ|C Chain C, Crystal Structure Of Thiazole Kinase Mutant (C198s) With
           Atp And Thiazole Phosphate
          Length = 284

 Score = 27.3 bits (59), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 47  VFLNRWIIKGDDIGLQRGDIVSLVSPKDPGQKIIKRIVGVEGDVVSTLDYKSNVVKVPQG 106
           V +  W+IKG D G   GDI+ L   +   QK +  ++ + G+V    D  S+V  +  G
Sbjct: 143 VGVTDWLIKGVDAGEGGGDIIRL--AQQAAQK-LNTVIAITGEVDVIAD-TSHVYTLHNG 198

Query: 107 H 107
           H
Sbjct: 199 H 199


>pdb|1EKK|A Chain A, Crystal Structure Of Hydroxyethylthiazole Kinase In The R3
           Form With Hydroxyethylthiazole
 pdb|1EKK|B Chain B, Crystal Structure Of Hydroxyethylthiazole Kinase In The R3
           Form With Hydroxyethylthiazole
 pdb|1EKQ|A Chain A, Crystal Structure Of Hydroxyethylthiazole Kinase In R3
           Space Group
 pdb|1EKQ|B Chain B, Crystal Structure Of Hydroxyethylthiazole Kinase In R3
           Space Group
          Length = 272

 Score = 27.3 bits (59), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 52  WIIKGDDIGLQRGDIVSLVSPKDPGQKIIKRIVGVEGDVVSTLDYKSNVVKVPQGH 107
           W+IKG D G   GDI+ L   +   QK +  ++ + G+V    D  S+V  +  GH
Sbjct: 136 WLIKGVDAGEGGGDIIRL--AQQAAQK-LNTVIAITGEVDVIAD-TSHVYTLHNGH 187


>pdb|2VKZ|G Chain G, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid
            Synthase Type I Multienzyme Complex
 pdb|2VKZ|H Chain H, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid
            Synthase Type I Multienzyme Complex
 pdb|2VKZ|I Chain I, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid
            Synthase Type I Multienzyme Complex
 pdb|3HMJ|G Chain G, Saccharomyces Cerevisiae Fas Type I
 pdb|3HMJ|H Chain H, Saccharomyces Cerevisiae Fas Type I
 pdb|3HMJ|I Chain I, Saccharomyces Cerevisiae Fas Type I
 pdb|2UV8|G Chain G, Crystal Structure Of Yeast Fatty Acid Synthase With Stalled
            Acyl Carrier Protein At 3.1 Angstrom Resolution
 pdb|2UV8|H Chain H, Crystal Structure Of Yeast Fatty Acid Synthase With Stalled
            Acyl Carrier Protein At 3.1 Angstrom Resolution
 pdb|2UV8|I Chain I, Crystal Structure Of Yeast Fatty Acid Synthase With Stalled
            Acyl Carrier Protein At 3.1 Angstrom Resolution
          Length = 2051

 Score = 26.9 bits (58), Expect = 5.2,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 12/88 (13%)

Query: 24   YVARVDGTSMQPVFNPDRNHQDYVFLNRW--IIKGDDIGLQRGDIVSLVSPKDPGQKIIK 81
            +V+R D T + P+        D+  +  W  IIK        GD++ LV   + G K+I 
Sbjct: 1311 FVSRPDRTMLAPM--------DFAIVVGWRAIIKAIFPNTVDGDLLKLVHLSN-GYKMIP 1361

Query: 82   RIVGVE-GDVVSTLDYKSNVVKVPQGHI 108
                ++ GDVVST     +VV  P G I
Sbjct: 1362 GAKPLQVGDVVSTTAVIESVVNQPTGKI 1389


>pdb|2BUK|A Chain A, Satellite Tobacco Necrosis Virus
 pdb|1VTZ|EE Chain e, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|FF Chain f, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|GG Chain g, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|HH Chain h, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|II Chain i, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|JJ Chain j, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|KK Chain k, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|LL Chain l, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|MM Chain m, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|NN Chain n, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|OO Chain o, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|PP Chain p, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|QQ Chain q, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|RR Chain r, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|SS Chain s, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|TT Chain t, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|UU Chain u, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|VV Chain v, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|WW Chain w, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|XX Chain x, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|YY Chain y, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|ZZ Chain z, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|0 Chain 0, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|1 Chain 1, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|2 Chain 2, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|3 Chain 3, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|4 Chain 4, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|5 Chain 5, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|6 Chain 6, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|1VTZ|7 Chain 7, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 3rqv)
 pdb|3RQV|A Chain A, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|B Chain B, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|C Chain C, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|D Chain D, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|E Chain E, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|F Chain F, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|G Chain G, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|H Chain H, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|I Chain I, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|J Chain J, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|K Chain K, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|L Chain L, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|M Chain M, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|N Chain N, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|O Chain O, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|P Chain P, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|Q Chain Q, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|R Chain R, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|S Chain S, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|T Chain T, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|U Chain U, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|V Chain V, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|W Chain W, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|X Chain X, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|Y Chain Y, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|Z Chain Z, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|AA Chain a, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|BB Chain b, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|CC Chain c, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3RQV|DD Chain d, 1.45 Angstrom Structure Of Stnv Coat Protein (Half Of
          The Capsid, The Other Half In Pdb 1vtz)
 pdb|3S4G|A Chain A, Low Resolution Structure Of Stnv Complexed With Rna
 pdb|4BCU|A Chain A, Satellite Tobacco Necrosis Virus (stnv) Virus Like
          Particle In Complex With The B3 Aptamer
          Length = 196

 Score = 26.2 bits (56), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 49 LNRWIIKGDDIGLQRGDIVSLVSPK 73
          L+  II+GDDI  + GD V +VS K
Sbjct: 48 LSNGIIQGDDINQRSGDQVRIVSHK 72


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.139    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,177,598
Number of Sequences: 62578
Number of extensions: 214444
Number of successful extensions: 498
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 490
Number of HSP's gapped (non-prelim): 15
length of query: 164
length of database: 14,973,337
effective HSP length: 91
effective length of query: 73
effective length of database: 9,278,739
effective search space: 677347947
effective search space used: 677347947
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)