Query         psy15800
Match_columns 109
No_of_seqs    177 out of 1005
Neff          8.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:40:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15800.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15800hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG1052 LdhA Lactate dehydroge 100.0 1.2E-32 2.5E-37  200.4  10.0  106    2-108    61-179 (324)
  2 PRK08410 2-hydroxyacid dehydro 100.0 6.3E-31 1.4E-35  190.6  10.3  104    5-108    60-178 (311)
  3 COG0111 SerA Phosphoglycerate  100.0 7.1E-31 1.5E-35  191.1  10.1  104    5-108    63-175 (324)
  4 PRK06487 glycerate dehydrogena 100.0   4E-30 8.6E-35  186.9  10.5  103    5-107    63-180 (317)
  5 PRK15409 bifunctional glyoxyla 100.0 4.1E-30 8.8E-35  187.2  10.1  106    2-108    61-179 (323)
  6 PRK11790 D-3-phosphoglycerate  100.0 4.7E-30   1E-34  191.8  10.1  104    5-108    72-184 (409)
  7 PRK13243 glyoxylate reductase; 100.0 1.7E-29 3.6E-34  184.7  10.4  104    5-108    64-183 (333)
  8 PRK06932 glycerate dehydrogena 100.0 1.8E-29 3.8E-34  183.3  10.1  104    5-108    62-180 (314)
  9 TIGR01327 PGDH D-3-phosphoglyc 100.0   9E-29   2E-33  189.7  10.2  105    2-107    57-170 (525)
 10 PLN03139 formate dehydrogenase 100.0 1.5E-28 3.3E-33  182.2  10.2  104    5-108   118-232 (386)
 11 PRK07574 formate dehydrogenase 100.0 1.7E-28 3.6E-33  182.1   9.8  104    5-108   111-225 (385)
 12 PRK13581 D-3-phosphoglycerate  100.0 2.2E-28 4.8E-33  187.6  10.4  106    2-108    59-173 (526)
 13 PLN02306 hydroxypyruvate reduc 100.0 5.4E-28 1.2E-32  179.5   9.9  104    5-108    81-199 (386)
 14 PLN02928 oxidoreductase family  99.9 5.5E-27 1.2E-31  172.2  10.3  101    5-107    79-191 (347)
 15 PRK12480 D-lactate dehydrogena  99.9 5.3E-27 1.2E-31  171.3   9.1  104    5-108    64-179 (330)
 16 PRK06436 glycerate dehydrogena  99.9 2.5E-26 5.3E-31  166.1  10.8  101    5-108    46-155 (303)
 17 PRK08605 D-lactate dehydrogena  99.9 2.5E-26 5.4E-31  167.9   9.0  104    5-108    64-180 (332)
 18 KOG0069|consensus               99.9 3.2E-26 6.9E-31  166.3   8.8  105    3-108    79-195 (336)
 19 KOG0068|consensus               99.9 1.5E-26 3.2E-31  167.0   6.6  106    3-108    65-179 (406)
 20 PRK15469 ghrA bifunctional gly  99.9 8.6E-24 1.9E-28  153.5   9.4  103    6-108    54-169 (312)
 21 PRK15438 erythronate-4-phospha  99.9 2.7E-23 5.8E-28  153.9   9.7   93    6-108    56-149 (378)
 22 PRK00257 erythronate-4-phospha  99.9 1.6E-22 3.6E-27  150.0   9.4   94    6-108    56-149 (381)
 23 PF00389 2-Hacid_dh:  D-isomer   99.6 1.6E-15 3.4E-20   97.7   2.8   45    5-49     57-101 (133)
 24 KOG0067|consensus               99.5   5E-14 1.1E-18  103.3   3.9  105    5-109    92-212 (435)
 25 PF02826 2-Hacid_dh_C:  D-isome  99.4 3.4E-13 7.4E-18   90.9   3.8   59   50-108     1-69  (178)
 26 TIGR02853 spore_dpaA dipicolin  99.1 6.9E-11 1.5E-15   85.2   4.5   88    9-108    90-184 (287)
 27 PTZ00075 Adenosylhomocysteinas  98.7 1.5E-08 3.2E-13   77.4   5.2   85   14-107   197-286 (476)
 28 PRK08306 dipicolinate synthase  98.1 5.7E-06 1.2E-10   60.0   5.5   90    5-108    90-185 (296)
 29 PRK05476 S-adenosyl-L-homocyst  96.0  0.0033 7.2E-08   48.0   1.4   90   13-107   154-244 (425)
 30 PRK13403 ketol-acid reductoiso  95.8  0.0085 1.8E-07   44.4   2.9   25   83-107    24-48  (335)
 31 PLN02494 adenosylhomocysteinas  95.4   0.016 3.5E-07   44.8   3.1   25   84-108   263-287 (477)
 32 PF00670 AdoHcyase_NAD:  S-aden  94.5   0.037 8.1E-07   37.0   2.6   25   83-107    31-55  (162)
 33 TIGR00936 ahcY adenosylhomocys  93.5   0.071 1.5E-06   40.6   2.9   24   84-107   204-227 (406)
 34 cd01075 NAD_bind_Leu_Phe_Val_D  93.0   0.083 1.8E-06   36.3   2.3   26   83-108    36-61  (200)
 35 cd00401 AdoHcyase S-adenosyl-L  91.1    0.22 4.8E-06   38.0   2.9   24   84-107   211-234 (413)
 36 COG0027 PurT Formate-dependent  89.5    0.37 8.1E-06   35.9   2.8   25   84-108    21-45  (394)
 37 TIGR00518 alaDH alanine dehydr  87.2     0.6 1.3E-05   35.0   2.8   24   84-107   176-199 (370)
 38 TIGR02964 xanthine_xdhC xanthi  85.6    0.93   2E-05   32.2   2.9   25   84-108   109-133 (246)
 39 PRK05479 ketol-acid reductoiso  84.0     1.1 2.4E-05   33.3   2.8   25   83-107    25-49  (330)
 40 PF03720 UDPG_MGDP_dh_C:  UDP-g  82.9     1.8   4E-05   26.4   3.1   29   80-108    12-40  (106)
 41 PLN02545 3-hydroxybutyryl-CoA   82.8     1.1 2.4E-05   32.2   2.4   26   83-108    12-37  (295)
 42 PRK14619 NAD(P)H-dependent gly  82.7     1.5 3.3E-05   31.8   3.1   26   83-108    12-37  (308)
 43 PLN02712 arogenate dehydrogena  81.8     1.4 3.1E-05   35.7   2.9   24   84-107   378-401 (667)
 44 PLN02256 arogenate dehydrogena  80.9     1.9   4E-05   31.6   3.0   25   83-107    44-68  (304)
 45 TIGR02114 coaB_strep phosphopa  80.2     2.1 4.5E-05   29.9   2.9   24   83-106    24-47  (227)
 46 cd01076 NAD_bind_1_Glu_DH NAD(  79.5     2.2 4.9E-05   29.9   2.9   23   83-105    39-61  (227)
 47 PRK07066 3-hydroxybutyryl-CoA   79.4     1.7 3.8E-05   32.1   2.4   26   83-108    15-40  (321)
 48 TIGR03325 BphB_TodD cis-2,3-di  78.5     2.3   5E-05   29.6   2.8   25   83-107    14-38  (262)
 49 PRK08703 short chain dehydroge  78.3     2.5 5.5E-05   28.8   2.9   26   83-108    15-40  (239)
 50 PRK06732 phosphopantothenate--  77.4     2.8 6.1E-05   29.3   2.9   25   83-107    25-49  (229)
 51 PRK08339 short chain dehydroge  77.3     3.2 6.9E-05   29.1   3.2   24   84-107    18-41  (263)
 52 PF00070 Pyr_redox:  Pyridine n  77.2     4.2 9.1E-05   23.2   3.2   25   84-108     8-32  (80)
 53 PRK05786 fabG 3-ketoacyl-(acyl  77.0     2.4 5.3E-05   28.7   2.5   26   83-108    14-39  (238)
 54 PRK06523 short chain dehydroge  76.6     3.2   7E-05   28.7   3.0   25   83-107    18-42  (260)
 55 PRK06483 dihydromonapterin red  76.3     3.5 7.5E-05   28.1   3.1   26   83-108    11-36  (236)
 56 TIGR00465 ilvC ketol-acid redu  76.1     3.1 6.6E-05   30.7   2.9   24   83-106    11-34  (314)
 57 PRK08265 short chain dehydroge  76.0     3.1 6.7E-05   29.0   2.8   26   83-108    15-40  (261)
 58 PRK00683 murD UDP-N-acetylmura  75.9     3.4 7.3E-05   31.3   3.2   26   83-108    11-36  (418)
 59 PLN02653 GDP-mannose 4,6-dehyd  75.8     3.9 8.4E-05   29.6   3.4   25   83-107    15-39  (340)
 60 COG0499 SAM1 S-adenosylhomocys  75.5     2.7 5.9E-05   31.9   2.5   22   84-105   218-239 (420)
 61 PRK06180 short chain dehydroge  75.4       3 6.4E-05   29.3   2.6   26   82-107    12-37  (277)
 62 PRK07890 short chain dehydroge  75.3     3.8 8.1E-05   28.2   3.1   26   83-108    14-39  (258)
 63 PLN02712 arogenate dehydrogena  75.2     3.1 6.7E-05   33.8   2.9   25   83-107    60-84  (667)
 64 PRK06114 short chain dehydroge  75.0     4.1 8.9E-05   28.2   3.2   25   83-107    17-41  (254)
 65 PRK07326 short chain dehydroge  74.9     3.9 8.4E-05   27.7   3.0   25   83-107    15-39  (237)
 66 PF01262 AlaDh_PNT_C:  Alanine   74.5     3.5 7.5E-05   27.2   2.6   24   84-107    29-52  (168)
 67 PRK06035 3-hydroxyacyl-CoA deh  74.2     2.8   6E-05   30.1   2.3   26   83-108    11-36  (291)
 68 PRK06398 aldose dehydrogenase;  74.2     4.3 9.2E-05   28.3   3.2   25   83-107    15-39  (258)
 69 PRK07523 gluconate 5-dehydroge  74.1     4.1   9E-05   28.1   3.1   25   83-107    19-43  (255)
 70 PRK06841 short chain dehydroge  74.0     3.8 8.3E-05   28.1   2.9   25   83-107    24-48  (255)
 71 PRK09620 hypothetical protein;  73.9       4 8.7E-05   28.7   2.9   24   83-106    28-51  (229)
 72 PRK12384 sorbitol-6-phosphate   73.5     3.8 8.2E-05   28.3   2.8   25   83-107    11-35  (259)
 73 PRK12828 short chain dehydroge  73.4     4.2 9.2E-05   27.4   2.9   25   83-107    16-40  (239)
 74 PRK06949 short chain dehydroge  73.1     3.3 7.2E-05   28.4   2.4   25   83-107    18-42  (258)
 75 PRK12823 benD 1,6-dihydroxycyc  73.1     4.6  0.0001   27.8   3.1   25   83-107    17-41  (260)
 76 PRK06194 hypothetical protein;  73.0     3.9 8.6E-05   28.7   2.8   25   83-107    15-39  (287)
 77 PRK07533 enoyl-(acyl carrier p  73.0     4.7  0.0001   28.1   3.2   23   85-107    23-45  (258)
 78 PLN02253 xanthoxin dehydrogena  72.7     3.9 8.5E-05   28.6   2.7   24   84-107    28-51  (280)
 79 PRK06179 short chain dehydroge  72.5     4.3 9.4E-05   28.2   2.9   26   82-107    12-37  (270)
 80 PRK07577 short chain dehydroge  72.5     5.5 0.00012   26.9   3.3   27   82-108    11-37  (234)
 81 PRK12745 3-ketoacyl-(acyl-carr  72.1       5 0.00011   27.5   3.1   25   83-107    11-35  (256)
 82 PRK07035 short chain dehydroge  72.0     3.8 8.3E-05   28.1   2.5   25   83-107    17-41  (252)
 83 KOG0725|consensus               72.0     4.2   9E-05   29.2   2.7   24   85-108    19-42  (270)
 84 PRK07067 sorbitol dehydrogenas  71.9     4.4 9.5E-05   28.0   2.8   26   83-108    15-40  (257)
 85 PRK07831 short chain dehydroge  71.9     4.7  0.0001   27.9   2.9   23   85-107    29-51  (262)
 86 PRK06200 2,3-dihydroxy-2,3-dih  71.8     3.9 8.5E-05   28.4   2.5   25   83-107    15-39  (263)
 87 PRK08085 gluconate 5-dehydroge  71.8     4.4 9.4E-05   27.9   2.7   24   84-107    19-42  (254)
 88 PRK07454 short chain dehydroge  71.7     3.9 8.5E-05   27.9   2.5   25   83-107    15-39  (241)
 89 PRK07856 short chain dehydroge  71.6     4.9 0.00011   27.7   3.0   26   83-108    15-40  (252)
 90 PRK06182 short chain dehydroge  71.6     4.1 8.9E-05   28.5   2.6   26   82-107    11-36  (273)
 91 PRK07062 short chain dehydroge  71.6     4.6 9.9E-05   28.0   2.8   24   84-107    18-41  (265)
 92 PRK07231 fabG 3-ketoacyl-(acyl  71.5     5.1 0.00011   27.3   3.0   27   82-108    13-39  (251)
 93 PLN02272 glyceraldehyde-3-phos  71.3     4.6  0.0001   31.1   2.9   25   83-107    93-119 (421)
 94 PRK08993 2-deoxy-D-gluconate 3  71.3     5.2 0.00011   27.6   3.0   25   83-107    19-43  (253)
 95 PRK06172 short chain dehydroge  71.0     4.6 9.9E-05   27.8   2.7   25   83-107    16-40  (253)
 96 PRK12367 short chain dehydroge  71.0     5.4 0.00012   27.9   3.1   25   84-108    24-48  (245)
 97 PRK07806 short chain dehydroge  70.9       6 0.00013   27.0   3.3   25   83-107    15-39  (248)
 98 PRK07074 short chain dehydroge  70.9     4.7  0.0001   27.8   2.7   25   83-107    11-35  (257)
 99 cd05313 NAD_bind_2_Glu_DH NAD(  70.8     5.1 0.00011   28.7   2.9   23   83-105    46-68  (254)
100 PF03807 F420_oxidored:  NADP o  70.8     3.8 8.3E-05   24.0   2.0   26   83-108     7-36  (96)
101 PRK09186 flagellin modificatio  70.6       5 0.00011   27.5   2.8   26   82-107    12-37  (256)
102 PRK09135 pteridine reductase;   70.5     5.7 0.00012   26.9   3.1   25   83-107    15-39  (249)
103 PRK07904 short chain dehydroge  70.4     5.6 0.00012   27.7   3.1   25   84-108    18-43  (253)
104 PRK05993 short chain dehydroge  70.4     4.5 9.7E-05   28.5   2.6   26   83-108    13-38  (277)
105 PRK01710 murD UDP-N-acetylmura  70.4     5.5 0.00012   30.6   3.2   24   84-107    23-46  (458)
106 PRK08017 oxidoreductase; Provi  70.4     4.9 0.00011   27.6   2.7   25   83-107    11-35  (256)
107 PRK05867 short chain dehydroge  70.3     4.7  0.0001   27.8   2.7   24   84-107    19-42  (253)
108 KOG1200|consensus               70.2     5.7 0.00012   28.0   2.9   24   85-108    25-48  (256)
109 PRK07576 short chain dehydroge  70.2     5.8 0.00013   27.7   3.1   25   83-107    18-42  (264)
110 PRK08278 short chain dehydroge  70.0       6 0.00013   27.8   3.2   25   83-107    15-39  (273)
111 PRK06550 fabG 3-ketoacyl-(acyl  69.8     6.6 0.00014   26.6   3.3   25   83-107    14-38  (235)
112 PRK08264 short chain dehydroge  69.6     5.2 0.00011   27.2   2.7   26   83-108    15-41  (238)
113 PRK06500 short chain dehydroge  69.3     6.4 0.00014   26.8   3.1   25   83-107    15-39  (249)
114 TIGR02622 CDP_4_6_dhtase CDP-g  69.3     5.8 0.00013   28.9   3.0   25   83-107    13-37  (349)
115 PRK08251 short chain dehydroge  69.2     4.8  0.0001   27.5   2.5   25   83-107    11-35  (248)
116 PRK07063 short chain dehydroge  69.2     5.5 0.00012   27.5   2.8   25   83-107    16-40  (260)
117 PRK12939 short chain dehydroge  69.1     5.4 0.00012   27.2   2.7   25   83-107    16-40  (250)
118 PRK03803 murD UDP-N-acetylmura  69.0     5.7 0.00012   30.2   3.0   24   84-107    15-38  (448)
119 PRK14618 NAD(P)H-dependent gly  69.0     4.4 9.5E-05   29.5   2.4   26   83-108    12-37  (328)
120 PRK06125 short chain dehydroge  69.0     6.1 0.00013   27.3   3.0   24   84-107    17-40  (259)
121 PRK08862 short chain dehydroge  68.9     5.4 0.00012   27.4   2.7   25   84-108    15-39  (227)
122 PRK09291 short chain dehydroge  68.9     6.3 0.00014   27.0   3.0   25   83-107    11-35  (257)
123 PRK07814 short chain dehydroge  68.5     6.7 0.00015   27.3   3.1   25   83-107    19-43  (263)
124 PRK07825 short chain dehydroge  68.4       5 0.00011   28.0   2.5   25   83-107    14-38  (273)
125 PRK12481 2-deoxy-D-gluconate 3  68.4     6.5 0.00014   27.2   3.0   24   84-107    18-41  (251)
126 PRK05717 oxidoreductase; Valid  68.4     6.4 0.00014   27.1   3.0   25   83-107    19-43  (255)
127 PRK12829 short chain dehydroge  68.3     6.2 0.00013   27.1   2.9   25   83-107    20-44  (264)
128 PRK05866 short chain dehydroge  68.3     4.9 0.00011   28.8   2.4   24   84-107    50-73  (293)
129 PRK07478 short chain dehydroge  68.2     5.9 0.00013   27.3   2.8   25   83-107    15-39  (254)
130 PLN02780 ketoreductase/ oxidor  68.2     4.2 9.1E-05   29.6   2.1   25   84-108    63-87  (320)
131 PRK08217 fabG 3-ketoacyl-(acyl  68.1     6.4 0.00014   26.8   2.9   25   83-107    14-38  (253)
132 PRK07666 fabG 3-ketoacyl-(acyl  68.1     5.4 0.00012   27.1   2.6   25   83-107    16-40  (239)
133 PRK07530 3-hydroxybutyryl-CoA   67.9     4.7  0.0001   28.9   2.3   26   83-108    12-37  (292)
134 PRK07024 short chain dehydroge  67.7     5.1 0.00011   27.7   2.4   25   83-107    11-35  (257)
135 PRK07819 3-hydroxybutyryl-CoA   67.6       5 0.00011   28.9   2.4   26   83-108    13-38  (286)
136 TIGR01832 kduD 2-deoxy-D-gluco  67.5     7.1 0.00015   26.7   3.1   25   83-107    14-38  (248)
137 KOG1209|consensus               67.4     7.6 0.00016   27.8   3.1   26   83-108    17-42  (289)
138 PRK06196 oxidoreductase; Provi  67.4     5.6 0.00012   28.6   2.6   24   84-107    36-59  (315)
139 PRK06171 sorbitol-6-phosphate   67.4       8 0.00017   26.8   3.3   26   83-108    18-43  (266)
140 PRK05876 short chain dehydroge  67.3     7.1 0.00015   27.6   3.1   25   83-107    15-39  (275)
141 PRK06079 enoyl-(acyl carrier p  67.2     7.6 0.00016   26.9   3.2   24   84-107    19-42  (252)
142 PRK08277 D-mannonate oxidoredu  67.1     6.1 0.00013   27.6   2.7   24   84-107    20-43  (278)
143 cd01065 NAD_bind_Shikimate_DH   66.8     5.7 0.00012   25.3   2.3   25   84-108    28-53  (155)
144 PRK09072 short chain dehydroge  66.7     7.5 0.00016   26.9   3.1   25   83-107    14-38  (263)
145 PRK06138 short chain dehydroge  66.5     6.6 0.00014   26.8   2.7   25   83-107    14-38  (252)
146 PRK05875 short chain dehydroge  66.5     6.9 0.00015   27.3   2.9   25   83-107    16-40  (276)
147 PF01488 Shikimate_DH:  Shikima  66.4     4.4 9.6E-05   25.8   1.7   25   84-108    21-46  (135)
148 PLN02657 3,8-divinyl protochlo  66.1       7 0.00015   29.4   3.0   25   84-108    70-94  (390)
149 PRK06057 short chain dehydroge  66.1     6.7 0.00015   27.0   2.7   25   83-107    16-40  (255)
150 PRK08945 putative oxoacyl-(acy  66.1     6.9 0.00015   26.8   2.8   25   83-107    21-45  (247)
151 cd05211 NAD_bind_Glu_Leu_Phe_V  65.9     7.2 0.00016   27.1   2.8   22   83-104    31-52  (217)
152 PRK08213 gluconate 5-dehydroge  65.7     8.1 0.00017   26.7   3.1   25   83-107    21-45  (259)
153 PRK07531 bifunctional 3-hydrox  65.5     5.5 0.00012   31.0   2.4   26   83-108    12-37  (495)
154 TIGR03206 benzo_BadH 2-hydroxy  65.1     8.1 0.00018   26.3   3.0   25   83-107    12-36  (250)
155 PRK12429 3-hydroxybutyrate deh  65.0     7.1 0.00015   26.7   2.7   27   81-107    11-37  (258)
156 PLN03209 translocon at the inn  64.9     6.4 0.00014   31.6   2.6   24   84-107    90-113 (576)
157 PRK07774 short chain dehydroge  64.8     7.3 0.00016   26.6   2.7   25   83-107    15-39  (250)
158 PRK05579 bifunctional phosphop  64.8     7.9 0.00017   29.5   3.0   24   84-107   214-237 (399)
159 PRK06124 gluconate 5-dehydroge  64.8     8.6 0.00019   26.4   3.1   25   83-107    20-44  (256)
160 cd05191 NAD_bind_amino_acid_DH  64.8     9.7 0.00021   22.1   2.9   23   84-106    32-55  (86)
161 PRK02472 murD UDP-N-acetylmura  64.7     7.8 0.00017   29.4   3.0   24   84-107    14-37  (447)
162 PRK08589 short chain dehydroge  64.6     8.6 0.00019   26.9   3.1   25   83-107    15-39  (272)
163 PRK08643 acetoin reductase; Va  64.3     8.9 0.00019   26.3   3.0   25   83-107    11-35  (256)
164 PRK05653 fabG 3-ketoacyl-(acyl  64.2     8.1 0.00017   26.0   2.8   26   83-108    14-39  (246)
165 PRK06130 3-hydroxybutyryl-CoA   64.0     6.2 0.00014   28.5   2.3   26   83-108    12-37  (311)
