BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15782
(129 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human
Snrnp Core Domain
pdb|3CW1|B Chain B, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|M Chain M, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|N Chain N, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|O Chain O, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|X Chain X, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|U Chain U, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|A Chain A, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|A Chain A, Macromolecular Machine 6
pdb|4F7U|C Chain C, Macromolecular Machine 6
pdb|1VU2|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|1VU2|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|1VU2|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|1VU2|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|1VU2|WW Chain w, The 8s Snrnp Assembly Intermediate
pdb|1VU3|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|1VU3|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|1VU3|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|1VU3|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|4F77|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|4F77|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|4F77|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|4F77|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|4F77|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|4F77|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|4F77|WW Chain w, The 8s Snrnp Assembly Intermediate
Length = 119
Score = 141 bits (356), Expect = 9e-35, Method: Compositional matrix adjust.
Identities = 65/88 (73%), Positives = 78/88 (88%)
Query: 1 MNFLMKLSHETVTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGN 60
+ FLMKLSHETVTIELKNGTQVHGTI GVDV+MNTHLK VKMT+K +EP L+++S+RGN
Sbjct: 4 VRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGN 63
Query: 61 NIRYYILPDSLPLETLLIDDAPRSKGKR 88
NIRY+ILPDSLPL+TLL+D P+ K K+
Sbjct: 64 NIRYFILPDSLPLDTLLVDVEPKVKSKK 91
>pdb|3PGW|Z Chain Z, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|W Chain W, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
Length = 126
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 4/71 (5%)
Query: 5 MKLSHET----VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGN 60
+K+ HE VT E G G + + MN + + +T + L+ + +RG+
Sbjct: 7 IKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGS 66
Query: 61 NIRYYILPDSL 71
IR+ ILPD L
Sbjct: 67 KIRFLILPDML 77
>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|E Chain E, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|Q Chain Q, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|T Chain T, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
Length = 77
Score = 37.0 bits (84), Expect = 0.003, Method: Compositional matrix adjust.
Identities = 20/62 (32%), Positives = 30/62 (48%)
Query: 3 FLMKLSHETVTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNI 62
FL K+ + V I L +G G + +D MN L+ + V GK+ +RGNN+
Sbjct: 10 FLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNV 69
Query: 63 RY 64
Y
Sbjct: 70 LY 71
>pdb|3CW1|D Chain D, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|S Chain S, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|T Chain T, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|U Chain U, Crystal Structure Of Human Spliceosomal U1 Snrnp
Length = 126
Score = 36.6 bits (83), Expect = 0.003, Method: Compositional matrix adjust.
Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 4/71 (5%)
Query: 5 MKLSHET----VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGN 60
+K+ HE VT E G G + + MN + + +T + L+ + +RG
Sbjct: 7 IKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGC 66
Query: 61 NIRYYILPDSL 71
IR+ ILPD L
Sbjct: 67 KIRFLILPDML 77
>pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|C Chain C, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|E Chain E, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|G Chain G, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|I Chain I, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|K Chain K, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
Length = 75
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 4/69 (5%)
Query: 5 MKLSHET----VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGN 60
+K+ HE VT E G G + + MN + + +T + L+ + +RG
Sbjct: 7 IKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGC 66
Query: 61 NIRYYILPD 69
IR+ ILPD
Sbjct: 67 KIRFLILPD 75
>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567
Length = 75
Score = 34.3 bits (77), Expect = 0.018, Method: Compositional matrix adjust.
