Diaphorina citri psyllid: psy15784


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MVSNILRISSMKRMVNLLGTAQDSSDTKSQLYQIQHYTQQLAKDTNHILKQLNDTPLPSSPSEQRQCKMQKERLADDFSTALNAFQDVQKLAHKKESDQIKKTKVISKLPPPPGRQAVSGEEFGDRTQDQLIELQDNGSQQLQQQRQQDFINLREAEEQEQAIRQLESDIRDVNQIFKELGAMVHDQGELIDSIEAHVERTEAYVSDGNTQLKDAAMYTVSRILPLKVLVL
cccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEc
MVSNILRISS*********************YQIQHYTQQ**K*************************MQKERLADDFSTALNAFQ*******************************************************************REAEEQEQAIRQLESDIRDVNQIFKELGAMVHDQGELIDSIEAHVERTEAYVSDGNTQLKDAAMYTVSRILPLKVLVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSNILRISSMKRMVNLLGTAQDSSDTKSQLYQIQHYTQQLAKDTNHILKQLNDTPLPSSPSEQRQCKMQKERLADDFSTALNAFQDVQKLAHKKESDQIKKTKVISKLPPPPGRQAVSGEEFGDRTQDQLIELQDNGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFKELGAMVHDQGELIDSIEAHVERTEAYVSDGNTQLKDAAMYTVSRILPLKVLVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Syntaxin-12 SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion (in vitro).confidentQ86Y82
Syntaxin-12 SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion (in vitro).confidentQ5RBW6
Syntaxin-12 SNARE that acts to regulate protein transport between endosomes and the trans-Golgi network (By similarity). The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion (in vitro).confidentG3V7P1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043234 [CC]protein complexconfidentGO:0005575, GO:0032991
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006906 [BP]vesicle fusionprobableGO:0006996, GO:0009987, GO:0016192, GO:0008150, GO:0016044, GO:0071840, GO:0006810, GO:0016050, GO:0061025, GO:0061024, GO:0048284, GO:0006944, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0016043
GO:0031902 [CC]late endosome membraneprobableGO:0005737, GO:0005575, GO:0005770, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0008333 [BP]endosome to lysosome transportprobableGO:0016197, GO:0051234, GO:0046907, GO:0007034, GO:0006810, GO:0044765, GO:0008150, GO:0007041, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0050821 [BP]protein stabilizationprobableGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0031201 [CC]SNARE complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031083 [CC]BLOC-1 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0031082
GO:0033344 [BP]cholesterol effluxprobableGO:0051234, GO:0006810, GO:0015918, GO:0006869, GO:0015850, GO:0030301, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0005765 [CC]lysosomal membraneprobableGO:0005737, GO:0044446, GO:0000323, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0005764, GO:0044444, GO:0044437, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005484 [MF]SNAP receptor activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000149 [MF]SNARE bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006892 [BP]post-Golgi vesicle-mediated transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0016079 [BP]synaptic vesicle exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0008150, GO:0006836
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DNX, chain A
Confidence level:very confident
Coverage over the Query: 1-103
View the alignment between query and template
View the model in PyMOL
Template: 1DN1, chain B
Confidence level:very confident
Coverage over the Query: 2-115,127-209
View the alignment between query and template
View the model in PyMOL