166 PRK08226 short chain dehydroge  64.0       9  0.0002   26.4   3.1   25   83-107    15-39  (263)
167 PRK14106 murD UDP-N-acetylmura  63.9     8.1 0.00018   29.3   3.0   24   84-107    14-37  (450)
168 PRK06914 short chain dehydroge  63.6     8.1 0.00018   27.0   2.8   25   83-107    12-36  (280)
169 PRK00258 aroE shikimate 5-dehy  63.5     6.4 0.00014   28.2   2.3   25   84-108   132-157 (278)
170 PRK08818 prephenate dehydrogen  63.3     8.6 0.00019   29.1   3.0   27   81-107    11-38  (370)
171 KOG0023|consensus               63.2     8.1 0.00018   29.0   2.7   23   85-107   192-214 (360)
172 PRK15181 Vi polysaccharide bio  63.1      12 0.00025   27.5   3.6   25   83-107    24-48  (348)
173 PLN00141 Tic62-NAD(P)-related   62.9     8.9 0.00019   26.6   2.9   24   84-107    27-50  (251)
174 PRK06935 2-deoxy-D-gluconate 3  62.9     9.8 0.00021   26.2   3.1   24   84-107    25-48  (258)
175 PRK09414 glutamate dehydrogena  62.8     8.3 0.00018   29.9   2.9   21   84-104   241-261 (445)
176 PRK06113 7-alpha-hydroxysteroi  62.8     8.3 0.00018   26.6   2.7   24   84-107    21-44  (255)
177 PRK07889 enoyl-(acyl carrier p  62.8      10 0.00022   26.4   3.2   24   84-107    19-42  (256)
178 PRK06197 short chain dehydroge  62.7      10 0.00022   27.1   3.2   24   84-107    26-49  (306)
179 PRK14030 glutamate dehydrogena  62.7     8.8 0.00019   29.8   3.0   20   84-103   237-256 (445)
180 PLN02350 phosphogluconate dehy  62.7     7.1 0.00015   30.7   2.5   26   83-108    14-39  (493)
181 PRK08415 enoyl-(acyl carrier p  62.7      11 0.00023   26.8   3.2   24   84-107    17-40  (274)
182 PRK06198 short chain dehydroge  62.7     7.7 0.00017   26.7   2.5   25   83-107    15-40  (260)
183 PRK05872 short chain dehydroge  62.6     7.4 0.00016   27.7   2.5   25   83-107    18-42  (296)
184 PRK08628 short chain dehydroge  62.4     9.3  0.0002   26.3   2.9   25   83-107    16-40  (258)
185 PRK05808 3-hydroxybutyryl-CoA   61.7     6.5 0.00014   28.0   2.0   26   83-108    11-36  (282)
186 PRK07097 gluconate 5-dehydroge  61.7     9.3  0.0002   26.5   2.8   24   84-107    20-43  (265)
187 PRK07060 short chain dehydroge  61.6     8.4 0.00018   26.1   2.5   24   84-107    19-42  (245)
188 PRK06139 short chain dehydroge  61.6     7.6 0.00016   28.5   2.4   25   83-107    16-40  (330)
189 PLN02662 cinnamyl-alcohol dehy  61.5     9.6 0.00021   27.1   2.9   27   81-107    11-37  (322)
190 PLN02858 fructose-bisphosphate  61.5     6.4 0.00014   34.7   2.2   25   84-108   333-357 (1378)
191 PRK12742 oxidoreductase; Provi  61.4      11 0.00023   25.5   3.0   24   83-106    15-38  (237)
192 cd01078 NAD_bind_H4MPT_DH NADP  61.4      11 0.00024   25.2   3.0   24   84-107    38-61  (194)
193 PRK08303 short chain dehydroge  60.9      11 0.00023   27.3   3.1   24   84-107    18-41  (305)
194 PRK06505 enoyl-(acyl carrier p  60.8      11 0.00024   26.6   3.0   23   85-107    20-42  (271)
195 PRK06720 hypothetical protein;  60.8      10 0.00022   25.2   2.7   24   84-107    26-49  (169)
196 PRK12826 3-ketoacyl-(acyl-carr  60.8      12 0.00026   25.4   3.2   25   83-107    15-39  (251)
197 PRK08594 enoyl-(acyl carrier p  60.7      12 0.00026   26.1   3.2   23   84-106    19-41  (257)
198 PRK11199 tyrA bifunctional cho  60.7     9.9 0.00021   28.6   2.9   25   83-107   107-131 (374)
199 PRK07502 cyclohexadienyl dehyd  60.7     7.7 0.00017   28.0   2.3   26   83-108    14-41  (307)
200 PLN02695 GDP-D-mannose-3',5'-e  60.4      11 0.00024   28.0   3.1   25   83-107    30-54  (370)
201 PRK09242 tropinone reductase;   60.2      11 0.00024   26.0   2.9   25   83-107    18-42  (257)
202 PRK07791 short chain dehydroge  60.0      12 0.00026   26.6   3.1   25   83-107    15-39  (286)
203 TIGR00521 coaBC_dfp phosphopan  60.0      12 0.00026   28.5   3.2   23   84-106   211-233 (390)
204 PRK12824 acetoacetyl-CoA reduc  59.6      12 0.00026   25.3   3.0   25   83-107    11-35  (245)
205 PRK13394 3-hydroxybutyrate deh  59.5      12 0.00025   25.7   3.0   26   83-108    16-41  (262)
206 PRK08293 3-hydroxybutyryl-CoA   59.5     8.6 0.00019   27.5   2.3   26   83-108    11-36  (287)
207 PRK12748 3-ketoacyl-(acyl-carr  59.5      12 0.00026   25.7   3.1   24   84-107    17-40  (256)
208 PRK08642 fabG 3-ketoacyl-(acyl  59.4      12 0.00026   25.5   3.0   23   83-105    14-36  (253)
209 PRK07424 bifunctional sterol d  59.3     9.5 0.00021   29.1   2.6   24   84-107   188-211 (406)
210 PRK08690 enoyl-(acyl carrier p  59.2      13 0.00028   25.9   3.2   23   84-106    18-40  (261)
211 PRK02006 murD UDP-N-acetylmura  58.8      11 0.00025   29.1   3.0   25   83-107    15-39  (498)
212 PRK07109 short chain dehydroge  58.8       9  0.0002   28.0   2.4   25   83-107    17-41  (334)
213 TIGR01035 hemA glutamyl-tRNA r  58.5     8.5 0.00019   29.3   2.3   25   84-108   189-214 (417)
214 KOG1207|consensus               58.4      11 0.00024   26.1   2.6   24   85-108    18-41  (245)
215 PRK08159 enoyl-(acyl carrier p  58.4      14  0.0003   26.1   3.2   23   84-106    22-44  (272)
216 PRK05854 short chain dehydroge  58.4      10 0.00022   27.4   2.6   24   84-107    24-47  (313)
217 KOG1370|consensus               58.3     9.4  0.0002   28.7   2.3   21   84-104   223-243 (434)
218 PRK12747 short chain dehydroge  58.2      13 0.00028   25.5   3.0   23   83-105    13-35  (252)
219 PRK00421 murC UDP-N-acetylmura  58.1      12 0.00025   28.7   3.0   24   84-107    16-40  (461)
220 PRK08936 glucose-1-dehydrogena  57.9      13 0.00028   25.7   3.0   24   83-106    16-39  (261)
221 PRK06484 short chain dehydroge  57.9      10 0.00022   29.1   2.7   24   84-107    15-38  (520)
222 PLN02989 cinnamyl-alcohol dehy  57.8      13 0.00027   26.7   3.0   25   83-107    14-38  (325)
223 PRK08220 2,3-dihydroxybenzoate  57.8      13 0.00029   25.3   3.0   25   83-107    17-41  (252)
224 PLN02572 UDP-sulfoquinovose sy  57.8      12 0.00025   28.7   2.9   23   84-106    57-79  (442)
225 PRK06463 fabG 3-ketoacyl-(acyl  57.6      13 0.00029   25.5   3.0   24   83-106    16-39  (255)
226 PRK08416 7-alpha-hydroxysteroi  57.6      13 0.00028   25.8   2.9   23   84-106    18-40  (260)
227 PRK06482 short chain dehydroge  57.4      10 0.00022   26.4   2.4   25   83-107    11-35  (276)
228 PRK07985 oxidoreductase; Provi  57.3      15 0.00033   26.2   3.3   23   84-106    59-81  (294)
229 PRK14031 glutamate dehydrogena  57.0      13 0.00028   28.9   3.0   23   84-106   237-259 (444)
230 PRK12827 short chain dehydroge  56.6      15 0.00033   24.8   3.1   24   83-106    15-38  (249)
231 PRK11064 wecC UDP-N-acetyl-D-m  56.5      11 0.00024   28.7   2.6   26   83-108    11-36  (415)
232 PRK03369 murD UDP-N-acetylmura  56.4      13 0.00028   28.9   3.0   24   84-107    21-44  (488)
233 PRK07453 protochlorophyllide o  56.1      15 0.00032   26.5   3.1   25   83-107    15-39  (322)
234 PLN00016 RNA-binding protein;   56.0      13 0.00029   27.5   2.9   26   83-108    65-90  (378)
235 PRK10669 putative cation:proto  55.9     9.2  0.0002   30.1   2.1   25   84-108   426-450 (558)
236 PRK05565 fabG 3-ketoacyl-(acyl  55.7      13 0.00028   25.1   2.7   25   83-107    14-39  (247)
237 PRK12859 3-ketoacyl-(acyl-carr  55.4      17 0.00036   25.2   3.2   21   85-105    19-39  (256)
238 COG0300 DltE Short-chain dehyd  55.3      15 0.00032   26.6   2.9   26   83-108    15-40  (265)
239 PRK06997 enoyl-(acyl carrier p  55.2      16 0.00035   25.5   3.1   23   84-106    18-40  (260)
240 PRK00141 murD UDP-N-acetylmura  55.2      13 0.00029   28.6   2.9   24   84-107    24-47  (473)
241 PRK05472 redox-sensing transcr  55.2     8.1 0.00018   26.5   1.5   59   39-106    57-118 (213)
242 TIGR00507 aroE shikimate 5-deh  55.1      12 0.00026   26.6   2.5   25   84-108   126-150 (270)
243 PRK07792 fabG 3-ketoacyl-(acyl  54.9      16 0.00035   26.2   3.2   24   84-107    22-45  (306)
244 PRK09310 aroDE bifunctional 3-  54.7      11 0.00023   29.4   2.3   24   84-107   341-364 (477)
245 cd08296 CAD_like Cinnamyl alco  54.5      14  0.0003   26.6   2.8   25   83-107   172-196 (333)
246 PLN02583 cinnamoyl-CoA reducta  54.4      16 0.00034   26.1   3.0   24   83-106    15-38  (297)
247 PRK01390 murD UDP-N-acetylmura  54.4      14 0.00031   28.2   2.9   24   84-107    18-41  (460)
248 cd08288 MDR_yhdh Yhdh putative  54.3      14  0.0003   26.2   2.7   23   84-106   157-179 (324)
249 PRK09424 pntA NAD(P) transhydr  54.3      13 0.00028   29.3   2.7   25   84-108   174-198 (509)
250 PLN02477 glutamate dehydrogena  53.9      15 0.00033   28.2   2.9   22   83-104   214-235 (410)
251 PRK06603 enoyl-(acyl carrier p  53.9      17 0.00037   25.3   3.0   23   85-107    21-43  (260)
252 PRK00045 hemA glutamyl-tRNA re  53.9      11 0.00024   28.8   2.2   25   84-108   191-216 (423)
253 PF11798 IMS_HHH:  IMS family H  53.8     9.9 0.00021   18.2   1.3   14   85-98     18-31  (32)
254 PRK07984 enoyl-(acyl carrier p  53.6      18 0.00039   25.4   3.2   23   85-107    19-41  (262)
255 PRK07370 enoyl-(acyl carrier p  53.5      20 0.00043   24.9   3.3   22   84-105    18-39  (258)
256 PRK07775 short chain dehydroge  53.5      18 0.00038   25.4   3.1   25   83-107    19-43  (274)
257 PRK08263 short chain dehydroge  53.4      14  0.0003   25.9   2.5   26   82-107    11-36  (275)
258 PLN02650 dihydroflavonol-4-red  53.1      16 0.00034   26.7   2.8   27   81-107    12-38  (351)
259 PRK06701 short chain dehydroge  53.0      18 0.00039   25.7   3.1   24   84-107    56-79  (290)
260 PRK05855 short chain dehydroge  52.9      16 0.00034   28.2   3.0   24   84-107   325-348 (582)
261 cd08295 double_bond_reductase_  52.9      13 0.00028   26.8   2.4   24   84-107   162-185 (338)
262 PLN02166 dTDP-glucose 4,6-dehy  52.6      16 0.00035   28.0   2.9   24   84-107   130-153 (436)
263 PRK04308 murD UDP-N-acetylmura  52.2      18 0.00038   27.6   3.1   24   84-107    14-37  (445)
264 PRK09496 trkA potassium transp  52.2      13 0.00028   28.1   2.3   25   84-108   240-264 (453)
265 PRK06719 precorrin-2 dehydroge  52.1      19 0.00041   23.7   2.9   24   84-107    22-45  (157)
266 PF00208 ELFV_dehydrog:  Glutam  51.7      15 0.00033   26.0   2.5   22   83-104    40-61  (244)
267 PRK12743 oxidoreductase; Provi  51.5      20 0.00043   24.7   3.1   23   83-105    11-33  (256)
268 cd08245 CAD Cinnamyl alcohol d  51.2      16 0.00034   26.1   2.6   24   84-107   172-195 (330)
269 PRK14982 acyl-ACP reductase; P  51.1      31 0.00067   25.9   4.1   24   84-107   165-190 (340)
270 COG1064 AdhP Zn-dependent alco  51.1      18 0.00039   27.1   2.9   25   84-108   176-200 (339)
271 PF00861 Ribosomal_L18p:  Ribos  50.9      20 0.00043   22.6   2.7   24   85-108    75-98  (119)
272 cd01977 Nitrogenase_VFe_alpha   50.9      87  0.0019   23.8   6.6   40    5-44     85-135 (415)
273 PLN02240 UDP-glucose 4-epimera  50.7      21 0.00045   25.8   3.2   24   83-106    14-37  (352)
274 PRK14806 bifunctional cyclohex  50.5      16 0.00035   29.7   2.7   26   83-108    11-38  (735)
275 TIGR02822 adh_fam_2 zinc-bindi  50.3      18 0.00038   26.3   2.7   24   84-107   175-198 (329)
276 PRK04148 hypothetical protein;  50.2      19 0.00042   23.3   2.6   24   84-108    26-49  (134)
277 cd08294 leukotriene_B4_DH_like  50.2      16 0.00034   26.0   2.4   23   84-106   154-176 (329)
278 cd00432 Ribosomal_L18_L5e Ribo  50.1      21 0.00047   21.6   2.7   23   85-107    61-83  (103)
279 PRK12744 short chain dehydroge  50.0      22 0.00048   24.4   3.1   23   83-105    17-39  (257)
280 PRK12935 acetoacetyl-CoA reduc  50.0      21 0.00045   24.3   2.9   23   83-105    15-37  (247)
281 PRK08268 3-hydroxy-acyl-CoA de  49.9      14 0.00031   29.0   2.3   25   84-108    16-40  (507)
282 PRK06484 short chain dehydroge  49.6      16 0.00034   28.2   2.5   24   84-107   279-302 (520)
283 PLN02896 cinnamyl-alcohol dehy  49.6      19  0.0004   26.3   2.8   25   83-107    19-43  (353)
284 TIGR00561 pntA NAD(P) transhyd  49.6      19 0.00041   28.5   2.9   25   84-108   173-197 (511)
285 cd08289 MDR_yhfp_like Yhfp put  49.4      18 0.00039   25.6   2.7   24   84-107   157-180 (326)
286 PRK08063 enoyl-(acyl carrier p  49.4      16 0.00036   24.8   2.4   22   82-103    12-33  (250)
287 COG3967 DltE Short-chain dehyd  49.4      22 0.00048   25.2   2.9   23   85-107    16-38  (245)
288 COG3867 Arabinogalactan endo-1  49.2      16 0.00034   27.4   2.3   18   86-103   105-122 (403)
289 PF13241 NAD_binding_7:  Putati  49.2      20 0.00042   21.6   2.4   24   84-107    16-39  (103)
290 PRK05557 fabG 3-ketoacyl-(acyl  49.2      23 0.00049   23.8   3.0   24   83-106    14-37  (248)
291 TIGR02279 PaaC-3OHAcCoADH 3-hy  49.1      14 0.00031   28.9   2.2   26   83-108    13-38  (503)
292 COG0334 GdhA Glutamate dehydro  49.1      20 0.00042   27.7   2.8   24   84-107   216-239 (411)
293 PF11430 EGL-1:  Programmed cel  48.9      15 0.00033   16.0   1.4   16   85-100     2-17  (21)
294 TIGR02825 B4_12hDH leukotriene  48.9      22 0.00047   25.5   3.0   24   84-107   149-172 (325)
295 PRK01438 murD UDP-N-acetylmura  48.8      20 0.00043   27.5   2.9   24   84-107    25-48  (480)
296 cd05283 CAD1 Cinnamyl alcohol   48.8      19  0.0004   26.0   2.7   25   83-107   178-202 (337)
297 PRK12936 3-ketoacyl-(acyl-carr  48.7      20 0.00044   24.2   2.7   25   83-107    15-39  (245)
298 PRK12548 shikimate 5-dehydroge  48.5      19 0.00042   25.9   2.7   25   84-108   135-160 (289)
299 PTZ00079 NADP-specific glutama  48.4      21 0.00044   27.9   2.9   21   84-104   246-266 (454)
300 PLN02730 enoyl-[acyl-carrier-p  48.2      23 0.00049   25.9   3.0   19   85-103    22-40  (303)
301 cd08292 ETR_like_2 2-enoyl thi  48.2      18 0.00039   25.6   2.5   23   84-106   150-172 (324)
302 KOG1687|consensus               48.1      43 0.00093   22.0   3.9   61    5-67     95-163 (168)
303 PF04127 DFP:  DNA / pantothena  48.1      22 0.00048   24.1   2.8   24   83-106    28-51  (185)
304 PRK06128 oxidoreductase; Provi  47.7      26 0.00057   24.9   3.3   23   84-106    65-87  (300)
305 PRK03659 glutathione-regulated  47.6      15 0.00032   29.4   2.1   25   84-108   409-433 (601)
306 COG1249 Lpd Pyruvate/2-oxoglut  47.5      21 0.00046   27.7   2.9   25   84-108   182-206 (454)
307 PRK12825 fabG 3-ketoacyl-(acyl  47.4      24 0.00053   23.6   3.0   24   83-106    15-38  (249)
308 COG1004 Ugd Predicted UDP-gluc  47.3      22 0.00047   27.4   2.8   23   85-107   330-352 (414)
309 PRK09134 short chain dehydroge  47.3      25 0.00053   24.2   3.0   23   84-106    19-41  (258)
310 PRK03562 glutathione-regulated  47.2      15 0.00033   29.5   2.2   24   84-107   409-432 (621)
311 cd08301 alcohol_DH_plants Plan  46.7      20 0.00042   26.3   2.5   24   84-107   197-221 (369)
312 PRK06123 short chain dehydroge  46.6      24 0.00052   23.9   2.9   23   83-105    11-33  (248)
313 PLN03154 putative allyl alcoho  46.5      25 0.00053   25.8   3.0   24   84-107   169-192 (348)
314 cd05280 MDR_yhdh_yhfp Yhdh and  46.2      21 0.00045   25.2   2.6   24   84-107   157-180 (325)
315 cd08239 THR_DH_like L-threonin  46.2      17 0.00037   26.2   2.1   24   84-107   173-197 (339)
316 COG4221 Short-chain alcohol de  46.1      23 0.00049   25.4   2.6   25   84-108    16-40  (246)
317 PRK08261 fabG 3-ketoacyl-(acyl  45.8      25 0.00053   26.7   3.0   23   84-106   220-242 (450)
318 PRK12937 short chain dehydroge  45.8      26 0.00056   23.7   2.9   24   83-106    14-37  (245)
319 PRK07201 short chain dehydroge  45.8      18  0.0004   28.6   2.4   24   84-107   381-404 (657)
320 TIGR03366 HpnZ_proposed putati  45.8      18 0.00038   25.5   2.1   24   84-107   130-154 (280)
321 CHL00139 rpl18 ribosomal prote  45.7      28 0.00061   21.7   2.8   24   84-107    64-87  (109)
322 COG0771 MurD UDP-N-acetylmuram  45.7      25 0.00055   27.4   3.0   25   83-107    15-39  (448)
323 PRK06249 2-dehydropantoate 2-r  45.7      26 0.00055   25.4   3.0   25   83-107    13-37  (313)
324 PRK04690 murD UDP-N-acetylmura  45.5      24 0.00051   27.3   2.9   23   84-106    17-39  (468)
325 PLN02178 cinnamyl-alcohol dehy  45.5      23 0.00051   26.3   2.8   24   84-107   188-211 (375)
326 PRK08324 short chain dehydroge  45.5      22 0.00048   28.8   2.8   24   84-107   432-455 (681)
327 PLN02206 UDP-glucuronate decar  45.3      23 0.00051   27.2   2.8   23   84-106   129-151 (442)
328 cd08244 MDR_enoyl_red Possible  45.1      22 0.00048   25.1   2.5   25   83-107   152-176 (324)
329 PLN02214 cinnamoyl-CoA reducta  45.0      26 0.00055   25.6   2.9   25   83-107    19-43  (342)
330 PRK12938 acetyacetyl-CoA reduc  44.8      29 0.00063   23.5   3.0   22   83-104    12-33  (246)
331 TIGR02632 RhaD_aldol-ADH rhamn  44.6      25 0.00055   28.5   3.0   24   84-107   424-447 (676)
332 PRK10754 quinone oxidoreductas  44.5      21 0.00046   25.4   2.4   24   84-107   151-174 (327)