Identities = 19/62 (30%), Positives = 29/62 (46%)
Query: 3 FLMKLSHETVTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNI 62
FL K+ + V I L +G G + +D N L+ + V GK+ +RGNN+
Sbjct: 8 FLNKVIGKKVLIRLSSGVDYKGILSCLDGYXNLALERTEEYVNGKKTNVYGDAFIRGNNV 67
Query: 63 RY 64
Y
Sbjct: 68 LY 69
>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4
pdb|4EMH|B Chain B, Crystal Structure Of Splsm4
pdb|4EMH|C Chain C, Crystal Structure Of Splsm4
pdb|4EMH|D Chain D, Crystal Structure Of Splsm4
pdb|4EMH|E Chain E, Crystal Structure Of Splsm4
pdb|4EMH|F Chain F, Crystal Structure Of Splsm4
pdb|4EMH|G Chain G, Crystal Structure Of Splsm4
pdb|4EMH|H Chain H, Crystal Structure Of Splsm4
pdb|4EMH|I Chain I, Crystal Structure Of Splsm4
pdb|4EMH|J Chain J, Crystal Structure Of Splsm4
pdb|4EMH|K Chain K, Crystal Structure Of Splsm4
pdb|4EMH|L Chain L, Crystal Structure Of Splsm4
pdb|4EMH|M Chain M, Crystal Structure Of Splsm4
pdb|4EMH|N Chain N, Crystal Structure Of Splsm4
pdb|4EMH|O Chain O, Crystal Structure Of Splsm4
pdb|4EMH|P Chain P, Crystal Structure Of Splsm4
pdb|4EMH|Q Chain Q, Crystal Structure Of Splsm4
pdb|4EMH|R Chain R, Crystal Structure Of Splsm4
pdb|4EMH|T Chain T, Crystal Structure Of Splsm4
pdb|4EMH|U Chain U, Crystal Structure Of Splsm4
pdb|4EMH|V Chain V, Crystal Structure Of Splsm4
pdb|4EMH|W Chain W, Crystal Structure Of Splsm4
pdb|4EMH|X Chain X, Crystal Structure Of Splsm4
pdb|4EMH|Y Chain Y, Crystal Structure Of Splsm4
Length = 105
Score = 34.3 bits (77), Expect = 0.018, Method: Compositional matrix adjust.
Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTV-KGKEPTTLDSISLRGNNIRYYILPDS 70
+ +ELKNG +G ++ D N L+ V T G + L +RGNNI+Y + D
Sbjct: 29 ILVELKNGETFNGHLENCDNYXNLTLREVIRTXPDGDKFFRLPECYIRGNNIKYLRIQDE 88
Query: 71 L 71
+
Sbjct: 89 V 89
>pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|B Chain B, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|C Chain C, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|D Chain D, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|E Chain E, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|F Chain F, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|G Chain G, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|H Chain H, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|I Chain I, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|J Chain J, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|K Chain K, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|L Chain L, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|M Chain M, Crystal Structure Of Yeast Smf In Spacegroup P43212
pdb|1N9S|N Chain N, Crystal Structure Of Yeast Smf In Spacegroup P43212
Length = 93
Score = 34.3 bits (77), Expect = 0.019, Method: Compositional matrix adjust.
Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
Query: 3 FLMKLSHETVTIELK-NGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNN 61
FL L + V ++LK N T+ GT+ D N L + V G TL I +R NN
Sbjct: 25 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNN 84
Query: 62 IRY 64
+ Y
Sbjct: 85 VLY 87
>pdb|1N9R|A Chain A, Crystal Structure Of A Heptameric Ring Complex Of Yeast
Smf In Spacegroup P4122
pdb|1N9R|B Chain B, Crystal Structure Of A Heptameric Ring Complex Of Yeast
Smf In Spacegroup P4122
pdb|1N9R|C Chain C, Crystal Structure Of A Heptameric Ring Complex Of Yeast
Smf In Spacegroup P4122
pdb|1N9R|D Chain D, Crystal Structure Of A Heptameric Ring Complex Of Yeast
Smf In Spacegroup P4122
pdb|1N9R|E Chain E, Crystal Structure Of A Heptameric Ring Complex Of Yeast
Smf In Spacegroup P4122
pdb|1N9R|F Chain F, Crystal Structure Of A Heptameric Ring Complex Of Yeast
Smf In Spacegroup P4122
pdb|1N9R|G Chain G, Crystal Structure Of A Heptameric Ring Complex Of Yeast
Smf In Spacegroup P4122
Length = 93
Score = 33.9 bits (76), Expect = 0.022, Method: Compositional matrix adjust.
Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
Query: 3 FLMKLSHETVTIELK-NGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNN 61
FL L + V ++LK N T+ GT+ D N L + V G TL I +R NN
Sbjct: 25 FLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNN 84
Query: 62 IRY 64
+ Y
Sbjct: 85 VLY 87
>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
Archaeoglobus Fulgidus At 1.95a Resolution
Length = 77
Score = 33.5 bits (75), Expect = 0.030, Method: Compositional matrix adjust.
Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
Query: 12 VTIELKNG-TQVHGTIQGVDVAMNTHLKTVKMTVKGKEPT-TLDSISLRGNNI 62
+ +E+K Q+ G ++GVD MN +L T M KG+E +L I LRGNN+
Sbjct: 18 IRVEMKGEENQLVGKLEGVDDYMNLYL-TNAMECKGEEKVRSLGEIVLRGNNV 69
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
Length = 77
Score = 31.2 bits (69), Expect = 0.18, Method: Compositional matrix adjust.
