Diaphorina citri psyllid: psy15755


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510------
MFSRPKHFPPGPSLWFPYYGHFLSILFLHYHHTHKALAKMCRIYKSKILGFYLGPFPTVVASDEKSIRELLMKPQFQGRIDQVVSLVRVDFGEERGIIFTEGDLWQQQKRFFLRHLRDHGFGKRSEPLEVQLAAEIQDLITFLREERNHPAYQNGLALIPSIFAWGNIALLMSALTGEKFTGREGKDTLSDIHWNALNFQFYTEPLAGTLTFVPFAKYLPPFFGYMKDITRLNDNLANYAKFYTEPLAGTLTFVPFAKYLPPFFGYMKDITRLNDNLANYAKNSIRKKMDSFNEDTINSAVDAYIKMMKEAQADGDRETYFTEEQLKLVIQDFTFPASNTISGQLGFLWQQFLLHPEVQTKIQEELDRVVGRSELPNLNHRAELHYTEATIREIMRYKTLVPLSVPHKATEDANFMGYHVEKGTIMVPSLYCLHNDPDIWGDPENFRPERFLDSNGQLKKKDRTLPFGFGKRLCPGETFARQNMFMYVAGLLQNFTFSLPEGAKLPDDSKYIPGLN
ccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHccccEEEEEEccccEEEEEcHHHHHHHHcccccccccccHHHHHHHccccccCEEccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEcccHHHHcccccccccccccccccccccccccccccCCcccccccccccHHHHHHHHHHHHHHHHHcEEEEcccccccccccccccccc
****PKHFPPGPSLWFPYYGHFLSILFLHYHHTHKALAKMCRIYKSKILGFYLGPFPTVVASDEKSIRELLMKPQFQGRIDQVVSLVRVDFGEERGIIFTEGDLWQQQKRFFLRHLRDHGFGKRSEPLEVQLAAEIQDLITFLREERNHPAYQNGLALIPSIFAWGNIALLMSALTGEKFTGREGKDTLSDIHWNALNFQFYTEPLAGTLTFVPFAKYLPPFFGYMKDITRLNDNLANYAKFYTEPLAGTLTFVPFAKYLPPFFGYMKDITRLNDNLANYAKNSIRKKMDSFNEDTINSAVDAYIKMMKE****GDRETYFTEEQLKLVIQDFTFPASNTISGQLGFLWQQFLLHPEVQTKIQEELDRVVGRSELPNLNHRAELHYTEATIREIMRYKTLVPLSVPHKATEDANFMGYHVEKGTIMVPSLYCLHNDPDIWGDPENFRPERFLDSNGQLKKKDRTLPFGFGKRLCPGETFARQNMFMYVAGLLQNFTFSLPE******DSKYIPGL*
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSRPKHFPPGPSLWFPYYGHFLSILFLHYHHTHKALAKMCRIYKSKILGFYLGPFPTVVASDEKSIRELLMKPQFQGRIDQVVSLVRVDFGEERGIIFTEGDLWQQQKRFFLRHLRDHGFGKRSEPLEVQLAAEIQDLITFLREERNHPAYQNGLALIPSIFAWGNIALLMSALTGEKFTGREGKDTLSDIHWNALNFQFYTEPLAGTLTFVPFAKYLPPFFGYMKDITRLNDNLANYAKFYTEPLAGTLTFVPFAKYLPPFFGYMKDITRLNDNLANYAKNSIRKKMDSFNEDTINSAVDAYIKMMKEAQADGDRETYFTEEQLKLVIQDFTFPASNTISGQLGFLWQQFLLHPEVQTKIQEELDRVVGRSELPNLNHRAELHYTEATIREIMRYKTLVPLSVPHKATEDANFMGYHVEKGTIMVPSLYCLHNDPDIWGDPENFRPERFLDSNGQLKKKDRTLPFGFGKRLCPGETFARQNMFMYVAGLLQNFTFSLPEGAKLPDDSKYIPGLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 2U1 Catalyzes the hydroxylation of arachidonic acid, docosahexaenoic acid and other long chain fatty acids. May modulate the arachidonic acid signaling pathway and play a role in other fatty acid signaling processes.confidentQ4V8D1
Probable cytochrome P450 304a1 May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.confidentQ9VG17
Cytochrome P450 2U1 Catalyzes the hydroxylation of arachidonic acid, docosahexaenoic acid and other long chain fatty acids. May modulate the arachidonic acid signaling pathway and play a role in other fatty acid signaling processes.confidentQ0IIF9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046483 [BP]heterocycle metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0070989 [BP]oxidative demethylationprobableGO:0070988, GO:0044710, GO:0008150, GO:0008152, GO:0055114
GO:0016098 [BP]monoterpenoid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006721, GO:0006720, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255
GO:0009410 [BP]response to xenobiotic stimulusprobableGO:0042221, GO:0050896, GO:0008150
GO:0042738 [BP]exogenous drug catabolic processprobableGO:0042737, GO:0050896, GO:0009987, GO:0042493, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0042221, GO:0017144, GO:0009056
GO:0019369 [BP]arachidonic acid metabolic processprobableGO:0044238, GO:0006631, GO:0008152, GO:0006082, GO:0071704, GO:1901568, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0006690, GO:0008150, GO:0044237, GO:0043436, GO:0001676, GO:0044255, GO:0033559, GO:0044281, GO:0006629
GO:0020037 [MF]heme bindingprobableGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0009404 [BP]toxin metabolic processprobableGO:0044710, GO:0019748, GO:0009987, GO:0044237, GO:0008150, GO:0008152
GO:0034875 [MF]caffeine oxidase activityprobableGO:0033695, GO:0003824, GO:0003674, GO:0016725, GO:0016491
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0008395 [MF]steroid hydroxylase activityprobableGO:0003824, GO:0004497, GO:0003674, GO:0016491
GO:0008392 [MF]arachidonic acid epoxygenase activityprobableGO:0004497, GO:0016705, GO:0003824, GO:0003674, GO:0008391, GO:0016491
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006725 [BP]cellular aromatic compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0016712 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PM0, chain A
Confidence level:very confident
Coverage over the Query: 31-199,233-505
View the alignment between query and template
View the model in PyMOL
Template: 2PG6, chain A
Confidence level:confident
Coverage over the Query: 8-203,237-509
View the alignment between query and template
View the model in PyMOL
Template: 2Q6N, chain A
Confidence level:confident
Coverage over the Query: 24-148,169-171,194-500
View the alignment between query and template
View the model in PyMOL