333 PLN02427 UDP-apiose/xylose syn  44.5      27 0.00059   25.8   3.0   25   83-107    23-48  (386)
334 TIGR03201 dearomat_had 6-hydro  44.4      21 0.00045   26.0   2.4   24   84-107   176-199 (349)
335 TIGR02818 adh_III_F_hyde S-(hy  44.1      22 0.00047   26.2   2.4   24   84-107   195-219 (368)
336 cd08259 Zn_ADH5 Alcohol dehydr  44.0      22 0.00049   25.1   2.5   24   84-107   173-196 (332)
337 PLN02858 fructose-bisphosphate  43.9      20 0.00043   31.8   2.5   26   83-108    12-37  (1378)
338 TIGR01289 LPOR light-dependent  43.8      23  0.0005   25.5   2.5   25   83-107    12-37  (314)
339 cd08270 MDR4 Medium chain dehy  43.5      27  0.0006   24.4   2.8   24   84-107   143-166 (305)
340 cd08269 Zn_ADH9 Alcohol dehydr  43.5      21 0.00045   25.1   2.2   24   84-107   139-163 (312)
341 TIGR03589 PseB UDP-N-acetylglu  43.5      26 0.00057   25.4   2.8   27   81-107    11-39  (324)
342 cd08230 glucose_DH Glucose deh  43.1      27 0.00059   25.4   2.8   23   84-106   182-204 (355)
343 TIGR01470 cysG_Nterm siroheme   43.0      31 0.00066   23.7   2.9   24   84-107    18-41  (205)
344 TIGR01724 hmd_rel H2-forming N  42.9      28 0.00061   26.2   2.8   23   86-108    31-53  (341)
345 cd08300 alcohol_DH_class_III c  42.6      24 0.00052   25.9   2.5   24   84-107   196-220 (368)
346 PRK06300 enoyl-(acyl carrier p  42.1      33 0.00071   24.9   3.1   21   85-105    21-41  (299)
347 cd08291 ETR_like_1 2-enoyl thi  42.1      24 0.00051   25.3   2.3   24   84-107   154-177 (324)
348 PRK06718 precorrin-2 dehydroge  42.0      32  0.0007   23.5   2.9   24   84-107    19-42  (202)
349 PRK05593 rplR 50S ribosomal pr  41.9      34 0.00073   21.6   2.7   24   84-107    72-95  (117)
350 cd05276 p53_inducible_oxidored  41.9      28  0.0006   24.2   2.6   24   84-107   150-173 (323)
351 KOG0409|consensus               41.8      31 0.00068   25.7   2.9   26   83-108    43-68  (327)
352 cd08231 MDR_TM0436_like Hypoth  41.6      25 0.00054   25.6   2.4   24   84-107   187-211 (361)
353 cd08242 MDR_like Medium chain   41.2      24 0.00053   25.0   2.3   24   83-106   164-187 (319)
354 COG0794 GutQ Predicted sugar p  41.1      25 0.00055   24.4   2.2   24   84-107    51-74  (202)
355 PRK13771 putative alcohol dehy  41.1      28 0.00062   24.8   2.6   24   84-107   173-196 (334)
356 cd08293 PTGR2 Prostaglandin re  41.0      33 0.00072   24.6   3.0   24   84-107   165-189 (345)
357 cd08234 threonine_DH_like L-th  40.4      24 0.00051   25.2   2.1   24   84-107   169-193 (334)
358 PLN00198 anthocyanidin reducta  40.4      35 0.00075   24.7   3.0   24   83-106    18-41  (338)
359 PLN02740 Alcohol dehydrogenase  40.2      28 0.00062   25.7   2.6   24   84-107   208-232 (381)
360 TIGR00060 L18_bact ribosomal p  39.9      38 0.00083   21.3   2.7   23   85-107    70-92  (114)
361 cd08241 QOR1 Quinone oxidoredu  39.9      30 0.00064   24.1   2.5   24   84-107   150-173 (323)
362 cd05213 NAD_bind_Glutamyl_tRNA  39.8      25 0.00055   25.6   2.2   25   84-108   187-212 (311)
363 cd08253 zeta_crystallin Zeta-c  39.8      29 0.00064   24.1   2.5   24   84-107   155-178 (325)
364 PF13380 CoA_binding_2:  CoA bi  39.7      55  0.0012   20.2   3.4   25   84-108    13-37  (116)
365 PRK03806 murD UDP-N-acetylmura  39.5      36 0.00079   25.8   3.1   25   83-107    14-38  (438)
366 TIGR03451 mycoS_dep_FDH mycoth  39.4      27 0.00059   25.5   2.3   24   84-107   186-210 (358)
367 PRK12549 shikimate 5-dehydroge  39.3      29 0.00064   25.0   2.4   25   84-108   136-161 (284)
368 TIGR03026 NDP-sugDHase nucleot  39.3      39 0.00085   25.5   3.2   26   83-108   331-356 (411)
369 cd08246 crotonyl_coA_red croto  39.2      28 0.00062   25.7   2.4   24   84-107   204-227 (393)
370 PLN02586 probable cinnamyl alc  39.2      38 0.00083   24.9   3.1   23   84-106   193-215 (360)
371 cd08252 AL_MDR Arginate lyase   39.1      35 0.00075   24.3   2.8   25   83-107   159-184 (336)
372 COG1028 FabG Dehydrogenases wi  38.9      43 0.00093   22.8   3.2   24   84-107    15-38  (251)
373 cd08243 quinone_oxidoreductase  38.9      32  0.0007   24.0   2.6   23   84-106   153-175 (320)
374 PRK09880 L-idonate 5-dehydroge  38.8      31 0.00067   25.0   2.5   24   84-107   179-203 (343)
375 PF08004 DUF1699:  Protein of u  38.7      11 0.00024   24.3   0.1   32    5-36     39-73  (131)
376 PRK07679 pyrroline-5-carboxyla  38.7      33 0.00072   24.4   2.6   25   83-107    11-39  (279)
377 TIGR02823 oxido_YhdH putative   38.5      33 0.00072   24.3   2.6   23   84-106   156-178 (323)
378 cd01080 NAD_bind_m-THF_DH_Cycl  38.1      43 0.00094   22.3   2.9   24   84-107    53-77  (168)
379 cd05282 ETR_like 2-enoyl thioe  37.8      37 0.00079   23.9   2.7   23   84-106   149-171 (323)
380 cd05288 PGDH Prostaglandin deh  37.7      39 0.00084   23.9   2.9   24   84-107   156-179 (329)
381 PRK12746 short chain dehydroge  37.6      42 0.00092   22.8   3.0   22   83-104    15-36  (254)
382 cd05188 MDR Medium chain reduc  37.4      43 0.00092   22.7   2.9   23   85-107   145-167 (271)
383 TIGR02356 adenyl_thiF thiazole  37.4      40 0.00087   22.9   2.8   24   84-107    30-54  (202)
384 PRK08125 bifunctional UDP-gluc  37.4      34 0.00073   27.6   2.7   25   83-107   324-349 (660)
385 KOG1014|consensus               37.2      41  0.0009   25.0   2.9   25   84-108    59-83  (312)
386 cd08251 polyketide_synthase po  37.1      44 0.00095   23.0   3.0   25   83-107   130-154 (303)
387 PTZ00032 60S ribosomal protein  37.0      41 0.00089   23.5   2.7   23   85-107   167-189 (211)
388 cd08264 Zn_ADH_like2 Alcohol d  36.9      40 0.00087   23.9   2.8   23   84-106   173-195 (325)
389 TIGR01751 crot-CoA-red crotony  36.7      33 0.00071   25.5   2.4   23   84-106   200-222 (398)
390 cd08250 Mgc45594_like Mgc45594  36.7      36 0.00078   24.2   2.6   24   84-107   150-173 (329)
391 PF02579 Nitro_FeMo-Co:  Dinitr  36.4      39 0.00084   19.4   2.3   22   83-104    59-80  (94)
392 cd05286 QOR2 Quinone oxidoredu  36.4      36 0.00078   23.5   2.5   25   83-107   146-170 (320)
393 PF07287 DUF1446:  Protein of u  36.2      45 0.00098   25.3   3.1   32   24-55     64-96  (362)
394 PRK13302 putative L-aspartate   35.9      32 0.00068   24.7   2.1   25   83-107    14-41  (271)
395 PLN02948 phosphoribosylaminoim  35.6      45 0.00098   26.7   3.1   25   84-108    31-55  (577)
396 PRK06077 fabG 3-ketoacyl-(acyl  35.5      54  0.0012   22.2   3.2   23   83-105    15-37  (252)
397 cd08277 liver_alcohol_DH_like   35.4      44 0.00095   24.5   2.9   24   84-107   194-218 (365)
398 cd08266 Zn_ADH_like1 Alcohol d  35.3      49  0.0011   23.2   3.1   24   84-107   177-200 (342)
399 KOG1201|consensus               35.2      49  0.0011   24.5   3.0   25   85-109    49-73  (300)
400 cd08281 liver_ADH_like1 Zinc-d  35.0      34 0.00073   25.2   2.2   24   84-107   201-225 (371)
401 TIGR01202 bchC 2-desacetyl-2-h  35.0      35 0.00075   24.5   2.3   23   84-106   154-177 (308)
402 PRK08219 short chain dehydroge  35.0      30 0.00066   23.0   1.9   24   83-107    12-35  (227)
403 cd08260 Zn_ADH6 Alcohol dehydr  35.0      40 0.00086   24.3   2.6   25   83-107   174-198 (345)
404 TIGR02817 adh_fam_1 zinc-bindi  34.8      40 0.00087   24.0   2.6   23   84-106   159-182 (336)
405 PLN02986 cinnamyl-alcohol dehy  34.4      52  0.0011   23.5   3.1   26   81-106    12-37  (322)
406 PLN02686 cinnamoyl-CoA reducta  34.1      45 0.00098   24.7   2.8   23   84-106    63-85  (367)
407 cd08268 MDR2 Medium chain dehy  34.0      40 0.00086   23.5   2.4   24   84-107   155-178 (328)
408 PLN02514 cinnamyl-alcohol dehy  33.8      42  0.0009   24.6   2.6   23   84-106   190-212 (357)
409 PLN02520 bifunctional 3-dehydr  33.8      37  0.0008   26.9   2.4   24   84-107   388-411 (529)
410 cd08255 2-desacetyl-2-hydroxye  33.7      34 0.00075   23.6   2.0   24   84-107   107-131 (277)
411 cd08267 MDR1 Medium chain dehy  33.7      51  0.0011   23.0   2.9   23   84-106   154-176 (319)
412 cd08282 PFDH_like Pseudomonas   33.5      39 0.00085   24.9   2.4   24   84-107   186-210 (375)
413 smart00829 PKS_ER Enoylreducta  33.3      43 0.00094   22.7   2.5   25   83-107   114-138 (288)
414 PF03686 UPF0146:  Uncharacteri  33.2      49  0.0011   21.3   2.4   20   89-108    27-46  (127)
415 PRK15182 Vi polysaccharide bio  33.1      41 0.00088   25.9   2.4   25   83-108    14-38  (425)
416 cd08299 alcohol_DH_class_I_II_  32.8      41 0.00088   24.9   2.4   24   84-107   200-224 (373)
417 cd08254 hydroxyacyl_CoA_DH 6-h  32.7      42  0.0009   23.8   2.4   24   84-107   175-198 (338)
418 PTZ00354 alcohol dehydrogenase  32.6      45 0.00097   23.6   2.5   23   84-106   151-173 (334)
419 TIGR02354 thiF_fam2 thiamine b  32.4      58  0.0013   22.2   2.9   24   84-107    30-54  (200)
420 PRK15057 UDP-glucose 6-dehydro  32.3      56  0.0012   24.8   3.0   27   82-108   313-339 (388)
421 PRK14573 bifunctional D-alanyl  32.2      50  0.0011   27.4   3.0   25   83-107    12-37  (809)
422 TIGR02824 quinone_pig3 putativ  32.1      46   0.001   23.1   2.5   24   84-107   150-173 (325)
423 PRK14194 bifunctional 5,10-met  32.1      69  0.0015   23.6   3.4   24   85-108   170-193 (301)
424 PRK06947 glucose-1-dehydrogena  31.8      64  0.0014   21.9   3.1   22   83-104    11-32  (248)
425 cd00757 ThiF_MoeB_HesA_family   31.5      59  0.0013   22.5   2.9   23   84-106    30-53  (228)
426 cd08233 butanediol_DH_like (2R  31.3      46   0.001   24.0   2.4   24   84-107   182-206 (351)
427 cd08248 RTN4I1 Human Reticulon  31.1      61  0.0013   23.2   3.0   23   84-106   173-195 (350)
428 cd08261 Zn_ADH7 Alcohol dehydr  31.0      46 0.00099   23.9   2.3   23   84-106   169-191 (337)
429 KOG1208|consensus               30.6      54  0.0012   24.2   2.7   23   85-107    46-68  (314)
430 PF00185 OTCace:  Aspartate/orn  30.6      70  0.0015   20.9   3.0   26   82-107    11-36  (158)
431 COG0287 TyrA Prephenate dehydr  30.4      64  0.0014   23.4   3.0   25   83-107    11-37  (279)
432 cd08232 idonate-5-DH L-idonate  30.0      54  0.0012   23.5   2.6   24   84-107   175-199 (339)
433 PF10727 Rossmann-like:  Rossma  29.9      46   0.001   21.2   2.0   24   84-107    19-43  (127)
434 KOG0022|consensus               29.8      54  0.0012   24.8   2.5   24   84-107   202-226 (375)
435 cd08298 CAD2 Cinnamyl alcohol   29.8      65  0.0014   22.9   3.0   24   84-107   177-200 (329)
436 PF10686 DUF2493:  Protein of u  29.7      55  0.0012   18.6   2.1   31    6-36     31-62  (71)
437 PRK10309 galactitol-1-phosphat  29.7      44 0.00095   24.2   2.1   24   84-107   170-194 (347)
438 PRK01368 murD UDP-N-acetylmura  29.6      55  0.0012   25.3   2.7   23   83-106    14-36  (454)
439 PF12146 Hydrolase_4:  Putative  29.6      77  0.0017   18.1   2.8   20   88-107    33-52  (79)
440 cd08272 MDR6 Medium chain dehy  29.6      72  0.0016   22.2   3.1   23   84-106   155-177 (326)
441 cd05281 TDH Threonine dehydrog  29.4      51  0.0011   23.7   2.4   23   84-106   173-196 (341)
442 PLN00203 glutamyl-tRNA reducta  29.3      43 0.00093   26.6   2.1   25   84-108   275-300 (519)
443 cd08274 MDR9 Medium chain dehy  29.3      67  0.0015   23.0   3.0   23   84-106   188-210 (350)
444 PF13450 NAD_binding_8:  NAD(P)  29.1 1.1E+02  0.0023   16.9   3.2   24   85-108     6-29  (68)
445 PRK12557 H(2)-dependent methyl  29.0      59  0.0013   24.3   2.6   23   86-108    31-53  (342)
446 PRK15182 Vi polysaccharide bio  28.0      72  0.0016   24.5   3.0   25   83-107   332-356 (425)
447 PRK14175 bifunctional 5,10-met  27.8      86  0.0019   23.0   3.3   22   86-107   170-191 (286)
448 PF05675 DUF817:  Protein of un  27.4      66  0.0014   22.9   2.5   22   85-106   108-129 (235)
449 cd08286 FDH_like_ADH2 formalde  27.3      59  0.0013   23.4   2.4   23   84-106   176-199 (345)
450 COG1086 Predicted nucleoside-d  27.3      66  0.0014   26.1   2.7   24   84-107   260-284 (588)
451 PRK13982 bifunctional SbtC-lik  27.3      60  0.0013   25.5   2.5   22   84-105   282-303 (475)
452 cd05311 NAD_bind_2_malic_enz N  27.2      63  0.0014   22.5   2.4   24   84-107    34-60  (226)
453 COG3395 Uncharacterized protei  26.8      74  0.0016   24.6   2.9   28   80-107    87-114 (413)
454 COG0565 LasT rRNA methylase [T  26.7      92   0.002   22.3   3.2   27   81-108    13-40  (242)
455 PLN02353 probable UDP-glucose   26.7      78  0.0017   24.8   3.0   26   83-108   342-367 (473)
456 PLN02827 Alcohol dehydrogenase  26.3      62  0.0013   24.0   2.4   23   84-106   203-226 (378)
457 cd08284 FDH_like_2 Glutathione  26.1      63  0.0014   23.1   2.3   23   84-106   177-200 (344)
458 cd08297 CAD3 Cinnamyl alcohol   26.0      85  0.0018   22.4   3.0   24   84-107   176-199 (341)
459 cd08287 FDH_like_ADH3 formalde  25.9      56  0.0012   23.4   2.1   25   83-107   177-202 (345)
460 KOG3553|consensus               25.6      52  0.0011   20.5   1.6   41    7-47     33-76  (124)
461 PRK06416 dihydrolipoamide dehy  25.1      85  0.0018   23.9   3.0   24   84-107   181-204 (462)
462 cd08265 Zn_ADH3 Alcohol dehydr  24.7      69  0.0015   23.7   2.4   23   84-106   213-236 (384)
463 PRK11064 wecC UDP-N-acetyl-D-m  24.1      91   0.002   23.8   3.0   26   83-108   338-364 (415)
464 cd05284 arabinose_DH_like D-ar  24.0      71  0.0015   22.8   2.3   24   84-107   177-201 (340)
465 cd00853 NifX NifX belongs to a  23.7      73  0.0016   18.9   2.0   23   83-105    67-89  (102)
466 PF06057 VirJ:  Bacterial virul  23.7      99  0.0021   21.3   2.8   22   85-106    16-37  (192)
467 cd08279 Zn_ADH_class_III Class  23.7      72  0.0016   23.3   2.3   23   84-106   192-215 (363)
468 cd08278 benzyl_alcohol_DH Benz  23.6      76  0.0017   23.2   2.4   24   84-107   196-220 (365)
469 PRK07688 thiamine/molybdopteri  23.3      95  0.0021   23.1   2.9   24   84-107    33-57  (339)
470 PRK14189 bifunctional 5,10-met  23.1 1.1E+02  0.0024   22.3   3.1   21   86-106   170-190 (285)
471 cd05289 MDR_like_2 alcohol deh  23.1 1.1E+02  0.0023   21.1   3.0   23   84-106   155-177 (309)
472 cd08285 NADP_ADH NADP(H)-depen  23.1      79  0.0017   22.8   2.4   24   84-107   176-200 (351)
473 cd01980 Chlide_reductase_Y Chl  23.1 2.5E+02  0.0053   21.4   5.1   81   24-104   219-309 (416)
474 PRK07846 mycothione reductase;  22.9   1E+02  0.0022   23.6   3.1   24   84-107   175-198 (451)
475 cd08256 Zn_ADH2 Alcohol dehydr  22.8      70  0.0015   23.1   2.1   23   84-106   184-207 (350)
476 TIGR03452 mycothione_red mycot  22.8      94   0.002   23.8   2.8   24   84-107   178-201 (452)
477 PRK07251 pyridine nucleotide-d  22.4   1E+02  0.0022   23.3   3.0   24   84-107   166-189 (438)
478 TIGR01139 cysK cysteine syntha  22.4 1.1E+02  0.0024   21.9   3.0   24   83-106    65-88  (298)
479 cd00562 NifX_NifB This CD repr  22.3      62  0.0013   18.8   1.5   23   83-105    67-89  (102)
480 PRK09422 ethanol-active dehydr  22.2      92   0.002   22.2   2.6   24   84-107   172-196 (338)
481 cd08240 6_hydroxyhexanoate_dh_  22.1      83  0.0018   22.7   2.4   23   84-106   185-208 (350)
482 PRK14192 bifunctional 5,10-met  22.1 1.1E+02  0.0024   22.2   3.0   22   86-107   171-192 (283)
483 PRK11730 fadB multifunctional   22.1      77  0.0017   26.1   2.3   25   84-108   322-346 (715)
484 PRK06116 glutathione reductase  22.0 1.1E+02  0.0024   23.3   3.0   24   84-107   176-199 (450)
485 PRK13512 coenzyme A disulfide   22.0      97  0.0021   23.6   2.8   24   84-107   157-180 (438)
486 cd05285 sorbitol_DH Sorbitol d  22.0      75  0.0016   22.9   2.1   23   84-106   172-195 (343)
487 PRK12475 thiamine/molybdopteri  22.0 1.1E+02  0.0023   22.9   2.9   24   84-107    33-57  (338)
488 KOG1203|consensus               22.0      93   0.002   24.1   2.6   24   84-107    89-112 (411)
489 cd00852 NifB NifB belongs to a  21.9      82  0.0018   18.8   2.0   24   83-106    71-94  (106)
490 cd05195 enoyl_red enoyl reduct  21.9 1.2E+02  0.0025   20.5   3.0   24   83-106   118-141 (293)
491 TIGR01421 gluta_reduc_1 glutat  21.8   1E+02  0.0022   23.6   2.8   24   84-107   175-198 (450)
492 TIGR01809 Shik-DH-AROM shikima  21.8      86  0.0019   22.5   2.3   25   84-108   134-159 (282)
493 PRK05225 ketol-acid reductoiso  21.8      45 0.00097   26.3   0.9   19   84-107    45-63  (487)
494 cd08290 ETR 2-enoyl thioester   21.6   1E+02  0.0023   21.9   2.8   23   84-106   157-179 (341)
495 cd08273 MDR8 Medium chain dehy  21.5 1.1E+02  0.0025   21.5   2.9   24   83-106   149-172 (331)
496 PTZ00434 cytosolic glyceraldeh  21.4 1.1E+02  0.0023   23.3   2.8   24   82-105    10-38  (361)
497 cd08263 Zn_ADH10 Alcohol dehyd  21.4      79  0.0017   23.1   2.1   23   84-106   197-220 (367)
498 COG1992 Uncharacterized conser  21.3 1.2E+02  0.0026   20.8   2.8   51   43-108    69-119 (181)
499 TIGR01138 cysM cysteine syntha  21.3 1.2E+02  0.0026   21.9   3.0   24   83-106    67-90  (290)
500 TIGR02440 FadJ fatty oxidation  21.3      83  0.0018   25.9   2.4   25   84-108   313-338 (699)