Identities = 15/53 (28%), Positives = 27/53 (50%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNIRY 64
V + LK G + GT+ G D+ MN L + G+ + S+ +RG+ + +
Sbjct: 17 VIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRGDTVVF 69
>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
Length = 75
Score = 30.4 bits (67), Expect = 0.28, Method: Compositional matrix adjust.
Identities = 15/51 (29%), Positives = 25/51 (49%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNI 62
V + LK G + G + G D+ +N L +M G+ I +RG+N+
Sbjct: 17 VLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNV 67
>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
Length = 77
Score = 30.4 bits (67), Expect = 0.31, Method: Compositional matrix adjust.
Identities = 15/51 (29%), Positives = 25/51 (49%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNI 62
V + LK G + G + G D+ +N L +M G+ I +RG+N+
Sbjct: 19 VLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNV 69
>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|G Chain G, Macromolecular Machine 6
pdb|4F7U|J Chain J, Macromolecular Machine 6
pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
Length = 76
Score = 29.6 bits (65), Expect = 0.44, Method: Compositional matrix adjust.
Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
Query: 4 LMKLSHETVTIELKNGTQVHGTIQGVDVAMNTHL-KTVKMTVKGKEPTTLDSISLRGNNI 62
L K + ++++L G V G ++G D MN + + V+M G++ + + +RGN+I
Sbjct: 9 LKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQ-NNIGMVVIRGNSI 67
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit
Length = 85
Score = 29.6 bits (65), Expect = 0.44, Method: Compositional matrix adjust.
Identities = 16/53 (30%), Positives = 27/53 (50%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNIRY 64
V I+LK + G ++ D+ MN L + G+ L ++ +RG+NI Y
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVY 78
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
Length = 86
Score = 29.6 bits (65), Expect = 0.44, Method: Compositional matrix adjust.
Identities = 16/53 (30%), Positives = 27/53 (50%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNIRY 64
V I+LK + G ++ D+ MN L + G+ L ++ +RG+NI Y
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVY 78
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
Length = 87
Score = 29.6 bits (65), Expect = 0.45, Method: Compositional matrix adjust.
Identities = 16/53 (30%), Positives = 27/53 (50%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNIRY 64
V I+LK + G ++ D+ MN L + G+ L ++ +RG+NI Y
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVY 78
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
Length = 83
Score = 29.6 bits (65), Expect = 0.48, Method: Compositional matrix adjust.
Identities = 16/53 (30%), Positives = 27/53 (50%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNNIRY 64
V I+LK + G ++ D+ MN L + G+ L ++ +RG+NI Y
Sbjct: 28 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVY 80
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii
Domain Of Human Neogenin
Length = 132
Score = 27.3 bits (59), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 13/40 (32%), Positives = 21/40 (52%)
Query: 12 VTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTT 51
VT L +GTQ+ I+G+D + + +T+ G P T
Sbjct: 67 VTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPAT 106
>pdb|2R2C|A Chain A, Crystal Structure Of A Domain Of The Outer Membrane
Lipoprotein Omp28 From Porphyromonas Gingivalis
pdb|2R2C|B Chain B, Crystal Structure Of A Domain Of The Outer Membrane
Lipoprotein Omp28 From Porphyromonas Gingivalis
Length = 183
Score = 25.8 bits (55), Expect = 7.6, Method: Compositional matrix adjust.
Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
Query: 2 NFLMKLSHETVTIELKNGTQVHGTIQGVDVAMNTHLKTVKMTVKGKEPTTLDSISLRGNN 61
+++ S++T + + + I VA T + +K+TVKGK L+ +L +
Sbjct: 31 SYVYDKSYKTWDVPIAEQXEQKAKINIFAVAEYTDTQKIKVTVKGK---ILEGNTLPKSX 87
Query: 62 IRYYILPDSL 71
++ Y+L D L
Sbjct: 88 VQVYLLEDKL 97
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.133 0.367
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,579,339
Number of Sequences: 62578
Number of extensions: 85044
Number of successful extensions: 202
Number of sequences better than 100.0: 24
Number of HSP's better than 100.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 179
Number of HSP's gapped (non-prelim): 24
length of query: 129
length of database: 14,973,337
effective HSP length: 88
effective length of query: 41
effective length of database: 9,466,473
effective search space: 388125393
effective search space used: 388125393
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 45 (21.9 bits)