No 1  
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]
Probab=100.00  E-value=1.2e-32  Score=200.36  Aligned_cols=106  Identities=27%  Similarity=0.312  Sum_probs=96.5

Q ss_pred             cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc----c
Q psy15800          2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ----H   77 (109)
Q Consensus         2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~----~   77 (109)
                      |+ .+|+||+|++.|+||||||+++++++||.|+|+|++++++||||+++++|++.|++.+.++.+++|+|..+.    .
T Consensus        61 l~-~~p~LKlIa~~~~G~D~vDl~aa~~~gI~Vtnvp~~~t~sVAe~~~aLiLa~~R~~~~~~~~~r~g~w~~~~~~~~~  139 (324)
T COG1052          61 LE-KLPGLKLIATRSAGYDNVDLEAAKERGITVTNVPGYSTEAVAEHAVALILALARRIHEGDRRVREGNWSLSGGPDPL  139 (324)
T ss_pred             HH-hCCCcEEEEEeccccCcccHHHHHHCCcEEEeCCCCCchHHHHHHHHHHHHHhhchHHHHHHHhcCcccccCCcccc
Confidence            44 569999999999999999999999999999999999999999999999999999999999999999997653    2


Q ss_pred             hhhhhc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         78 AITELI---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        78 ~~~~l~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .+.++.         |+||+++|+++++|||+|+||||++
T Consensus       140 ~~~~l~gktvGIiG~GrIG~avA~r~~~Fgm~v~y~~~~~  179 (324)
T COG1052         140 LGFDLRGKTLGIIGLGRIGQAVARRLKGFGMKVLYYDRSP  179 (324)
T ss_pred             cccCCCCCEEEEECCCHHHHHHHHHHhcCCCEEEEECCCC
Confidence            233332         7999999999999999999999986


No 2  
>PRK08410 2-hydroxyacid dehydrogenase; Provisional
Probab=99.97  E-value=6.3e-31  Score=190.65  Aligned_cols=104  Identities=19%  Similarity=0.261  Sum_probs=94.0

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccc------h
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQH------A   78 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~------~   78 (109)
                      .+|+||||++.|+|+|+||++++.++||.|+|+||+++++||||+++++|++.|+++.+++.+++|+|.....      .
T Consensus        60 ~~~~Lk~I~~~~~G~d~id~~~~~~~gI~v~n~~g~~~~~VAE~a~~l~L~~~R~~~~~~~~~~~g~w~~~~~~~~~~~~  139 (311)
T PRK08410         60 QLPNLKLICITATGTNNVDIEYAKKKGIAVKNVAGYSTESVAQHTFAMLLSLLGRINYYDRYVKSGEYSESPIFTHISRP  139 (311)
T ss_pred             hCCCCeEEEEcccccccccHHHHHhCCCEEEcCCCCCChHHHHHHHHHHHHHHhCHHHHHHHHHcCCCCcCCCccccCcc
Confidence            6899999999999999999999999999999999999999999999999999999999999999999964311      1


Q ss_pred             hhhhc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         79 ITELI---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        79 ~~~l~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      +.++.         |+||+++|+++++|||+|++|||+.
T Consensus       140 ~~~L~gktvGIiG~G~IG~~vA~~~~~fgm~V~~~d~~~  178 (311)
T PRK08410        140 LGEIKGKKWGIIGLGTIGKRVAKIAQAFGAKVVYYSTSG  178 (311)
T ss_pred             ccccCCCEEEEECCCHHHHHHHHHHhhcCCEEEEECCCc
Confidence            12333         7899999999999999999999864


No 3  
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]
Probab=99.97  E-value=7.1e-31  Score=191.10  Aligned_cols=104  Identities=26%  Similarity=0.282  Sum_probs=95.8

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhhc-
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELI-   83 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l~-   83 (109)
                      .+|+||||++.++|+|+||++++.++||.|+|+|+.++.+||||+++++|+++|+++.+++.+++|.|.+....+.++. 
T Consensus        63 ~~~~Lk~I~~~g~Gvd~id~~~~~~~gi~V~nap~~na~~vAE~~~~~~L~~~R~~~~~~~~~~~g~W~~~~~~g~el~g  142 (324)
T COG0111          63 AAPNLKAIGRAGAGVDNIDLEAATKRGILVVNAPGGNAISVAELVLALLLALARRIPDADASQRRGEWDRKAFRGTELAG  142 (324)
T ss_pred             hCCCceEEEEccccccccCHHHHhhcCCEEEeCCCcchHHHHHHHHHHHHHHhcCchhhHHHHHcCCccccccccccccC
Confidence            6899999999999999999999999999999999999999999999999999999999999999999986333334443 


Q ss_pred             --------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 --------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 --------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                              |+||+++|+++++|||+|++|||+.
T Consensus       143 kTvGIiG~G~IG~~va~~l~afgm~v~~~d~~~  175 (324)
T COG0111         143 KTVGIIGLGRIGRAVAKRLKAFGMKVIGYDPYS  175 (324)
T ss_pred             CEEEEECCCHHHHHHHHHHHhCCCeEEEECCCC
Confidence                    7899999999999999999999964


No 4  
>PRK06487 glycerate dehydrogenase; Provisional
Probab=99.97  E-value=4e-30  Score=186.90  Aligned_cols=103  Identities=21%  Similarity=0.284  Sum_probs=93.4

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccc------h
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQH------A   78 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~------~   78 (109)
                      .+|+||||++.++|+|++|++++.++||.|+|+||+++++||||++++||++.|+++.+++.+++|.|.....      .
T Consensus        63 ~~~~Lk~I~~~~~G~d~id~~~~~~~gI~v~n~~g~~~~~vAE~~~~~~L~~~R~~~~~~~~~~~g~W~~~~~~~~~~~~  142 (317)
T PRK06487         63 AAPQLKLILVAATGTNNVDLAAARERGITVCNCQGYGTPSVAQHTLALLLALATRLPDYQQAVAAGRWQQSSQFCLLDFP  142 (317)
T ss_pred             hCCCCeEEEEcCccccccCHHHHHHCCCEEEeCCCCCcchHHHHHHHHHHHHHcCHHHHHHHHHcCCCccCcccccccCc
Confidence            5899999999999999999999999999999999999999999999999999999999999999999964421      1


Q ss_pred             hhhhc---------cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         79 ITELI---------TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        79 ~~~l~---------G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.++.         |+||+++|+++++|||+|++|||+
T Consensus       143 ~~~l~gktvgIiG~G~IG~~vA~~l~~fgm~V~~~~~~  180 (317)
T PRK06487        143 IVELEGKTLGLLGHGELGGAVARLAEAFGMRVLIGQLP  180 (317)
T ss_pred             ccccCCCEEEEECCCHHHHHHHHHHhhCCCEEEEECCC
Confidence            12332         789999999999999999999986


No 5  
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional
Probab=99.97  E-value=4.1e-30  Score=187.23  Aligned_cols=106  Identities=21%  Similarity=0.246  Sum_probs=94.9

Q ss_pred             cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc---ch
Q psy15800          2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ---HA   78 (109)
Q Consensus         2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~---~~   78 (109)
                      |+ .+|+||+|++.++|+|+||++++.++||.|+|+||+++++||||++++||++.|+++.+++.+++|+|....   ..
T Consensus        61 l~-~~p~Lk~I~~~g~G~d~id~~~~~~~gI~V~n~~~~~~~~VAE~~~~l~L~~~R~i~~~~~~~~~g~w~~~~~~~~~  139 (323)
T PRK15409         61 LE-KMPKLRAASTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVEVAERVKAGEWTASIGPDWF  139 (323)
T ss_pred             Hh-hCCCCeEEEECceecccccHHHHHHCCCEEEeCCCCCchHHHHHHHHHHHHHHcCHHHHHHHHHcCCCcccCccccc
Confidence            44 689999999999999999999999999999999999999999999999999999999999999999996431   12


Q ss_pred             hhhhc---------cchHHHHHHHHh-hcCCEEEEEcccc
Q psy15800         79 ITELI---------TQSDTNHTQRCL-ASIMQLVYSTCYN  108 (109)
Q Consensus        79 ~~~l~---------G~IG~~va~~~~-~fg~~V~~~~r~~  108 (109)
                      +.++.         |+||+++|++++ +|||+|+||||+.
T Consensus       140 g~~L~gktvGIiG~G~IG~~va~~l~~~fgm~V~~~~~~~  179 (323)
T PRK15409        140 GTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRH  179 (323)
T ss_pred             cCCCCCCEEEEEcccHHHHHHHHHHHhcCCCEEEEECCCC
Confidence            33443         789999999998 9999999999874


No 6  
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=99.96  E-value=4.7e-30  Score=191.78  Aligned_cols=104  Identities=22%  Similarity=0.232  Sum_probs=94.8

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhhc-
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELI-   83 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l~-   83 (109)
                      .+|+||||++.|+|+|+||++++.++||.|+|+||+++.+||||+++++|++.|+++.+++.+++|+|......+.+|. 
T Consensus        72 ~~~~Lk~I~~~~~G~d~id~~~~~~~gI~V~n~pg~~~~aVAE~~i~l~L~~~R~~~~~~~~~~~g~w~~~~~~~~~L~g  151 (409)
T PRK11790         72 AAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGEIILLLRGIPEKNAKAHRGGWNKSAAGSFEVRG  151 (409)
T ss_pred             hCCCCeEEEECceecccccHHHHHhCCCEEEeCCCCChHHHHHHHHHHHHHHHcChHHHHHHHHcCcccccccCcccCCC
Confidence            6899999999999999999999999999999999999999999999999999999999999999999975432233443 


Q ss_pred             --------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 --------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 --------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                              |+||+++|+++++|||+|++|||+.
T Consensus       152 ktvGIiG~G~IG~~vA~~~~~fGm~V~~~d~~~  184 (409)
T PRK11790        152 KTLGIVGYGHIGTQLSVLAESLGMRVYFYDIED  184 (409)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCc
Confidence                    7899999999999999999999864


No 7  
>PRK13243 glyoxylate reductase; Reviewed
Probab=99.96  E-value=1.7e-29  Score=184.69  Aligned_cols=104  Identities=22%  Similarity=0.365  Sum_probs=94.1

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc----c---
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ----H---   77 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~----~---   77 (109)
                      .+|+||||++.++|+|+||++++.++||.|+|+||+++++||||+++++|++.|+++.+++.+++|.|....    +   
T Consensus        64 ~~p~Lk~I~~~~~G~d~id~~~~~~~gI~v~n~~g~~~~~vAE~~~~l~L~~~R~~~~~~~~~~~g~W~~~~~~~~~~~~  143 (333)
T PRK13243         64 AAPRLRIVANYAVGYDNIDVEEATRRGIYVTNTPGVLTEATADFAWALLLATARRLVEADHFVRSGEWKRRGVAWHPLMF  143 (333)
T ss_pred             hCCCCeEEEecCccccccCHHHHHHcCCEEEECCCCChHHHHHHHHHHHHHHHhCHHHHHHHHHcCCCCccccccccccc
Confidence            689999999999999999999999999999999999999999999999999999999999999999996421    1   


Q ss_pred             hhhhhc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         78 AITELI---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        78 ~~~~l~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .+.++.         |+||+.+|+++++|||+|++|||+.
T Consensus       144 ~g~~L~gktvgIiG~G~IG~~vA~~l~~~G~~V~~~d~~~  183 (333)
T PRK13243        144 LGYDVYGKTIGIIGFGRIGQAVARRAKGFGMRILYYSRTR  183 (333)
T ss_pred             cccCCCCCEEEEECcCHHHHHHHHHHHHCCCEEEEECCCC
Confidence            223443         7899999999999999999999874


No 8  
>PRK06932 glycerate dehydrogenase; Provisional
Probab=99.96  E-value=1.8e-29  Score=183.32  Aligned_cols=104  Identities=22%  Similarity=0.196  Sum_probs=93.4

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccc------h
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQH------A   78 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~------~   78 (109)
                      .+|+||||++.++|+|+||.+++.++||.|+|+||+++++||||+++++|++.|+++.+++.++++.|.....      .
T Consensus        62 ~~~~Lk~I~~~~~G~d~id~~~~~~~gI~v~n~~g~~~~~vAE~~i~l~l~~~R~~~~~~~~~~~~~W~~~~~~~~~~~~  141 (314)
T PRK06932         62 QLPKLKLIAITATGTNNVDLVAAKELGIAVKNVTGYSSTTVPEHVLGMIFALKHSLMGWYRDQLSDRWATCKQFCYFDYP  141 (314)
T ss_pred             hCcCCeEEEEecccccccCHHHHHhCCCEEEeCCCCChhHHHHHHHHHHHHHHhChHHHHHHHHcCCCCcCccccccCCc
Confidence            6899999999999999999999999999999999999999999999999999999999999999999964311      1


Q ss_pred             hhhhc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         79 ITELI---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        79 ~~~l~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      +.++.         |+||+++|+++++|||+|++|||+.
T Consensus       142 ~~~l~gktvgIiG~G~IG~~va~~l~~fg~~V~~~~~~~  180 (314)
T PRK06932        142 ITDVRGSTLGVFGKGCLGTEVGRLAQALGMKVLYAEHKG  180 (314)
T ss_pred             ccccCCCEEEEECCCHHHHHHHHHHhcCCCEEEEECCCc
Confidence            12332         7899999999999999999999853


No 9  
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase. This model represents a long form of D-3-phosphoglycerate dehydrogenase, the serA gene of one pathway of serine biosynthesis. Shorter forms, scoring between trusted and noise cutoff, include SerA from E. coli.
Probab=99.96  E-value=9e-29  Score=189.68  Aligned_cols=105  Identities=24%  Similarity=0.285  Sum_probs=95.3

Q ss_pred             cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhh
Q psy15800          2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITE   81 (109)
Q Consensus         2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~   81 (109)
                      |+ .+|+||||+..++|+|+||++++.++||.|+|+||+++.+||||++++||++.|+++.+++.+++|+|.+....+.+
T Consensus        57 l~-~~~~Lk~I~~~~~G~d~id~~~~~~~gI~V~n~pg~~~~~vAE~~~~l~L~~~R~~~~~~~~~~~g~W~~~~~~g~~  135 (525)
T TIGR01327        57 IA-AAPKLKVIGRAGVGVDNIDIEAATARGILVVNAPTGNTISAAEHALAMLLAAARNIPQADASLKEGEWDRKAFMGTE  135 (525)
T ss_pred             Hh-hCCCceEEEECCcccchhcHHHHHHCCCEEEeCCCcChHHHHHHHHHHHHHHhcCHHHHHHHHHcCCccccccCccc
Confidence            44 58999999999999999999999999999999999999999999999999999999999999999999754323334


Q ss_pred             hc---------cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 LI---------TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l~---------G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.         |+||+++|+++++|||+|++|||+
T Consensus       136 l~gktvgIiG~G~IG~~vA~~l~~fG~~V~~~d~~  170 (525)
T TIGR01327       136 LYGKTLGVIGLGRIGSIVAKRAKAFGMKVLAYDPY  170 (525)
T ss_pred             cCCCEEEEECCCHHHHHHHHHHHhCCCEEEEECCC
Confidence            43         789999999999999999999986


No 10 
>PLN03139 formate dehydrogenase; Provisional
Probab=99.96  E-value=1.5e-28  Score=182.22  Aligned_cols=104  Identities=22%  Similarity=0.241  Sum_probs=93.8

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc--chhhhh
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ--HAITEL   82 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~--~~~~~l   82 (109)
                      .+|+||||++.++|+|+||++++.++||.|+|++|+++++||||++++||++.|++..+++.+++|.|....  ..+.++
T Consensus       118 ~ap~LK~I~~~g~G~D~iDl~aa~~~gI~V~n~~g~na~sVAE~al~liL~l~R~~~~~~~~~~~g~W~~~~~~~~~~~L  197 (386)
T PLN03139        118 KAKNLELLLTAGIGSDHIDLPAAAAAGLTVAEVTGSNVVSVAEDELMRILILLRNFLPGYHQVVSGEWNVAGIAYRAYDL  197 (386)
T ss_pred             hCCCccEEEECCccccccCHHHHHHCCeEEEECCCcCcHHHHHHHHHHHHHHHcCcHHHHHHHHhCCCccccccCCCcCC
Confidence            589999999999999999999999999999999999999999999999999999999999999999996421  122333


Q ss_pred             c---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 I---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .         |+||+.+|+++++|||+|++|||+.
T Consensus       198 ~gktVGIVG~G~IG~~vA~~L~afG~~V~~~d~~~  232 (386)
T PLN03139        198 EGKTVGTVGAGRIGRLLLQRLKPFNCNLLYHDRLK  232 (386)
T ss_pred             CCCEEEEEeecHHHHHHHHHHHHCCCEEEEECCCC
Confidence            2         7899999999999999999999874


No 11 
>PRK07574 formate dehydrogenase; Provisional
Probab=99.95  E-value=1.7e-28  Score=182.05  Aligned_cols=104  Identities=23%  Similarity=0.267  Sum_probs=94.2

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc--chhhhh
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ--HAITEL   82 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~--~~~~~l   82 (109)
                      .+|+||||++.++|+|+||++++.++||.|+|+++.++++||||+++++|++.|++..+++.+++|+|....  ..+.++
T Consensus       111 ~~p~LK~I~~~g~G~D~id~~aa~~~gI~V~n~~g~~a~~VAE~al~l~L~l~R~~~~~~~~~~~g~W~~~~~~~~~~~L  190 (385)
T PRK07574        111 KAPNLKLAITAGIGSDHVDLQAASEHGITVAEVTGSNSISVAEHVVMMILALVRNYEPSHRQAVEGGWNIADCVSRSYDL  190 (385)
T ss_pred             hCCCCcEEEECCcccccccHHHHHHCCcEEEcCCCCchHHHHHHHHHHHHHHHcCHHHHHHHHHhCCCCcccccccceec
Confidence            689999999999999999999999999999999999999999999999999999999999999999996432  112233


Q ss_pred             c---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 I---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .         |+||+.+|++|++|||+|++|||+.
T Consensus       191 ~gktVGIvG~G~IG~~vA~~l~~fG~~V~~~dr~~  225 (385)
T PRK07574        191 EGMTVGIVGAGRIGLAVLRRLKPFDVKLHYTDRHR  225 (385)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHhCCCEEEEECCCC
Confidence            2         7899999999999999999999974


No 12 
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=99.95  E-value=2.2e-28  Score=187.58  Aligned_cols=106  Identities=26%  Similarity=0.316  Sum_probs=95.5

Q ss_pred             cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhh
Q psy15800          2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITE   81 (109)
Q Consensus         2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~   81 (109)
                      |+ .+|+||||++.|+|+|++|++++.++||.|+|+|++++.+||||+++++|++.|+++.+++.+++|.|.+....+.+
T Consensus        59 l~-~~~~Lk~I~~~~~G~d~id~~~~~~~gI~V~n~p~~~~~~vAE~~l~l~L~~~R~~~~~~~~~~~g~W~~~~~~g~~  137 (526)
T PRK13581         59 LE-AAKNLKVIGRAGVGVDNVDVPAATRRGIIVVNAPTGNTISAAEHTIALMLALARNIPQAHASLKAGKWERKKFMGVE  137 (526)
T ss_pred             Hh-hCCCCeEEEECCcccccccHHHHHHCCCEEEeCCCCChHHHHHHHHHHHHHHHcCHHHHHHHHHcCCCCccCccccc
Confidence            44 68999999999999999999999999999999999999999999999999999999999999999999753322333


Q ss_pred             hc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         82 LI---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        82 l~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      +.         |+||+.+|+++++|||+|++|||+.
T Consensus       138 l~gktvgIiG~G~IG~~vA~~l~~fG~~V~~~d~~~  173 (526)
T PRK13581        138 LYGKTLGIIGLGRIGSEVAKRAKAFGMKVIAYDPYI  173 (526)
T ss_pred             cCCCEEEEECCCHHHHHHHHHHHhCCCEEEEECCCC
Confidence            32         7899999999999999999999863


No 13 
>PLN02306 hydroxypyruvate reductase
Probab=99.95  E-value=5.4e-28  Score=179.48  Aligned_cols=104  Identities=21%  Similarity=0.292  Sum_probs=92.3

Q ss_pred             CCCC--ceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccc---hh
Q psy15800          5 AGEN--LKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQH---AI   79 (109)
Q Consensus         5 ~~p~--Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~---~~   79 (109)
                      .+|+  ||+|++.++|+|+||++++.++||+|+|+||+++++||||+++++|++.|+++.+++.+++|+|..+.+   .+
T Consensus        81 ~~~~l~lk~I~~~~~G~D~iD~~aa~~~gI~V~n~pg~~~~~VAE~al~liLal~R~i~~~~~~~~~g~w~~~~~~~~~g  160 (386)
T PLN02306         81 ALSKAGGKAFSNMAVGYNNVDVEAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYEGWLPHLFVG  160 (386)
T ss_pred             hCCcCCceEEEECCcccccccHHHHHHCCCEEEECCCcCHHHHHHHHHHHHHHHHhChHHHHHHHHcCCCccccccccCC
Confidence            4674  699999999999999999999999999999999999999999999999999999999999999864421   23


Q ss_pred             hhhc---------cchHHHHHHHHh-hcCCEEEEEcccc
Q psy15800         80 TELI---------TQSDTNHTQRCL-ASIMQLVYSTCYN  108 (109)
Q Consensus        80 ~~l~---------G~IG~~va~~~~-~fg~~V~~~~r~~  108 (109)
                      .++.         |+||+++|++++ +|||+|++|||+.
T Consensus       161 ~~L~gktvGIiG~G~IG~~vA~~l~~~fGm~V~~~d~~~  199 (386)
T PLN02306        161 NLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQ  199 (386)
T ss_pred             cCCCCCEEEEECCCHHHHHHHHHHHhcCCCEEEEECCCC
Confidence            3343         789999999985 9999999999874


No 14 
>PLN02928 oxidoreductase family protein
Probab=99.94  E-value=5.5e-27  Score=172.24  Aligned_cols=101  Identities=17%  Similarity=0.212  Sum_probs=91.3

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCC---CccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhh
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPV---SSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITE   81 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~---~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~   81 (109)
                      .+|+||||++.++|+|++|++++.++||.|+|+|++   ++.+||||+++++|++.|++..+.+.++++.|...  .+.+
T Consensus        79 ~~~~Lk~I~~~~~G~d~id~~~~~~~gi~v~n~~~~~~~~~~~vAE~av~l~L~~~R~~~~~~~~~~~~~w~~~--~~~~  156 (347)
T PLN02928         79 RASQMKLIMQFGVGLEGVDVDAATKHGIKVARIPSEGTGNAASCAEMAIYLMLGLLRKQNEMQISLKARRLGEP--IGDT  156 (347)
T ss_pred             cCCCceEEEECCcccCcCcHHHHHhCCCEEEECCCCCCcChHHHHHHHHHHHHHHHhCHHHHHHHHHcCCcccc--cccC
Confidence            589999999999999999999999999999999985   78999999999999999999999999999999542  2222


Q ss_pred             h---------ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 L---------ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l---------~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +         .|+||+++|+++++|||+|++|||+
T Consensus       157 l~gktvGIiG~G~IG~~vA~~l~afG~~V~~~dr~  191 (347)
T PLN02928        157 LFGKTVFILGYGAIGIELAKRLRPFGVKLLATRRS  191 (347)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHhhCCCEEEEECCC
Confidence            3         2799999999999999999999986


No 15 
>PRK12480 D-lactate dehydrogenase; Provisional
Probab=99.94  E-value=5.3e-27  Score=171.32  Aligned_cols=104  Identities=18%  Similarity=0.217  Sum_probs=91.5

Q ss_pred             CCC--CceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc-chhhh
Q psy15800          5 AGE--NLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ-HAITE   81 (109)
Q Consensus         5 ~~p--~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~-~~~~~   81 (109)
                      .+|  +||+|++.++|+|+||++++.++||.|+|+|++++++||||+++++|++.|+++.+++.+++|.|.... ..+.+
T Consensus        64 ~~~~~~Lk~I~~~~~G~d~id~~~~~~~gI~v~n~~~~~~~~vAE~~~~l~L~~~R~~~~~~~~~~~~~~~w~~~~~~~~  143 (330)
T PRK12480         64 KLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKP  143 (330)
T ss_pred             hhhhcCceEEEecccccchhhHHHHHHCCCEEEeCCCCChHHHHHHHHHHHHHHHHhHHHHHHHHHhCCcccccccCccc
Confidence            455  899999999999999999999999999999999999999999999999999999999999998763211 12233


Q ss_pred             hc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         82 LI---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        82 l~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      +.         |.||+.+|+++++|||+|++|||+.
T Consensus       144 l~g~~VgIIG~G~IG~~vA~~L~~~G~~V~~~d~~~  179 (330)
T PRK12480        144 VKNMTVAIIGTGRIGAATAKIYAGFGATITAYDAYP  179 (330)
T ss_pred             cCCCEEEEECCCHHHHHHHHHHHhCCCEEEEEeCCh
Confidence            32         7899999999999999999999874


No 16 
>PRK06436 glycerate dehydrogenase; Provisional
Probab=99.94  E-value=2.5e-26  Score=166.14  Aligned_cols=101  Identities=20%  Similarity=0.178  Sum_probs=89.1

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhhc-
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELI-   83 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l~-   83 (109)
                      .+|+||||++.++|+|++|.+++.++++.++|. |.++++||||+++++|++.|+++.+.+.+++|+|....  ..++. 
T Consensus        46 ~~~~Lk~I~~~~aG~D~id~~~~~~~~i~~~~~-g~~~~~VAE~~l~l~L~l~R~i~~~~~~~~~g~w~~~~--~~~L~g  122 (303)
T PRK06436         46 PGKKTKMIQSLSAGVDHIDVSGIPENVVLCSNA-GAYSISVAEHAFALLLAWAKNICENNYNMKNGNFKQSP--TKLLYN  122 (303)
T ss_pred             CCCCeEEEEECCcccCcccHHHHHhCCeEEEcC-CCCcHHHHHHHHHHHHHHHcChHHHHHHHHcCCCCCCC--CCCCCC
Confidence            468999999999999999999999888777775 77899999999999999999999999999999997432  22332 


Q ss_pred             --------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 --------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 --------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                              |+||+++|+++++|||+|++|||+.
T Consensus       123 ktvgIiG~G~IG~~vA~~l~afG~~V~~~~r~~  155 (303)
T PRK06436        123 KSLGILGYGGIGRRVALLAKAFGMNIYAYTRSY  155 (303)
T ss_pred             CEEEEECcCHHHHHHHHHHHHCCCEEEEECCCC
Confidence                    7899999999999999999999864


No 17 
>PRK08605 D-lactate dehydrogenase; Validated
Probab=99.93  E-value=2.5e-26  Score=167.92  Aligned_cols=104  Identities=16%  Similarity=0.152  Sum_probs=91.7

Q ss_pred             CCCC--ceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc-chhhh
Q psy15800          5 AGEN--LKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ-HAITE   81 (109)
Q Consensus         5 ~~p~--Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~-~~~~~   81 (109)
                      .+|+  ||+|++.|+|+|++|++++.++||.|+|+||+++++||||+++++|++.|++..+++.+++|.|.... ..+.+
T Consensus        64 ~~~~~~lk~I~~~~~G~d~id~~~~~~~gi~v~n~~~~~~~~vAE~~~~~~l~~~R~~~~~~~~~~~~~~~~~~~~~~~~  143 (332)
T PRK08605         64 LLNELGIKQIAQRSAGFDTYDLELATKYNLIISNVPSYSPESIAEFTVTQAINLVRHFNQIQTKVREHDFRWEPPILSRS  143 (332)
T ss_pred             hhhhcCceEEEEcccccchhhHHHHHHCCCEEEeCCCCChHHHHHHHHHHHHHHhcChHHHHHHHHhCCcccccccccce
Confidence            5676  99999999999999999999999999999999999999999999999999999999999999873211 12333


Q ss_pred             hc---------cchHHHHHHHH-hhcCCEEEEEcccc
Q psy15800         82 LI---------TQSDTNHTQRC-LASIMQLVYSTCYN  108 (109)
Q Consensus        82 l~---------G~IG~~va~~~-~~fg~~V~~~~r~~  108 (109)
                      +.         |.||+.+|+++ ++|||+|++|||+.
T Consensus       144 l~g~~VgIIG~G~IG~~vA~~L~~~~g~~V~~~d~~~  180 (332)
T PRK08605        144 IKDLKVAVIGTGRIGLAVAKIFAKGYGSDVVAYDPFP  180 (332)
T ss_pred             eCCCEEEEECCCHHHHHHHHHHHhcCCCEEEEECCCc
Confidence            43         78999999999 79999999999864


No 18 
>KOG0069|consensus
Probab=99.93  E-value=3.2e-26  Score=166.34  Aligned_cols=105  Identities=30%  Similarity=0.420  Sum_probs=93.4

Q ss_pred             ccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccc---h-
Q psy15800          3 SRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQH---A-   78 (109)
Q Consensus         3 ~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~---~-   78 (109)
                      .+.+|+||+|.+.|+|+||||+++|+++||+|+|+|+...++|||++++++|.+.|++...++.+++|+| .+..   . 
T Consensus        79 ~a~~p~lK~i~t~~vG~D~vDl~a~~krgI~V~nvp~~~~~~vAd~~~~lil~~~R~~~~g~~~~~~g~w-~~~~~~~~g  157 (336)
T KOG0069|consen   79 SALSPNLKLIVTMSVGYDHVDLEAARKRGIRVANVPDVLTDDVADLAVSLLLALLRRFSEGNEMVRNGGW-GWAGGWPLG  157 (336)
T ss_pred             hhcCCCeeEEEEeecccchhhHHHHHhcCceEeccCCcchHHHHHHHHHHHHHHHhhhhhhhhhhhcCCc-cccCCcccc
Confidence            3457999999999999999999999999999999999999999999999999999999999999999999 3321   1 


Q ss_pred             ----hhhh----ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         79 ----ITEL----ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        79 ----~~~l----~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                          +.++    .|+||+.+|++|++|||.+.|++|+.
T Consensus       158 ~~~~gK~vgilG~G~IG~~ia~rL~~Fg~~i~y~~r~~  195 (336)
T KOG0069|consen  158 YDLEGKTVGILGLGRIGKAIAKRLKPFGCVILYHSRTQ  195 (336)
T ss_pred             ccccCCEEEEecCcHHHHHHHHhhhhccceeeeecccC
Confidence                1121    28999999999999999999999864


No 19 
>KOG0068|consensus
Probab=99.93  E-value=1.5e-26  Score=167.03  Aligned_cols=106  Identities=23%  Similarity=0.259  Sum_probs=97.5

Q ss_pred             ccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhh
Q psy15800          3 SRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITEL   82 (109)
Q Consensus         3 ~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l   82 (109)
                      +++..+||+|.+.++|+|++|++++.++||.|.|+|.+++.++||+++++++++.|++++....+++|+|.+....+.++
T Consensus        65 ~aa~~~lkvVgrag~G~dNVDL~AAte~gi~Vvn~P~~Ns~saAEltigli~SLaR~i~~A~~s~k~g~wnr~~~~G~el  144 (406)
T KOG0068|consen   65 EAAAGGLKVVGRAGIGVDNVDLKAATENGILVVNTPTANSRSAAELTIGLILSLARQIGQASASMKEGKWNRVKYLGWEL  144 (406)
T ss_pred             HhhcCCeEEEEecccCccccChhhHHhCCeEEEeCCCCChHHHHHHHHHHHHHHhhhcchhheeeecCceeecceeeeEE
Confidence            33567899999999999999999999999999999999999999999999999999999999999999998766555554


Q ss_pred             c---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 I---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .         |+||+++|+++++|||+|++|||..
T Consensus       145 ~GKTLgvlG~GrIGseVA~r~k~~gm~vI~~dpi~  179 (406)
T KOG0068|consen  145 RGKTLGVLGLGRIGSEVAVRAKAMGMHVIGYDPIT  179 (406)
T ss_pred             eccEEEEeecccchHHHHHHHHhcCceEEeecCCC
Confidence            3         7899999999999999999999974


No 20 
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional
Probab=99.90  E-value=8.6e-24  Score=153.47  Aligned_cols=103  Identities=12%  Similarity=0.081  Sum_probs=86.5

Q ss_pred             CCCceEEEecCccCCcccHHH-----HhhcCcEEEecCC-CCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccc--
Q psy15800          6 GENLKVISTFSVGHDHLHLDQ-----IKSRGIRVGTVGP-VSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQH--   77 (109)
Q Consensus         6 ~p~Lk~i~~~~~G~d~id~~~-----~~~~gi~v~n~~g-~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~--   77 (109)
                      .|+||||++.++|+|++|.+.     +.++||+|+|.++ .++.+||||+++++|++.|+++.+.+.++++.|.....  
T Consensus        54 ~~~Lk~I~~~~aG~d~i~~~~~~~~~~~~~~i~v~~~~~~~~~~~vAE~~l~~~L~~~r~~~~~~~~~~~~~w~~~~~~~  133 (312)
T PRK15469         54 GRDLKAVFALGAGVDSILSKLQAHPEMLDPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYQALQNSSHWQPLPEYH  133 (312)
T ss_pred             cCCceEEEEcccccchhhhhhccccccCCCCceEEEecCCcccHHHHHHHHHHHHHHHcChHHHHHHHHhCCcCCCCCCC
Confidence            489999999999999998332     3458999999864 68999999999999999999999999999999964321  


Q ss_pred             -hhhhh----ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         78 -AITEL----ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        78 -~~~~l----~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                       .+..+    .|+||+++|+++++|||+|++|||+.
T Consensus       134 l~g~tvgIvG~G~IG~~vA~~l~afG~~V~~~~~~~  169 (312)
T PRK15469        134 REDFTIGILGAGVLGSKVAQSLQTWGFPLRCWSRSR  169 (312)
T ss_pred             cCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEeCCC
Confidence             11222    28999999999999999999999865


No 21 
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional
Probab=99.90  E-value=2.7e-23  Score=153.93  Aligned_cols=93  Identities=16%  Similarity=0.139  Sum_probs=79.1

Q ss_pred             CCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcc-cchhhhhcc
Q psy15800          6 GENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQ-QHAITELIT   84 (109)
Q Consensus         6 ~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~-~~~~~~l~G   84 (109)
                      .|+||||++.++|+||||.+++.++||.|+|+||+++.+||||+++++|++.|+..          |.-. ...+.--.|
T Consensus        56 ~~~Lk~I~~~~~G~D~iD~~~~~~~gI~v~napg~na~aVAE~~~~~lL~l~r~~g----------~~L~gktvGIIG~G  125 (378)
T PRK15438         56 GKPIKFVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSSLLMLAERDG----------FSLHDRTVGIVGVG  125 (378)
T ss_pred             CCCCeEEEECcccccccCHHHHHHCCCEEEECCCcCchHHHHHHHHHHHHHhccCC----------CCcCCCEEEEECcC
Confidence            58999999999999999999999999999999999999999999999999999731          2111 111111248


Q ss_pred             chHHHHHHHHhhcCCEEEEEcccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      +||+++|+++++|||+|++|||..
T Consensus       126 ~IG~~vA~~l~a~G~~V~~~dp~~  149 (378)
T PRK15438        126 NVGRRLQARLEALGIKTLLCDPPR  149 (378)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCcc
Confidence            999999999999999999999864


No 22 
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated
Probab=99.88  E-value=1.6e-22  Score=149.96  Aligned_cols=94  Identities=14%  Similarity=0.167  Sum_probs=78.4

Q ss_pred             CCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhhccc
Q psy15800          6 GENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQ   85 (109)
Q Consensus         6 ~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l~G~   85 (109)
                      .|+||||++.++|+||||.+++.++||.|+|+||+++.+||||+++++|++.|+..        .+.. ....+.--.|+
T Consensus        56 ~~~Lk~I~~~~~G~D~iD~~~~~~~gI~v~napg~na~aVAE~v~~~lL~l~r~~g--------~~l~-gktvGIIG~G~  126 (381)
T PRK00257         56 GSRVRFVGTCTIGTDHLDLDYFAEAGITWSSAPGCNARGVVDYVLGSLLTLAEREG--------VDLA-ERTYGVVGAGH  126 (381)
T ss_pred             CCCCeEEEECCccccccCHHHHHHCCCEEEECCCcChHHHHHHHHHHHHHHhcccC--------CCcC-cCEEEEECCCH
Confidence            48999999999999999999999999999999999999999999999999998621        0110 11111112489


Q ss_pred             hHHHHHHHHhhcCCEEEEEcccc
Q psy15800         86 SDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        86 IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ||+.+|+++++|||+|++|||..
T Consensus       127 IG~~va~~l~a~G~~V~~~Dp~~  149 (381)
T PRK00257        127 VGGRLVRVLRGLGWKVLVCDPPR  149 (381)
T ss_pred             HHHHHHHHHHHCCCEEEEECCcc
Confidence            99999999999999999999864


No 23 
>PF00389 2-Hacid_dh:  D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain;  InterPro: IPR006139  A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related. The catalytic domain contains a number of conserved charged residues which may play a role in the catalytic mechanism. The NAD-binding domain is described in IPR006140 from INTERPRO ; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0008152 metabolic process, 0055114 oxidation-reduction process; PDB: 2DLD_A 2G76_B 3DC2_B 1YGY_B 3DDN_A 3KB6_B 3K5P_A 3EVT_A 1WWK_B 1GDH_A ....
Probab=99.56  E-value=1.6e-15  Score=97.74  Aligned_cols=45  Identities=44%  Similarity=0.573  Sum_probs=40.9

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHH
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFN   49 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~   49 (109)
                      .+|+||||+..|+|+|+||++++.++||.|+|+||+++.+||||+
T Consensus        57 ~~~~Lk~I~~~~~G~d~id~~~a~~~gI~V~n~~g~~~~aVAE~a  101 (133)
T PF00389_consen   57 AAPNLKLISTAGAGVDNIDLEAAKERGIPVTNVPGYNAEAVAEHA  101 (133)
T ss_dssp             HHTT-SEEEESSSSCTTB-HHHHHHTTSEEEE-TTTTHHHHHHHH
T ss_pred             ccceeEEEEEcccccCcccHHHHhhCeEEEEEeCCcCCcchhccc
Confidence            469999999999999999999999999999999999999999999


No 24 
>KOG0067|consensus
Probab=99.45  E-value=5e-14  Score=103.35  Aligned_cols=105  Identities=16%  Similarity=0.185  Sum_probs=92.5

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhh----
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAIT----   80 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~----   80 (109)
                      .++.||++...+.|+|++|+.++.+.+|.|||.|+..-+.+|+-++-++|.++|+-....+..++|.|........    
T Consensus        92 kfkalRv~~rig~g~dn~dikaAseL~iavC~ip~~~Ve~~a~stl~hIl~l~rrntw~cq~l~eg~~~q~~~q~~e~a~  171 (435)
T KOG0067|consen   92 KFKALRVIVRIGSGYDNIDIKAASELGIAVCNIPSDAVEETADSTLCHILNLYRRNTWLCQALREGTCTQGLEQVREAAC  171 (435)
T ss_pred             HhhhhceeeeeccccchhhhhhhhhheeeeecccchhHHHHHHHHHHHHHhhhcccchhhhhhcccceeechhhhhhhhh
Confidence            5678999999999999999999999999999999999999999999999999999999999999999964321111    


Q ss_pred             --------hh----ccchHHHHHHHHhhcCCEEEEEccccC
Q psy15800         81 --------EL----ITQSDTNHTQRCLASIMQLVYSTCYNQ  109 (109)
Q Consensus        81 --------~l----~G~IG~~va~~~~~fg~~V~~~~r~~~  109 (109)
                              .+    .|++|+.++.++++||..|+.|||+.+
T Consensus       172 g~~~~~G~~~g~~g~gr~g~av~~~A~afg~~~ifydp~~~  212 (435)
T KOG0067|consen  172 GLARIRGPTLGLIGFGRTGQAVALRAKAFGFVVIFYDPYLI  212 (435)
T ss_pred             ccccccccceeeeccccccceehhhhhcccceeeeecchhh
Confidence                    11    268999999999999999999999853


No 25 
>PF02826 2-Hacid_dh_C:  D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain;  InterPro: IPR006140  A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related. All contain a glycine-rich region located in the central section of these enzymes, this region corresponds to the NAD-binding domain. The catalytic domain is described in IPR006139 from INTERPRO ; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0048037 cofactor binding, 0055114 oxidation-reduction process; PDB: 3JTM_A 3NAQ_B 3N7U_J 3KB6_B 3GG9_A 1QP8_B 2CUK_C 2W2L_D 2W2K_A 1WWK_A ....
Probab=99.38  E-value=3.4e-13  Score=90.92  Aligned_cols=59  Identities=20%  Similarity=0.168  Sum_probs=47.3

Q ss_pred             HHHHHHHhcCchHhHHHHHcCCC-Ccccchhhhh---------ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         50 IGLAIAVSRRFQQGHNCIASGTE-KSQQHAITEL---------ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        50 l~~~L~l~R~~~~~~~~~~~g~w-~~~~~~~~~l---------~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ++++|++.|+++.+++.++++.| ......+.++         .|+||+++|+++++|||+|++|||+.
T Consensus         1 i~l~L~~~R~~~~~~~~~~~~~W~~~~~~~~~~l~g~tvgIiG~G~IG~~vA~~l~~fG~~V~~~d~~~   69 (178)
T PF02826_consen    1 IALMLALLRRLPEYHEAQRNGEWASRERFPGRELRGKTVGIIGYGRIGRAVARRLKAFGMRVIGYDRSP   69 (178)
T ss_dssp             HHHHHHHHTTHHHHHHHHHTTBHHHHTTTTBS-STTSEEEEESTSHHHHHHHHHHHHTT-EEEEEESSC
T ss_pred             ChHHHHHHhCHHHHHHHHHcCCCCCCcCCCccccCCCEEEEEEEcCCcCeEeeeeecCCceeEEecccC
Confidence            58999999999999999999999 1111222233         27999999999999999999999985


No 26 
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit. This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by TIGR02852. This protein is also known as SpoVFA.
Probab=99.12  E-value=6.9e-11  Score=85.23  Aligned_cols=88  Identities=17%  Similarity=0.053  Sum_probs=68.7

Q ss_pred             ceEEEecCccCCcccHH-HHhhcCcEEE------ecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhh
Q psy15800          9 LKVISTFSVGHDHLHLD-QIKSRGIRVG------TVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITE   81 (109)
Q Consensus         9 Lk~i~~~~~G~d~id~~-~~~~~gi~v~------n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~   81 (109)
                      ++.++...+|+++.|++ .+.++||+|+      |++.+++.++||+++++++...           .-++.... ..--
T Consensus        90 ~~~~~~~~~G~~~~~l~~~a~~~gi~v~~~~~~~~va~~n~~~~Ae~ai~~al~~~-----------~~~l~gk~-v~Ii  157 (287)
T TIGR02853        90 TKGHCTIYVGISNPYLEQLAADAGVKLIELFERDDVAIYNSIPTAEGAIMMAIEHT-----------DFTIHGSN-VMVL  157 (287)
T ss_pred             cCCCCEEEEecCCHHHHHHHHHCCCeEEEEEeccceEEEccHhHHHHHHHHHHHhc-----------CCCCCCCE-EEEE
Confidence            44688899999999998 9999999999      8999999999999999888531           01221111 1111


Q ss_pred             hccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      -.|.||+.+|+.|++||++|++++|..
T Consensus       158 G~G~iG~avA~~L~~~G~~V~v~~R~~  184 (287)
T TIGR02853       158 GFGRTGMTIARTFSALGARVFVGARSS  184 (287)
T ss_pred             cChHHHHHHHHHHHHCCCEEEEEeCCH
Confidence            138999999999999999999999864


No 27 
>PTZ00075 Adenosylhomocysteinase; Provisional
Probab=98.75  E-value=1.5e-08  Score=77.41  Aligned_cols=85  Identities=8%  Similarity=-0.078  Sum_probs=62.9

Q ss_pred             ecCccCCccc-HHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhh----ccchHH
Q psy15800         14 TFSVGHDHLH-LDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITEL----ITQSDT   88 (109)
Q Consensus        14 ~~~~G~d~id-~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l----~G~IG~   88 (109)
                      -.++|+..+- +....+.+|+|+|+|+.+..+++|+++++++++.      +..++.+...   ..+..+    .|.||+
T Consensus       197 eTttGv~rl~~m~~~g~L~iPV~nv~d~~tk~~aD~~~G~~~s~~------d~~~R~~~~~---LaGKtVgVIG~G~IGr  267 (476)
T PTZ00075        197 ETTTGVHRLYKMLKKGELLFPAINVNDSVTKSKFDNIYGCRHSLI------DGIFRATDVM---IAGKTVVVCGYGDVGK  267 (476)
T ss_pred             cchHHHHHHHHHHHCCCCCceEEEeCCcchHHHHHHHHHHHHHHH------HHHHHhcCCC---cCCCEEEEECCCHHHH
Confidence            4567777652 3333456899999999999999999999999988      3344444321   111212    389999


Q ss_pred             HHHHHHhhcCCEEEEEccc
Q psy15800         89 NHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        89 ~va~~~~~fg~~V~~~~r~  107 (109)
                      .+|+++++|||+|+++++.
T Consensus       268 ~vA~rL~a~Ga~ViV~e~d  286 (476)
T PTZ00075        268 GCAQALRGFGARVVVTEID  286 (476)
T ss_pred             HHHHHHHHCCCEEEEEeCC
Confidence            9999999999999999654


No 28 
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=98.13  E-value=5.7e-06  Score=60.02  Aligned_cols=90  Identities=12%  Similarity=-0.052  Sum_probs=63.2

Q ss_pred             CCCCceEEEecCccCCcccHHHHhhcCcEEEecCCC------CccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccch
Q psy15800          5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPV------SSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHA   78 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~------~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~   78 (109)
                      ..|++..+. .|.+.++++ +.+.++||.+.+....      ++.+++|.++...+...           ..++....-.
T Consensus        90 ~l~~~~~v~-~G~~~~~~~-~~~~~~gi~~~~~~~~~~~~~~ns~~~aegav~~a~~~~-----------~~~l~g~kvl  156 (296)
T PRK08306         90 LTPEHCTIF-SGIANPYLK-ELAKETNRKLVELFERDDVAILNSIPTAEGAIMMAIEHT-----------PITIHGSNVL  156 (296)
T ss_pred             hcCCCCEEE-EecCCHHHH-HHHHHCCCeEEEEeccchhhhhccHhHHHHHHHHHHHhC-----------CCCCCCCEEE
Confidence            466776444 488889988 7888999999987754      88899999777644211           1122111100


Q ss_pred             hhhhccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         79 ITELITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        79 ~~~l~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                       ---.|.+|+.+++.|+.+|++|.++||+.
T Consensus       157 -ViG~G~iG~~~a~~L~~~Ga~V~v~~r~~  185 (296)
T PRK08306        157 -VLGFGRTGMTLARTLKALGANVTVGARKS  185 (296)
T ss_pred             -EECCcHHHHHHHHHHHHCCCEEEEEECCH
Confidence             01138999999999999999999999874


No 29 
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional
Probab=95.98  E-value=0.0033  Score=47.96  Aligned_cols=90  Identities=7%  Similarity=-0.004  Sum_probs=51.6

Q ss_pred             EecCccCCcc-cHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhhccchHHHHH
Q psy15800         13 STFSVGHDHL-HLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHT   91 (109)
Q Consensus        13 ~~~~~G~d~i-d~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l~G~IG~~va   91 (109)
                      =-.++|+..+ .+..-.+.+++|.|++.......-|...+.-.+....+....    +-..... ...---.|.||+.+|
T Consensus       154 EeTttGv~rl~~~~~~~~l~~Pv~~vn~s~~K~~~dn~~gt~~s~~~ai~rat----~~~l~Gk-~VlViG~G~IG~~vA  228 (425)
T PRK05476        154 EETTTGVHRLYAMAKDGALKFPAINVNDSVTKSKFDNRYGTGESLLDGIKRAT----NVLIAGK-VVVVAGYGDVGKGCA  228 (425)
T ss_pred             ecchHHHHHHHHHHHcCCCCCCEEecCCcccCccccccHHHHhhhHHHHHHhc----cCCCCCC-EEEEECCCHHHHHHH
Confidence            3456777765 333334578999999988777654433322222221111110    0011111 000111389999999


Q ss_pred             HHHhhcCCEEEEEccc
Q psy15800         92 QRCLASIMQLVYSTCY  107 (109)
Q Consensus        92 ~~~~~fg~~V~~~~r~  107 (109)
                      ++++++|++|+++|+.
T Consensus       229 ~~lr~~Ga~ViV~d~d  244 (425)
T PRK05476        229 QRLRGLGARVIVTEVD  244 (425)
T ss_pred             HHHHhCCCEEEEEcCC
Confidence            9999999999999865


No 30 
>PRK13403 ketol-acid reductoisomerase; Provisional
Probab=95.82  E-value=0.0085  Score=44.36  Aligned_cols=25  Identities=12%  Similarity=-0.010  Sum_probs=22.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|+||+++|++|++|||+|+++++.
T Consensus        24 ~GsIG~amA~nL~d~G~~ViV~~r~   48 (335)
T PRK13403         24 YGSQGHAQAQNLRDSGVEVVVGVRP   48 (335)
T ss_pred             EcHHHHHHHHHHHHCcCEEEEEECc
Confidence            3899999999999999999999764


No 31 
>PLN02494 adenosylhomocysteinase
Probab=95.35  E-value=0.016  Score=44.81  Aligned_cols=25  Identities=4%  Similarity=-0.063  Sum_probs=22.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.||+.+|+++++|||+|+++++.+
T Consensus       263 G~IGr~vA~~aka~Ga~VIV~e~dp  287 (477)
T PLN02494        263 GDVGKGCAAAMKAAGARVIVTEIDP  287 (477)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCCc
Confidence            6899999999999999999997643


No 32 
>PF00670 AdoHcyase_NAD:  S-adenosyl-L-homocysteine hydrolase, NAD binding domain;  InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3.3.1.1 from EC) (AdoHcyase) is an enzyme of the activated methyl cycle, responsible for the reversible hydration of S-adenosyl-L-homocysteine into adenosine and homocysteine. AdoHcyase is an ubiquitous enzyme which binds and requires NAD+ as a cofactor. AdoHcyase is a highly conserved protein [] of about 430 to 470 amino acids.  This entry represents the glycine-rich region in the central part of AdoHcyase, which is thought to be involved in NAD-binding.; GO: 0004013 adenosylhomocysteinase activity; PDB: 2ZJ1_C 3DHY_B 2ZIZ_C 2ZJ0_D 3CE6_B 3GLQ_B 3D64_A 3G1U_C 1A7A_A 3NJ4_C ....
Probab=94.49  E-value=0.037  Score=37.03  Aligned_cols=25  Identities=0%  Similarity=-0.160  Sum_probs=20.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +|.+|+.+|+.|+++|++|+.++..
T Consensus        31 YG~vG~g~A~~lr~~Ga~V~V~e~D   55 (162)
T PF00670_consen   31 YGKVGKGIARALRGLGARVTVTEID   55 (162)
T ss_dssp             -SHHHHHHHHHHHHTT-EEEEE-SS
T ss_pred             CCcccHHHHHHHhhCCCEEEEEECC
Confidence            3899999999999999999998754


No 33 
>TIGR00936 ahcY adenosylhomocysteinase. This enzyme hydrolyzes adenosylhomocysteine as part of a cycle for the regeneration of the methyl donor S-adenosylmethionine. Species that lack this enzyme are likely to have adenosylhomocysteine nucleosidase (EC 3.2.2.9), an enzyme which also acts as 5'-methyladenosine nucleosidase (see TIGR01704).
Probab=93.52  E-value=0.071  Score=40.59  Aligned_cols=24  Identities=4%  Similarity=-0.065  Sum_probs=21.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+|+++++||++|+++|+.
T Consensus       204 G~IG~~vA~~ak~~Ga~ViV~d~d  227 (406)
T TIGR00936       204 GWCGKGIAMRARGMGARVIVTEVD  227 (406)
T ss_pred             CHHHHHHHHHHhhCcCEEEEEeCC
Confidence            689999999999999999999643


No 34 
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. For example, leucine DH catalyzes the reversible oxidative deamination of L-leucine and several other straight or branched chain amino acids to the corresponding 2-oxoacid derivative. Amino acid DH -like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily inc
Probab=93.01  E-value=0.083  Score=36.25  Aligned_cols=26  Identities=8%  Similarity=0.088  Sum_probs=23.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|++|+.+|+.|..+|++|+++|+..
T Consensus        36 ~G~vG~~~A~~L~~~G~~Vvv~D~~~   61 (200)
T cd01075          36 LGKVGYKLAEHLLEEGAKLIVADINE   61 (200)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEcCCH
Confidence            38999999999999999999999753


No 35 
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy). The equilibrium lies far on the side of AdoHyc synthesis, but in nature the removal of Ado and Hyc is sufficiently fast, so that the net reaction is in the direction of hydrolysis. Since AdoHyc is a potent inhibitor of S-adenosyl-L-methionine dependent methyltransferases,  AdoHycase plays a critical role in the modulation of the activity of various methyltransferases. The enzyme forms homooligomers of 45-50kDa subunits, each binding one molecule of NAD+.
Probab=91.10  E-value=0.22  Score=38.04  Aligned_cols=24  Identities=4%  Similarity=-0.040  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.++++++++|++|+++|+.
T Consensus       211 G~IG~~va~~ak~~Ga~ViV~d~d  234 (413)
T cd00401         211 GDVGKGCAQSLRGQGARVIVTEVD  234 (413)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECC
Confidence            679999999999999999999765


No 36 
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism]
Probab=89.55  E-value=0.37  Score=35.85  Aligned_cols=25  Identities=4%  Similarity=-0.015  Sum_probs=23.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |..|++++--++.+|.+|+++|||.
T Consensus        21 GELGKEvaIe~QRLG~eViAVDrY~   45 (394)
T COG0027          21 GELGKEVAIEAQRLGVEVIAVDRYA   45 (394)
T ss_pred             CccchHHHHHHHhcCCEEEEecCcC
Confidence            7899999999999999999999985


No 37 
>TIGR00518 alaDH alanine dehydrogenase. The family of known L-alanine dehydrogenases includes representatives from the Proteobacteria, Firmicutes, and Cyanobacteria, all with about 50 % identity or better. An outlier to this group in both sequence and gap pattern is the homolog from Helicobacter pylori, an epsilon division Proteobacteria, which must be considered a putative alanine dehydrogenase. Related proteins include saccharopine dehydrogenase and the N-terminal half of the NAD(P) transhydrogenase alpha subunit. All of these related proteins bind NAD and/or NADP.
Probab=87.19  E-value=0.6  Score=35.02  Aligned_cols=24  Identities=8%  Similarity=-0.141  Sum_probs=22.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++.+|++|.++|+.
T Consensus       176 G~vG~~aa~~a~~lGa~V~v~d~~  199 (370)
T TIGR00518       176 GVVGTNAAKMANGLGATVTILDIN  199 (370)
T ss_pred             CHHHHHHHHHHHHCCCeEEEEECC
Confidence            789999999999999999999975


No 38 
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC. Members of this protein family are the accessory protein XdhC for insertion of the molybdenum cofactor into the xanthine dehydrogenase large chain, XdhB, in bacteria. This protein is not part of the mature xanthine dehydrogenase. Xanthine dehydrogenase is an enzyme for purine catabolism, from other purines to xanthine to urate to further breakdown products.
Probab=85.61  E-value=0.93  Score=32.18  Aligned_cols=25  Identities=0%  Similarity=-0.060  Sum_probs=23.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.+++.++++++.+|++|+.+|+..
T Consensus       109 G~va~~la~la~~lGf~V~v~D~R~  133 (246)
T TIGR02964       109 GHVGRALVRALAPLPCRVTWVDSRE  133 (246)
T ss_pred             cHHHHHHHHHHhcCCCEEEEEeCCc
Confidence            7899999999999999999999764


No 39 
>PRK05479 ketol-acid reductoisomerase; Provisional
Probab=84.01  E-value=1.1  Score=33.28  Aligned_cols=25  Identities=12%  Similarity=-0.025  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|++|+++|+.|+.+|++|+++++.
T Consensus        25 ~GsmG~AlA~~L~~sG~~Vvv~~r~   49 (330)
T PRK05479         25 YGSQGHAHALNLRDSGVDVVVGLRE   49 (330)
T ss_pred             eHHHHHHHHHHHHHCCCEEEEEECC
Confidence            3899999999999999999987664


No 40 
>PF03720 UDPG_MGDP_dh_C:  UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain;  InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]. The enzymes have a wide range of functions. In plants UDP-glucose dehydrogenase, 1.1.1.22 from EC, is an important enzyme in the synthesis of hemicellulose and pectin [], which are the components of newly formed cell walls; while in zebrafish UDP-glucose dehydrogenase is required for cardiac valve formation []. In Xanthomonas campestris, a plant pathogen, UDP-glucose dehydrogenase is required for virulence [].  GDP-mannose dehydrogenase, 1.1.1.132 from EC, catalyses the formation of GDP-mannuronic acid, which is the monomeric unit from which the exopolysaccharide alginate is formed. Alginate is secreted by a number of bacteria, which include Pseudomonas aeruginosa and Azotobacter vinelandii. In P. aeruginosa, alginate is believed to play an important role in the bacteria's resistance to antibiotics and the host immune response [], while in A. vinelandii it is essential for the encystment process []. This entry represents the C-terminal substrate-binding domain of these enzymes. Structural studies indicate that this domain forms an incomplete dinucleotide binding fold [, ].; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 3GG2_D 1DLI_A 1DLJ_A 2Y0E_D 2Y0D_B 2Y0C_D 1MV8_B 1MUU_A 1MFZ_C 3TDK_B ....
Probab=82.94  E-value=1.8  Score=26.44  Aligned_cols=29  Identities=3%  Similarity=-0.049  Sum_probs=21.2

Q ss_pred             hhhccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         80 TELITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        80 ~~l~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ..+..+-+..+++.|+..|++|.+|||+.
T Consensus        12 ~D~R~Sp~~~l~~~L~~~g~~V~~~DP~v   40 (106)
T PF03720_consen   12 DDIRESPALELIEELKERGAEVSVYDPYV   40 (106)
T ss_dssp             S--TT-HHHHHHHHHHHTT-EEEEE-TTS
T ss_pred             cccccCHHHHHHHHHHHCCCEEEEECCcc
Confidence            34556778899999999999999999975


No 41 
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase
Probab=82.82  E-value=1.1  Score=32.22  Aligned_cols=26  Identities=15%  Similarity=-0.032  Sum_probs=23.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+...|.+|+.||+..
T Consensus        12 ~G~mG~~iA~~l~~~G~~V~~~d~~~   37 (295)
T PLN02545         12 AGQMGSGIAQLAAAAGMDVWLLDSDP   37 (295)
T ss_pred             CCHHHHHHHHHHHhcCCeEEEEeCCH
Confidence            48999999999999999999999864


No 42 
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional
Probab=82.69  E-value=1.5  Score=31.78  Aligned_cols=26  Identities=4%  Similarity=-0.210  Sum_probs=23.8

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|+.+|+.+...|.+|..|+|..
T Consensus        12 ~G~~G~~lA~~l~~~G~~V~~~~r~~   37 (308)
T PRK14619         12 AGAWGSTLAGLASANGHRVRVWSRRS   37 (308)
T ss_pred             ccHHHHHHHHHHHHCCCEEEEEeCCC
Confidence            48999999999999999999999864


No 43 
>PLN02712 arogenate dehydrogenase
Probab=81.76  E-value=1.4  Score=35.66  Aligned_cols=24  Identities=0%  Similarity=-0.197  Sum_probs=22.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+|+.++.+|.+|++|||.
T Consensus       378 G~mG~slA~~L~~~G~~V~~~dr~  401 (667)
T PLN02712        378 GNFGQFLAKTMVKQGHTVLAYSRS  401 (667)
T ss_pred             CHHHHHHHHHHHHCcCEEEEEECC
Confidence            789999999999999999999985


No 44 
>PLN02256 arogenate dehydrogenase
Probab=80.87  E-value=1.9  Score=31.59  Aligned_cols=25  Identities=0%  Similarity=-0.129  Sum_probs=23.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|+.+++.++..|.+|++||+.
T Consensus        44 ~G~mG~slA~~L~~~G~~V~~~d~~   68 (304)
T PLN02256         44 FGNFGQFLAKTFVKQGHTVLATSRS   68 (304)
T ss_pred             eCHHHHHHHHHHHhCCCEEEEEECc
Confidence            4899999999999999999999976


No 45 
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal. In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis (see TIGR00521). These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This model describes proteins from the genera Streptococcus and Enterococcus homologous to the C-terminal region of TIGR00521, corresponding to phosphopantothenate--cysteine ligase activity.
Probab=80.21  E-value=2.1  Score=29.94  Aligned_cols=24  Identities=13%  Similarity=0.012  Sum_probs=21.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+++|+.+...|++|+..++
T Consensus        24 SGgIG~AIA~~la~~Ga~Vvlv~~   47 (227)
T TIGR02114        24 TGHLGKIITETFLSAGHEVTLVTT   47 (227)
T ss_pred             ccHHHHHHHHHHHHCCCEEEEEcC
Confidence            388999999999999999998764


No 46 
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids 
Probab=79.52  E-value=2.2  Score=29.85  Aligned_cols=23  Identities=4%  Similarity=-0.026  Sum_probs=20.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|++|+.+++.|..+|++|+++.
T Consensus        39 ~G~VG~~~a~~L~~~g~~vv~v~   61 (227)
T cd01076          39 FGNVGSHAARFLHEAGAKVVAVS   61 (227)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEE
Confidence            48999999999999999999653


No 47 
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=79.41  E-value=1.7  Score=32.08  Aligned_cols=26  Identities=15%  Similarity=-0.012  Sum_probs=23.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+...|++|..||+.+
T Consensus        15 aG~MG~giA~~~a~aG~~V~l~D~~~   40 (321)
T PRK07066         15 SGVIGSGWVARALAHGLDVVAWDPAP   40 (321)
T ss_pred             cCHHHHHHHHHHHhCCCeEEEEeCCH
Confidence            37899999999999999999999864


No 48 
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=78.52  E-value=2.3  Score=29.56  Aligned_cols=25  Identities=8%  Similarity=-0.071  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|++|+..+|.
T Consensus        14 s~gIG~~ia~~l~~~G~~V~~~~r~   38 (262)
T TIGR03325        14 ASGLGRAIVDRFVAEGARVAVLDKS   38 (262)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCC
Confidence            4679999999999999999998875


No 49 
>PRK08703 short chain dehydrogenase; Provisional
Probab=78.28  E-value=2.5  Score=28.82  Aligned_cols=26  Identities=4%  Similarity=-0.091  Sum_probs=23.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+.+++.+...|++|+.++|..
T Consensus        15 sggiG~~la~~l~~~g~~V~~~~r~~   40 (239)
T PRK08703         15 SQGLGEQVAKAYAAAGATVILVARHQ   40 (239)
T ss_pred             CCcHHHHHHHHHHHcCCEEEEEeCCh
Confidence            47899999999999999999998854


No 50 
>PRK06732 phosphopantothenate--cysteine ligase; Validated
Probab=77.43  E-value=2.8  Score=29.31  Aligned_cols=25  Identities=16%  Similarity=-0.004  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||.++|+.|...|.+|++.++.
T Consensus        25 SG~iG~aLA~~L~~~G~~V~li~r~   49 (229)
T PRK06732         25 TGQLGKIIAETFLAAGHEVTLVTTK   49 (229)
T ss_pred             chHHHHHHHHHHHhCCCEEEEEECc
Confidence            3899999999999999999998753


No 51 
>PRK08339 short chain dehydrogenase; Provisional
Probab=77.34  E-value=3.2  Score=29.09  Aligned_cols=24  Identities=0%  Similarity=-0.165  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++|+.+...|++|+..+|.
T Consensus        18 ~gIG~aia~~l~~~G~~V~~~~r~   41 (263)
T PRK08339         18 KGIGFGVARVLARAGADVILLSRN   41 (263)
T ss_pred             CcHHHHHHHHHHHCCCEEEEEeCC
Confidence            579999999999999999998875


No 52 
>PF00070 Pyr_redox:  Pyridine nucleotide-disulphide oxidoreductase;  InterPro: IPR001327  FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]. Comparison of the crystal structures of human glutathione reductase and Escherichia coli thioredoxin reductase reveals different locations of their active sites, suggesting that the enzymes diverged from an ancestral FAD/NAD(P)H reductase and acquired their disulphide reductase activities independently [].   Despite functional similarities, oxidoreductases of this family show no sequence similarity with adrenodoxin reductases [] and flavoprotein pyridine nucleotide cytochrome reductases (FPNCR) []. Assuming that disulphide reductase activity emerged later, during divergent evolution, the family can be referred to as FAD-dependent pyridine nucleotide reductases, FADPNR. To date, 3D structures of glutathione reductase [], thioredoxin reductase [], mercuric reductase [], lipoamide dehydrogenase [], trypanothione reductase [] and NADH peroxidase [] have been solved. The enzymes share similar tertiary structures based on a doubly-wound alpha/beta fold, but the relative orientations of their FAD- and NAD(P)H-binding domains may vary significantly. By contrast with the FPNCR family, the folds of the FAD- and NAD(P)H-binding domains are similar, suggesting that the domains evolved by gene duplication [].  This entry describes a small NADH binding domain within a larger FAD binding domain described by IPR023753 from INTERPRO. It is found in both class I and class II oxidoreductases. ; GO: 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0055114 oxidation-reduction process; PDB: 1ZKQ_A 3DGZ_A 1ZDL_A 2R9Z_B 2RAB_A 2A87_B 1M6I_A 2YVG_A 2GR1_A 2GQW_A ....
Probab=77.19  E-value=4.2  Score=23.18  Aligned_cols=25  Identities=0%  Similarity=-0.214  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |-+|-++|..++.+|.+|..+++..
T Consensus         8 G~ig~E~A~~l~~~g~~vtli~~~~   32 (80)
T PF00070_consen    8 GFIGIELAEALAELGKEVTLIERSD   32 (80)
T ss_dssp             SHHHHHHHHHHHHTTSEEEEEESSS
T ss_pred             CHHHHHHHHHHHHhCcEEEEEeccc
Confidence            6799999999999999999887754


No 53 
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=77.05  E-value=2.4  Score=28.74  Aligned_cols=26  Identities=8%  Similarity=-0.135  Sum_probs=23.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+.+++.+..-|.+|+..+|..
T Consensus        14 ~g~iG~~~a~~l~~~G~~V~~~~r~~   39 (238)
T PRK05786         14 SEGLGYAVAYFALKEGAQVCINSRNE   39 (238)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCCH
Confidence            47899999999999999999998753


No 54 
>PRK06523 short chain dehydrogenase; Provisional
Probab=76.60  E-value=3.2  Score=28.65  Aligned_cols=25  Identities=12%  Similarity=0.036  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|++|+..+|.
T Consensus        18 s~gIG~~ia~~l~~~G~~v~~~~r~   42 (260)
T PRK06523         18 TKGIGAATVARLLEAGARVVTTARS   42 (260)
T ss_pred             CCchhHHHHHHHHHCCCEEEEEeCC
Confidence            3689999999999999999998875


No 55 
>PRK06483 dihydromonapterin reductase; Provisional
Probab=76.31  E-value=3.5  Score=28.09  Aligned_cols=26  Identities=12%  Similarity=-0.114  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+++|+.+..-|++|+..+|..
T Consensus        11 s~gIG~~ia~~l~~~G~~V~~~~r~~   36 (236)
T PRK06483         11 GQRIGLALAWHLLAQGQPVIVSYRTH   36 (236)
T ss_pred             CChHHHHHHHHHHHCCCeEEEEeCCc
Confidence            46799999999999999999888753


No 56 
>TIGR00465 ilvC ketol-acid reductoisomerase. This is the second enzyme in the parallel isoleucine-valine biosynthetic pathway
Probab=76.12  E-value=3.1  Score=30.66  Aligned_cols=24  Identities=4%  Similarity=-0.046  Sum_probs=21.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|++|+++|+.++.+|++|+++++
T Consensus        11 ~G~mG~AiA~~L~~sG~~Viv~~~   34 (314)
T TIGR00465        11 YGSQGHAQALNLRDSGLNVIVGLR   34 (314)
T ss_pred             EcHHHHHHHHHHHHCCCeEEEEEC
Confidence            589999999999999999887654


No 57 
>PRK08265 short chain dehydrogenase; Provisional
Probab=76.02  E-value=3.1  Score=28.99  Aligned_cols=26  Identities=8%  Similarity=-0.070  Sum_probs=22.8

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+++++.+...|++|+..+|..
T Consensus        15 s~gIG~~ia~~l~~~G~~V~~~~r~~   40 (261)
T PRK08265         15 ATLIGAAVARALVAAGARVAIVDIDA   40 (261)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCCH
Confidence            36899999999999999999988753


No 58 
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=75.88  E-value=3.4  Score=31.29  Aligned_cols=26  Identities=0%  Similarity=-0.198  Sum_probs=23.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|+.|+..|.+|.++|+..
T Consensus        11 lG~~G~slA~~l~~~G~~V~g~D~~~   36 (418)
T PRK00683         11 LGVTGKSIARFLAQKGVYVIGVDKSL   36 (418)
T ss_pred             ECHHHHHHHHHHHHCCCEEEEEeCCc
Confidence            47899999999999999999999753


No 59 
>PLN02653 GDP-mannose 4,6-dehydratase
Probab=75.80  E-value=3.9  Score=29.64  Aligned_cols=25  Identities=12%  Similarity=-0.118  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|-||+.+++.|...|.+|++.+|.
T Consensus        15 tGfiG~~l~~~L~~~G~~V~~~~r~   39 (340)
T PLN02653         15 TGQDGSYLTEFLLSKGYEVHGIIRR   39 (340)
T ss_pred             CCccHHHHHHHHHHCCCEEEEEecc
Confidence            4789999999999999999988753


No 60 
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]
Probab=75.50  E-value=2.7  Score=31.94  Aligned_cols=22  Identities=5%  Similarity=-0.080  Sum_probs=20.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      |..|+.+|.+++++|++|++..
T Consensus       218 G~vGrG~A~~~rg~GA~ViVtE  239 (420)
T COG0499         218 GWVGRGIAMRLRGMGARVIVTE  239 (420)
T ss_pred             cccchHHHHHhhcCCCeEEEEe
Confidence            6789999999999999999873


No 61 
>PRK06180 short chain dehydrogenase; Provisional
Probab=75.45  E-value=3  Score=29.34  Aligned_cols=26  Identities=15%  Similarity=0.008  Sum_probs=23.1

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -.|.||+.+++.|..-|++|+..+|.
T Consensus        12 asggiG~~la~~l~~~G~~V~~~~r~   37 (277)
T PRK06180         12 VSSGFGRALAQAALAAGHRVVGTVRS   37 (277)
T ss_pred             CCChHHHHHHHHHHhCcCEEEEEeCC
Confidence            35789999999999999999999874


No 62 
>PRK07890 short chain dehydrogenase; Provisional
Probab=75.27  E-value=3.8  Score=28.17  Aligned_cols=26  Identities=8%  Similarity=-0.089  Sum_probs=22.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+.+|+.+..-|++|+..+|..
T Consensus        14 ~~~IG~~la~~l~~~G~~V~~~~r~~   39 (258)
T PRK07890         14 GPGLGRTLAVRAARAGADVVLAARTA   39 (258)
T ss_pred             CCcHHHHHHHHHHHcCCEEEEEeCCH
Confidence            46899999999999999999998753


No 63 
>PLN02712 arogenate dehydrogenase
Probab=75.24  E-value=3.1  Score=33.80  Aligned_cols=25  Identities=0%  Similarity=-0.116  Sum_probs=23.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+|+.++.+|.+|++|||.
T Consensus        60 ~G~mG~slA~~L~~~G~~V~~~dr~   84 (667)
T PLN02712         60 FGNYGQFLAKTLISQGHTVLAHSRS   84 (667)
T ss_pred             cCHHHHHHHHHHHHCCCEEEEEeCC
Confidence            3899999999999999999999975


No 64 
>PRK06114 short chain dehydrogenase; Provisional
Probab=74.95  E-value=4.1  Score=28.15  Aligned_cols=25  Identities=0%  Similarity=-0.266  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++|+.+...|++|+..+|.
T Consensus        17 s~gIG~~ia~~l~~~G~~v~~~~r~   41 (254)
T PRK06114         17 GSGIGQRIAIGLAQAGADVALFDLR   41 (254)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            3679999999999999999998864


No 65 
>PRK07326 short chain dehydrogenase; Provisional
Probab=74.85  E-value=3.9  Score=27.73  Aligned_cols=25  Identities=8%  Similarity=-0.093  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..+|.
T Consensus        15 tg~iG~~la~~l~~~g~~V~~~~r~   39 (237)
T PRK07326         15 SKGIGFAIAEALLAEGYKVAITARD   39 (237)
T ss_pred             CCcHHHHHHHHHHHCCCEEEEeeCC
Confidence            4789999999999899999999875


No 66 
>PF01262 AlaDh_PNT_C:  Alanine dehydrogenase/PNT, C-terminal domain;  InterPro: IPR007698 Alanine dehydrogenases (1.4.1.1 from EC) and pyridine nucleotide transhydrogenase (1.6.1.1 from EC) have been shown to share regions of similarity []. Alanine dehydrogenase catalyzes the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyzes the reduction of NADP+ to NADPH with the concomitant oxidation of NADH to NAD+. This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation between NADH and NADP is coupled with the translocation of a proton across the membrane. In prokaryotes the enzyme is composed of two different subunits, an alpha chain (gene pntA) and a beta chain (gene pntB), while in eukaryotes it is a single chain protein. The sequence of alanine dehydrogenase from several bacterial species are related with those of the alpha subunit of bacterial pyridine nucleotide transhydrogenase and of the N-terminal half of the eukaryotic enzyme. The two most conserved regions correspond respectively to the N-terminal extremity of these proteins and to a central glycine-rich region which is part of the NAD(H)-binding site.  This is a C-terminal domain of alanine dehydrogenases (1.4.1.1 from EC). This domain is also found in the lysine 2-oxoglutarate reductases. ; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1KOL_A 2EEZ_F 1L7E_C 1PTJ_B 1NM5_A 1HZZ_B 1U2G_B 2FSV_A 2FR8_A 1U2D_A ....
Probab=74.51  E-value=3.5  Score=27.23  Aligned_cols=24  Identities=4%  Similarity=-0.108  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |+.|+..++.++++|++|..+|..
T Consensus        29 G~vg~gA~~~~~~lGa~v~~~d~~   52 (168)
T PF01262_consen   29 GRVGQGAAEIAKGLGAEVVVPDER   52 (168)
T ss_dssp             SHHHHHHHHHHHHTT-EEEEEESS
T ss_pred             CHHHHHHHHHHhHCCCEEEeccCC
Confidence            889999999999999999999865


No 67 
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=74.24  E-value=2.8  Score=30.10  Aligned_cols=26  Identities=4%  Similarity=-0.151  Sum_probs=23.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+...|.+|+.||+..
T Consensus        11 aG~mG~~iA~~la~~G~~V~l~d~~~   36 (291)
T PRK06035         11 SGVMGQGIAQVFARTGYDVTIVDVSE   36 (291)
T ss_pred             ccHHHHHHHHHHHhcCCeEEEEeCCH
Confidence            48899999999999999999999864


No 68 
>PRK06398 aldose dehydrogenase; Validated
Probab=74.18  E-value=4.3  Score=28.26  Aligned_cols=25  Identities=4%  Similarity=-0.162  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++|+.+...|.+|+..+|.
T Consensus        15 s~gIG~~ia~~l~~~G~~Vi~~~r~   39 (258)
T PRK06398         15 SQGIGKAVVNRLKEEGSNVINFDIK   39 (258)
T ss_pred             CchHHHHHHHHHHHCCCeEEEEeCC
Confidence            4689999999999999999998875


No 69 
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=74.11  E-value=4.1  Score=28.05  Aligned_cols=25  Identities=0%  Similarity=-0.169  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|.+|+..+|.
T Consensus        19 ~g~iG~~ia~~l~~~G~~V~~~~r~   43 (255)
T PRK07523         19 SQGIGYALAEGLAQAGAEVILNGRD   43 (255)
T ss_pred             cchHHHHHHHHHHHcCCEEEEEeCC
Confidence            4789999999999999999998875


No 70 
>PRK06841 short chain dehydrogenase; Provisional
Probab=73.97  E-value=3.8  Score=28.12  Aligned_cols=25  Identities=4%  Similarity=-0.160  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||.++++.+...|++|+..+|.
T Consensus        24 s~~IG~~la~~l~~~G~~Vi~~~r~   48 (255)
T PRK06841         24 ASGIGHAIAELFAAKGARVALLDRS   48 (255)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCC
Confidence            3789999999999999999998875


No 71 
>PRK09620 hypothetical protein; Provisional
Probab=73.94  E-value=4  Score=28.66  Aligned_cols=24  Identities=4%  Similarity=-0.006  Sum_probs=21.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||..+|+.|...|.+|++++.
T Consensus        28 SGfiGs~LA~~L~~~Ga~V~li~g   51 (229)
T PRK09620         28 KGTIGRIIAEELISKGAHVIYLHG   51 (229)
T ss_pred             cCHHHHHHHHHHHHCCCeEEEEeC
Confidence            499999999999999999998774


No 72 
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=73.48  E-value=3.8  Score=28.27  Aligned_cols=25  Identities=0%  Similarity=-0.230  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|.+|+..+|.
T Consensus        11 ~~~IG~~la~~l~~~g~~vi~~~r~   35 (259)
T PRK12384         11 GQTLGAFLCHGLAEEGYRVAVADIN   35 (259)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEECC
Confidence            4789999999999999999998875


No 73 
>PRK12828 short chain dehydrogenase; Provisional
Probab=73.44  E-value=4.2  Score=27.36  Aligned_cols=25  Identities=4%  Similarity=-0.217  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+..-|.+|+..+|.
T Consensus        16 tg~iG~~la~~l~~~G~~v~~~~r~   40 (239)
T PRK12828         16 FGGLGRATAAWLAARGARVALIGRG   40 (239)
T ss_pred             CCcHhHHHHHHHHHCCCeEEEEeCC
Confidence            3789999999999889999999874


No 74 
>PRK06949 short chain dehydrogenase; Provisional
Probab=73.11  E-value=3.3  Score=28.44  Aligned_cols=25  Identities=8%  Similarity=-0.036  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..+|.
T Consensus        18 sg~IG~~~a~~l~~~G~~Vi~~~r~   42 (258)
T PRK06949         18 SSGLGARFAQVLAQAGAKVVLASRR   42 (258)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEeCC
Confidence            3789999999999999999998774


No 75 
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=73.07  E-value=4.6  Score=27.84  Aligned_cols=25  Identities=12%  Similarity=-0.041  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.|..-|.+|+.++|.
T Consensus        17 s~gIG~~la~~l~~~G~~v~~~~r~   41 (260)
T PRK12823         17 AQGIGRGVALRAAAEGARVVLVDRS   41 (260)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCc
Confidence            3689999999999999999999874


No 76 
>PRK06194 hypothetical protein; Provisional
Probab=73.02  E-value=3.9  Score=28.69  Aligned_cols=25  Identities=16%  Similarity=0.005  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.|...|.+|+..|+.
T Consensus        15 sggIG~~la~~l~~~G~~V~~~~r~   39 (287)
T PRK06194         15 ASGFGLAFARIGAALGMKLVLADVQ   39 (287)
T ss_pred             ccHHHHHHHHHHHHCCCEEEEEeCC
Confidence            3689999999999999999998875


No 77 
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=73.01  E-value=4.7  Score=28.07  Aligned_cols=23  Identities=9%  Similarity=-0.161  Sum_probs=20.7

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||+++|+.+...|.+|+..+|.
T Consensus        23 GIG~a~a~~la~~G~~v~l~~r~   45 (258)
T PRK07533         23 SIAWGCARAFRALGAELAVTYLN   45 (258)
T ss_pred             cHHHHHHHHHHHcCCEEEEEeCC
Confidence            69999999999999999887764


No 78 
>PLN02253 xanthoxin dehydrogenase
Probab=72.70  E-value=3.9  Score=28.65  Aligned_cols=24  Identities=4%  Similarity=-0.169  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+...|++|+..++.
T Consensus        28 ~gIG~~la~~l~~~G~~v~~~~~~   51 (280)
T PLN02253         28 TGIGESIVRLFHKHGAKVCIVDLQ   51 (280)
T ss_pred             chHHHHHHHHHHHcCCEEEEEeCC
Confidence            689999999999999999998764


No 79 
>PRK06179 short chain dehydrogenase; Provisional
Probab=72.53  E-value=4.3  Score=28.21  Aligned_cols=26  Identities=0%  Similarity=-0.101  Sum_probs=23.1

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -.|.||+++++.+..-|.+|+..+|.
T Consensus        12 asg~iG~~~a~~l~~~g~~V~~~~r~   37 (270)
T PRK06179         12 ASSGIGRATAEKLARAGYRVFGTSRN   37 (270)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEeCC
Confidence            34789999999999999999998875


No 80 
>PRK07577 short chain dehydrogenase; Provisional
Probab=72.45  E-value=5.5  Score=26.89  Aligned_cols=27  Identities=7%  Similarity=-0.197  Sum_probs=23.6

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      -.|.||+.+++.+..-|.+|+..+|..
T Consensus        11 ~s~~iG~~ia~~l~~~G~~v~~~~r~~   37 (234)
T PRK07577         11 ATKGIGLALSLRLANLGHQVIGIARSA   37 (234)
T ss_pred             CCCcHHHHHHHHHHHCCCEEEEEeCCc
Confidence            347899999999999999999998754


No 81 
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=72.06  E-value=5  Score=27.53  Aligned_cols=25  Identities=8%  Similarity=-0.118  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.|...|.+|+.++|.
T Consensus        11 sg~iG~~la~~L~~~g~~vi~~~r~   35 (256)
T PRK12745         11 RRGIGLGIARALAAAGFDLAINDRP   35 (256)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEecC
Confidence            5789999999999999999998864


No 82 
>PRK07035 short chain dehydrogenase; Provisional
Probab=72.01  E-value=3.8  Score=28.13  Aligned_cols=25  Identities=4%  Similarity=-0.142  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||.++++.+...|++|+..+|.
T Consensus        17 s~gIG~~l~~~l~~~G~~Vi~~~r~   41 (252)
T PRK07035         17 SRGIGEAIAKLLAQQGAHVIVSSRK   41 (252)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEeCC
Confidence            3689999999999999999998875


No 83 
>KOG0725|consensus
Probab=72.01  E-value=4.2  Score=29.20  Aligned_cols=24  Identities=4%  Similarity=-0.168  Sum_probs=21.8

Q ss_pred             chHHHHHHHHhhcCCEEEEEcccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      -||+++|+++..+|++|+..+|..
T Consensus        19 GIG~aia~~la~~Ga~v~i~~r~~   42 (270)
T KOG0725|consen   19 GIGKAIALLLAKAGAKVVITGRSE   42 (270)
T ss_pred             hHHHHHHHHHHHCCCEEEEEeCCH
Confidence            599999999999999999998753


No 84 
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=71.95  E-value=4.4  Score=27.97  Aligned_cols=26  Identities=15%  Similarity=0.086  Sum_probs=22.8

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+++++.|...|++|+..+|..
T Consensus        15 s~~iG~~ia~~l~~~G~~v~~~~r~~   40 (257)
T PRK07067         15 ASGIGEAVAERYLAEGARVVIADIKP   40 (257)
T ss_pred             CchHHHHHHHHHHHcCCEEEEEcCCH
Confidence            46899999999999999999988753


No 85 
>PRK07831 short chain dehydrogenase; Provisional
Probab=71.87  E-value=4.7  Score=27.95  Aligned_cols=23  Identities=17%  Similarity=0.138  Sum_probs=20.9

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||+++++.+...|.+|+..+|.
T Consensus        29 gIG~~ia~~l~~~G~~V~~~~~~   51 (262)
T PRK07831         29 GIGSATARRALEEGARVVISDIH   51 (262)
T ss_pred             cHHHHHHHHHHHcCCEEEEEeCC
Confidence            59999999999999999998764


No 86 
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=71.84  E-value=3.9  Score=28.37  Aligned_cols=25  Identities=12%  Similarity=-0.065  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|++|+..+|.
T Consensus        15 s~gIG~~ia~~l~~~G~~V~~~~r~   39 (263)
T PRK06200         15 GSGIGRALVERFLAEGARVAVLERS   39 (263)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            3679999999999999999998875


No 87 
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=71.81  E-value=4.4  Score=27.92  Aligned_cols=24  Identities=0%  Similarity=-0.208  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.|...|.+|+..+|.
T Consensus        19 ~giG~~ia~~L~~~G~~vvl~~r~   42 (254)
T PRK08085         19 QGIGFLLATGLAEYGAEIIINDIT   42 (254)
T ss_pred             ChHHHHHHHHHHHcCCEEEEEcCC
Confidence            689999999999999999998875


No 88 
>PRK07454 short chain dehydrogenase; Provisional
Probab=71.66  E-value=3.9  Score=27.87  Aligned_cols=25  Identities=4%  Similarity=-0.149  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|..-|.+|+..+|.
T Consensus        15 sg~iG~~la~~l~~~G~~V~~~~r~   39 (241)
T PRK07454         15 SSGIGKATALAFAKAGWDLALVARS   39 (241)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999999875


No 89 
>PRK07856 short chain dehydrogenase; Provisional
Probab=71.64  E-value=4.9  Score=27.69  Aligned_cols=26  Identities=12%  Similarity=-0.035  Sum_probs=22.8

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+++++.|..-|.+|+..+|..
T Consensus        15 s~gIG~~la~~l~~~g~~v~~~~r~~   40 (252)
T PRK07856         15 TRGIGAGIARAFLAAGATVVVCGRRA   40 (252)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCCh
Confidence            46899999999999999999988753


No 90 
>PRK06182 short chain dehydrogenase; Validated
Probab=71.64  E-value=4.1  Score=28.47  Aligned_cols=26  Identities=8%  Similarity=-0.104  Sum_probs=22.9

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -.|.||+++++.+..-|.+|+..+|.
T Consensus        11 asggiG~~la~~l~~~G~~V~~~~r~   36 (273)
T PRK06182         11 ASSGIGKATARRLAAQGYTVYGAARR   36 (273)
T ss_pred             CCChHHHHHHHHHHHCCCEEEEEeCC
Confidence            35789999999999999999998875


No 91 
>PRK07062 short chain dehydrogenase; Provisional
Probab=71.58  E-value=4.6  Score=28.01  Aligned_cols=24  Identities=4%  Similarity=-0.133  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+...|++|+..+|.
T Consensus        18 ~giG~~ia~~l~~~G~~V~~~~r~   41 (265)
T PRK07062         18 SGIGLATVELLLEAGASVAICGRD   41 (265)
T ss_pred             chHHHHHHHHHHHCCCeEEEEeCC
Confidence            679999999999999999998875


No 92 
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=71.46  E-value=5.1  Score=27.30  Aligned_cols=27  Identities=11%  Similarity=0.009  Sum_probs=23.4

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      -.|.||+++++.+...|.+|+..+|..
T Consensus        13 asg~iG~~l~~~l~~~G~~V~~~~r~~   39 (251)
T PRK07231         13 ASSGIGEGIARRFAAEGARVVVTDRNE   39 (251)
T ss_pred             CCChHHHHHHHHHHHCCCEEEEEeCCH
Confidence            347899999999999999999998753


No 93 
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase
Probab=71.34  E-value=4.6  Score=31.12  Aligned_cols=25  Identities=4%  Similarity=-0.005  Sum_probs=20.9

Q ss_pred             ccchHHHHHHHHhh-cCCEEEE-Eccc
Q psy15800         83 ITQSDTNHTQRCLA-SIMQLVY-STCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~-fg~~V~~-~~r~  107 (109)
                      +|+||+.+.|.+.. ++++|++ .||.
T Consensus        93 FGRIGR~v~R~~~~~~~i~vvaINdp~  119 (421)
T PLN02272         93 FGRIGRLVLRIATSRDDIEVVAVNDPF  119 (421)
T ss_pred             cCHHHHHHHHHHhhcCCcEEEEecCCC
Confidence            48999999999885 8999998 5554


No 94 
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated
Probab=71.28  E-value=5.2  Score=27.64  Aligned_cols=25  Identities=8%  Similarity=-0.191  Sum_probs=22.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|.+|++.|+.
T Consensus        19 ~~gIG~a~a~~l~~~G~~vv~~~~~   43 (253)
T PRK08993         19 DTGLGQGMALGLAEAGCDIVGINIV   43 (253)
T ss_pred             CchHHHHHHHHHHHCCCEEEEecCc
Confidence            3689999999999999999988753


No 95 
>PRK06172 short chain dehydrogenase; Provisional
Probab=70.99  E-value=4.6  Score=27.75  Aligned_cols=25  Identities=4%  Similarity=-0.146  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+..-|.+|+..+|.
T Consensus        16 s~~iG~~ia~~l~~~G~~v~~~~r~   40 (253)
T PRK06172         16 AAGIGRATALAFAREGAKVVVADRD   40 (253)
T ss_pred             CchHHHHHHHHHHHcCCEEEEEeCC
Confidence            4789999999999999999999875


No 96 
>PRK12367 short chain dehydrogenase; Provisional
Probab=70.98  E-value=5.4  Score=27.87  Aligned_cols=25  Identities=12%  Similarity=-0.094  Sum_probs=22.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.||+++++.+...|++|+..+|..
T Consensus        24 ~gIG~ala~~l~~~G~~Vi~~~r~~   48 (245)
T PRK12367         24 GALGKALTKAFRAKGAKVIGLTHSK   48 (245)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEECCc
Confidence            5799999999999999999888753


No 97 
>PRK07806 short chain dehydrogenase; Provisional
Probab=70.93  E-value=6  Score=27.01  Aligned_cols=25  Identities=4%  Similarity=-0.109  Sum_probs=22.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+..-|.+|+..+|.
T Consensus        15 sggiG~~l~~~l~~~G~~V~~~~r~   39 (248)
T PRK07806         15 SRGIGADTAKILAGAGAHVVVNYRQ   39 (248)
T ss_pred             CCcHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999988764


No 98 
>PRK07074 short chain dehydrogenase; Provisional
Probab=70.89  E-value=4.7  Score=27.76  Aligned_cols=25  Identities=12%  Similarity=-0.049  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|...|++|+..+|.
T Consensus        11 t~~iG~~la~~L~~~g~~v~~~~r~   35 (257)
T PRK07074         11 AGGIGQALARRFLAAGDRVLALDID   35 (257)
T ss_pred             cchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4689999999999999999999875


No 99 
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia asimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids t
Probab=70.78  E-value=5.1  Score=28.73  Aligned_cols=23  Identities=9%  Similarity=-0.016  Sum_probs=20.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      +|++|+.+|+.|..+|++|++++
T Consensus        46 fGnVG~~~a~~L~e~GakvvaVs   68 (254)
T cd05313          46 SGNVAQYAAEKLLELGAKVVTLS   68 (254)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEE
Confidence            48999999999999999999653


No 100
>PF03807 F420_oxidored:  NADP oxidoreductase coenzyme F420-dependent;  InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain. It catalyses the reduction of F420 with NADP(+) and the reduction of NADP(+) with F420H(2).; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 2IZZ_B 2GR9_B 2GRA_B 2GER_C 2AMF_E 2AHR_C 2VQ3_B 2VNS_B 2RCY_D 2YJZ_D ....
Probab=70.77  E-value=3.8  Score=23.99  Aligned_cols=26  Identities=15%  Similarity=0.046  Sum_probs=21.5

Q ss_pred             ccchHHHHHHHHhhcC---CEEE-EEcccc
Q psy15800         83 ITQSDTNHTQRCLASI---MQLV-YSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg---~~V~-~~~r~~  108 (109)
                      .|++|+.+++.+..-|   .+|. +++|..
T Consensus         7 ~G~mg~al~~~l~~~g~~~~~v~~~~~r~~   36 (96)
T PF03807_consen    7 AGNMGSALARGLLASGIKPHEVIIVSSRSP   36 (96)
T ss_dssp             TSHHHHHHHHHHHHTTS-GGEEEEEEESSH
T ss_pred             CCHHHHHHHHHHHHCCCCceeEEeeccCcH
Confidence            4899999999999999   8998 447754


No 101
>PRK09186 flagellin modification protein A; Provisional
Probab=70.55  E-value=5  Score=27.51  Aligned_cols=26  Identities=4%  Similarity=-0.201  Sum_probs=22.8

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -.|.||+.+|+.|..-|++|+..+|.
T Consensus        12 as~giG~~~a~~l~~~g~~v~~~~r~   37 (256)
T PRK09186         12 AGGLIGSALVKAILEAGGIVIAADID   37 (256)
T ss_pred             CCchHHHHHHHHHHHCCCEEEEEecC
Confidence            34789999999999999999998765


No 102
>PRK09135 pteridine reductase; Provisional
Probab=70.55  E-value=5.7  Score=26.95  Aligned_cols=25  Identities=4%  Similarity=-0.108  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|++|+..+|.
T Consensus        15 ~g~iG~~l~~~l~~~g~~v~~~~r~   39 (249)
T PRK09135         15 ARRIGAAIARTLHAAGYRVAIHYHR   39 (249)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEcCC
Confidence            4789999999999999999998874


No 103
>PRK07904 short chain dehydrogenase; Provisional
Probab=70.43  E-value=5.6  Score=27.68  Aligned_cols=25  Identities=12%  Similarity=0.163  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcC-CEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASI-MQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg-~~V~~~~r~~  108 (109)
                      |.||+++|+.+..-| ++|+..+|..
T Consensus        18 ~giG~~la~~l~~~gg~~V~~~~r~~   43 (253)
T PRK07904         18 SEIGLAICERYLKNAPARVVLAALPD   43 (253)
T ss_pred             cHHHHHHHHHHHhcCCCeEEEEeCCc
Confidence            679999999998875 9999988753


No 104
>PRK05993 short chain dehydrogenase; Provisional
Probab=70.42  E-value=4.5  Score=28.46  Aligned_cols=26  Identities=0%  Similarity=-0.148  Sum_probs=23.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+++|+.+..-|.+|+..+|..
T Consensus        13 sggiG~~la~~l~~~G~~Vi~~~r~~   38 (277)
T PRK05993         13 SSGIGAYCARALQSDGWRVFATCRKE   38 (277)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEECCH
Confidence            57899999999999999999988753


No 105
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=70.39  E-value=5.5  Score=30.56  Aligned_cols=24  Identities=4%  Similarity=-0.245  Sum_probs=22.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |..|..+|+.|+..|++|.++|+.
T Consensus        23 G~sG~a~a~~L~~~G~~V~~~D~~   46 (458)
T PRK01710         23 GVSNIPLIKFLVKLGAKVTAFDKK   46 (458)
T ss_pred             cHHHHHHHHHHHHCCCEEEEECCC
Confidence            789999999999999999999964


No 106
>PRK08017 oxidoreductase; Provisional
Probab=70.38  E-value=4.9  Score=27.57  Aligned_cols=25  Identities=0%  Similarity=-0.193  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+..-|.+|+..+|.
T Consensus        11 sg~IG~~la~~l~~~g~~v~~~~r~   35 (256)
T PRK08017         11 SSGIGLEAALELKRRGYRVLAACRK   35 (256)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCC
Confidence            5789999999999999999988775


No 107
>PRK05867 short chain dehydrogenase; Provisional
Probab=70.34  E-value=4.7  Score=27.77  Aligned_cols=24  Identities=8%  Similarity=-0.067  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.|...|.+|+..+|.
T Consensus        19 ~gIG~~ia~~l~~~G~~V~~~~r~   42 (253)
T PRK05867         19 TGIGKRVALAYVEAGAQVAIAARH   42 (253)
T ss_pred             chHHHHHHHHHHHCCCEEEEEcCC
Confidence            679999999999999999988875


No 108
>KOG1200|consensus
Probab=70.20  E-value=5.7  Score=27.99  Aligned_cols=24  Identities=4%  Similarity=-0.170  Sum_probs=21.5

Q ss_pred             chHHHHHHHHhhcCCEEEEEcccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .||+++++++..-|++|.+.|...
T Consensus        25 GIGrAia~~la~~Garv~v~dl~~   48 (256)
T KOG1200|consen   25 GIGRAIAQLLAKKGARVAVADLDS   48 (256)
T ss_pred             hHHHHHHHHHHhcCcEEEEeecch
Confidence            599999999999999999988653


No 109
>PRK07576 short chain dehydrogenase; Provisional
Probab=70.19  E-value=5.8  Score=27.67  Aligned_cols=25  Identities=4%  Similarity=-0.088  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||..+++.+...|++|+..+|.
T Consensus        18 sggIG~~la~~l~~~G~~V~~~~r~   42 (264)
T PRK07576         18 TSGINLGIAQAFARAGANVAVASRS   42 (264)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999999875


No 110
>PRK08278 short chain dehydrogenase; Provisional
Probab=70.03  E-value=6  Score=27.80  Aligned_cols=25  Identities=8%  Similarity=-0.098  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..+|.
T Consensus        15 s~gIG~~ia~~l~~~G~~V~~~~r~   39 (273)
T PRK08278         15 SRGIGLAIALRAARDGANIVIAAKT   39 (273)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEecc
Confidence            4689999999999999999998875


No 111
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=69.80  E-value=6.6  Score=26.57  Aligned_cols=25  Identities=12%  Similarity=-0.083  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|++|+..+|.
T Consensus        14 s~~iG~~ia~~l~~~G~~v~~~~r~   38 (235)
T PRK06550         14 ASGIGLAQARAFLAQGAQVYGVDKQ   38 (235)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4689999999999999999998874


No 112
>PRK08264 short chain dehydrogenase; Validated
Probab=69.57  E-value=5.2  Score=27.17  Aligned_cols=26  Identities=8%  Similarity=-0.097  Sum_probs=22.8

Q ss_pred             ccchHHHHHHHHhhcCC-EEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIM-QLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~-~V~~~~r~~  108 (109)
                      .|.||+++|+.|..-|. +|+..+|..
T Consensus        15 sg~iG~~la~~l~~~G~~~V~~~~r~~   41 (238)
T PRK08264         15 NRGIGRAFVEQLLARGAAKVYAAARDP   41 (238)
T ss_pred             CchHHHHHHHHHHHCCcccEEEEecCh
Confidence            47899999999999999 999888753


No 113
>PRK06500 short chain dehydrogenase; Provisional
Probab=69.35  E-value=6.4  Score=26.82  Aligned_cols=25  Identities=8%  Similarity=-0.000  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|++|+..+|.
T Consensus        15 sg~iG~~la~~l~~~g~~v~~~~r~   39 (249)
T PRK06500         15 TSGIGLETARQFLAEGARVAITGRD   39 (249)
T ss_pred             CchHHHHHHHHHHHCCCEEEEecCC
Confidence            4789999999999999999988874


No 114
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Members of this protein family are CDP-glucose 4,6-dehydratase from a variety of Gram-negative and Gram-positive bacteria. Members typically are encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate, CDP-D-glucose, used by this enzyme to produce CDP-4-keto-6-deoxyglucose.
Probab=69.35  E-value=5.8  Score=28.93  Aligned_cols=25  Identities=4%  Similarity=-0.275  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|-||+.+++.|..-|.+|++.+|.
T Consensus        13 tG~IG~~l~~~L~~~G~~V~~~~r~   37 (349)
T TIGR02622        13 TGFKGSWLSLWLLELGAEVYGYSLD   37 (349)
T ss_pred             CChhHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999998864


No 115
>PRK08251 short chain dehydrogenase; Provisional
Probab=69.22  E-value=4.8  Score=27.51  Aligned_cols=25  Identities=8%  Similarity=-0.065  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+..-|++|+..+|.
T Consensus        11 s~giG~~la~~l~~~g~~v~~~~r~   35 (248)
T PRK08251         11 SSGLGAGMAREFAAKGRDLALCARR   35 (248)
T ss_pred             CCHHHHHHHHHHHHcCCEEEEEeCC
Confidence            4789999999999999999988875


No 116
>PRK07063 short chain dehydrogenase; Provisional
Probab=69.19  E-value=5.5  Score=27.53  Aligned_cols=25  Identities=0%  Similarity=-0.170  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+..-|.+|+..+|.
T Consensus        16 s~gIG~~~a~~l~~~G~~vv~~~r~   40 (260)
T PRK07063         16 AQGIGAAIARAFAREGAAVALADLD   40 (260)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            3689999999999999999998874


No 117
>PRK12939 short chain dehydrogenase; Provisional
Probab=69.07  E-value=5.4  Score=27.15  Aligned_cols=25  Identities=0%  Similarity=-0.037  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|++|+..+|.
T Consensus        16 ~g~iG~~la~~l~~~G~~v~~~~r~   40 (250)
T PRK12939         16 ARGLGAAFAEALAEAGATVAFNDGL   40 (250)
T ss_pred             CChHHHHHHHHHHHcCCEEEEEeCC
Confidence            4789999999999999999988764


No 118
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=69.04  E-value=5.7  Score=30.24  Aligned_cols=24  Identities=0%  Similarity=-0.129  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..+|+.|+..|.+|.++|..
T Consensus        15 G~sG~s~a~~L~~~G~~v~~~D~~   38 (448)
T PRK03803         15 GKTGLSVVRFLARQGIPFAVMDSR   38 (448)
T ss_pred             cHhHHHHHHHHHhCCCeEEEEeCC
Confidence            789999999999999999999964


No 119
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional
Probab=69.02  E-value=4.4  Score=29.55  Aligned_cols=26  Identities=4%  Similarity=-0.234  Sum_probs=23.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..|..-|.+|..|+|..
T Consensus        12 ~G~mG~~ia~~L~~~G~~V~~~~r~~   37 (328)
T PRK14618         12 AGAWGTALAVLAASKGVPVRLWARRP   37 (328)
T ss_pred             cCHHHHHHHHHHHHCCCeEEEEeCCH
Confidence            48999999999999999999999863


No 120
>PRK06125 short chain dehydrogenase; Provisional
Probab=69.01  E-value=6.1  Score=27.31  Aligned_cols=24  Identities=8%  Similarity=-0.114  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+...|++|+..+|.
T Consensus        17 ~giG~~ia~~l~~~G~~V~~~~r~   40 (259)
T PRK06125         17 KGIGAAAAEAFAAEGCHLHLVARD   40 (259)
T ss_pred             chHHHHHHHHHHHcCCEEEEEeCC
Confidence            679999999999999999998875


No 121
>PRK08862 short chain dehydrogenase; Provisional
Probab=68.91  E-value=5.4  Score=27.44  Aligned_cols=25  Identities=4%  Similarity=-0.149  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      +.||+++++.+...|++|+..+|..
T Consensus        15 ~GIG~aia~~la~~G~~V~~~~r~~   39 (227)
T PRK08862         15 SVLGRTISCHFARLGATLILCDQDQ   39 (227)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEcCCH
Confidence            4799999999999999999988753


No 122
>PRK09291 short chain dehydrogenase; Provisional
Probab=68.85  E-value=6.3  Score=27.04  Aligned_cols=25  Identities=4%  Similarity=-0.165  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|...|++|+..+|.
T Consensus        11 sg~iG~~ia~~l~~~G~~v~~~~r~   35 (257)
T PRK09291         11 GSGFGREVALRLARKGHNVIAGVQI   35 (257)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEeCC
Confidence            5789999999999999999988764


No 123
>PRK07814 short chain dehydrogenase; Provisional
Probab=68.55  E-value=6.7  Score=27.25  Aligned_cols=25  Identities=0%  Similarity=-0.209  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|++|+..+|.
T Consensus        19 sggIG~~~a~~l~~~G~~Vi~~~r~   43 (263)
T PRK07814         19 GRGLGAAIALAFAEAGADVLIAART   43 (263)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCC
Confidence            3689999999999999999998875


No 124
>PRK07825 short chain dehydrogenase; Provisional
Probab=68.43  E-value=5  Score=27.99  Aligned_cols=25  Identities=4%  Similarity=-0.169  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.|...|.+|+..+|.
T Consensus        14 sggiG~~la~~l~~~G~~v~~~~r~   38 (273)
T PRK07825         14 ARGIGLATARALAALGARVAIGDLD   38 (273)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEECC
Confidence            4689999999999999999988764


No 125
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=68.42  E-value=6.5  Score=27.20  Aligned_cols=24  Identities=8%  Similarity=-0.165  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+++..-|++|+..+|.
T Consensus        18 ~gIG~aia~~l~~~G~~vv~~~~~   41 (251)
T PRK12481         18 TGLGQGMAIGLAKAGADIVGVGVA   41 (251)
T ss_pred             chHHHHHHHHHHHCCCEEEEecCc
Confidence            689999999999999999988764


No 126
>PRK05717 oxidoreductase; Validated
Probab=68.35  E-value=6.4  Score=27.13  Aligned_cols=25  Identities=12%  Similarity=-0.062  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++|+.+..-|++|+..++.
T Consensus        19 sg~IG~~~a~~l~~~g~~v~~~~~~   43 (255)
T PRK05717         19 ARGIGLGIAAWLIAEGWQVVLADLD   43 (255)
T ss_pred             cchHHHHHHHHHHHcCCEEEEEcCC
Confidence            3789999999999999999988764


No 127
>PRK12829 short chain dehydrogenase; Provisional
Probab=68.28  E-value=6.2  Score=27.13  Aligned_cols=25  Identities=0%  Similarity=-0.140  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|...|.+|+..+|.
T Consensus        20 ~g~iG~~~a~~L~~~g~~V~~~~r~   44 (264)
T PRK12829         20 ASGIGRAIAEAFAEAGARVHVCDVS   44 (264)
T ss_pred             CCcHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999998875


No 128
>PRK05866 short chain dehydrogenase; Provisional
Probab=68.28  E-value=4.9  Score=28.75  Aligned_cols=24  Identities=4%  Similarity=-0.108  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++|+.+..-|.+|+..+|.
T Consensus        50 ggIG~~la~~La~~G~~Vi~~~R~   73 (293)
T PRK05866         50 SGIGEAAAEQFARRGATVVAVARR   73 (293)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEECC
Confidence            679999999999999999998875


No 129
>PRK07478 short chain dehydrogenase; Provisional
Probab=68.21  E-value=5.9  Score=27.27  Aligned_cols=25  Identities=4%  Similarity=-0.122  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+..-|.+|+..+|.
T Consensus        15 s~giG~~ia~~l~~~G~~v~~~~r~   39 (254)
T PRK07478         15 SSGIGRAAAKLFAREGAKVVVGARR   39 (254)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCC
Confidence            4689999999999999999988875


No 130
>PLN02780 ketoreductase/ oxidoreductase
Probab=68.20  E-value=4.2  Score=29.64  Aligned_cols=25  Identities=8%  Similarity=-0.057  Sum_probs=22.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.||+++|+.+..-|++|+..+|..
T Consensus        63 ~GIG~alA~~La~~G~~Vil~~R~~   87 (320)
T PLN02780         63 DGIGKGFAFQLARKGLNLVLVARNP   87 (320)
T ss_pred             cHHHHHHHHHHHHCCCCEEEEECCH
Confidence            5799999999999999999998753


No 131
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=68.14  E-value=6.4  Score=26.77  Aligned_cols=25  Identities=4%  Similarity=-0.160  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..+|.
T Consensus        14 ~g~iG~~~a~~l~~~G~~vi~~~r~   38 (253)
T PRK08217         14 AQGLGRAMAEYLAQKGAKLALIDLN   38 (253)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999998875


No 132
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=68.12  E-value=5.4  Score=27.13  Aligned_cols=25  Identities=0%  Similarity=-0.316  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|..-|.+|+..+|.
T Consensus        16 sg~iG~~l~~~L~~~G~~Vi~~~r~   40 (239)
T PRK07666         16 GRGIGRAVAIALAKEGVNVGLLART   40 (239)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4689999999999999999998875


No 133
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=67.87  E-value=4.7  Score=28.91  Aligned_cols=26  Identities=8%  Similarity=0.088  Sum_probs=23.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+..-|.+|+.||+..
T Consensus        12 aG~mG~~iA~~la~~G~~V~l~d~~~   37 (292)
T PRK07530         12 AGQMGNGIAHVCALAGYDVLLNDVSA   37 (292)
T ss_pred             CcHHHHHHHHHHHHCCCeEEEEeCCH
Confidence            48899999999999999999999864


No 134
>PRK07024 short chain dehydrogenase; Provisional
Probab=67.69  E-value=5.1  Score=27.72  Aligned_cols=25  Identities=4%  Similarity=-0.180  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.|..-|.+|+..+|.
T Consensus        11 s~gIG~~la~~l~~~G~~v~~~~r~   35 (257)
T PRK07024         11 SSGIGQALAREYARQGATLGLVARR   35 (257)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999998874


No 135
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=67.58  E-value=5  Score=28.95  Aligned_cols=26  Identities=8%  Similarity=0.073  Sum_probs=23.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+...|.+|+.||+..
T Consensus        13 aG~mG~~iA~~~a~~G~~V~l~d~~~   38 (286)
T PRK07819         13 AGQMGAGIAEVCARAGVDVLVFETTE   38 (286)
T ss_pred             ccHHHHHHHHHHHhCCCEEEEEECCH
Confidence            37899999999999999999999864


No 136
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This model describes 2-deoxy-D-gluconate 3-dehydrogenase (also called 2-keto-3-deoxygluconate oxidoreductase), a member of the family of short-chain-alcohol dehydrogenases (pfam00106). This protein has been characterized in Erwinia chrysanthemi as an enzyme of pectin degradation.
Probab=67.54  E-value=7.1  Score=26.65  Aligned_cols=25  Identities=8%  Similarity=-0.194  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+|+.+..-|.+|+..+|.
T Consensus        14 s~gIG~~ia~~l~~~G~~vi~~~r~   38 (248)
T TIGR01832        14 NTGLGQGIAVGLAEAGADIVGAGRS   38 (248)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEcCc
Confidence            4689999999999999999998874


No 137
>KOG1209|consensus
Probab=67.41  E-value=7.6  Score=27.76  Aligned_cols=26  Identities=0%  Similarity=-0.273  Sum_probs=23.8

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||-++|+.+..-|+.|++..|..
T Consensus        17 ~GGIG~ala~ef~~~G~~V~AtaR~~   42 (289)
T KOG1209|consen   17 SGGIGYALAKEFARNGYLVYATARRL   42 (289)
T ss_pred             CcchhHHHHHHHHhCCeEEEEEcccc
Confidence            38899999999999999999998865


No 138
>PRK06196 oxidoreductase; Provisional
Probab=67.38  E-value=5.6  Score=28.59  Aligned_cols=24  Identities=4%  Similarity=-0.050  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+..-|.+|+..+|.
T Consensus        36 ggIG~~~a~~L~~~G~~Vv~~~R~   59 (315)
T PRK06196         36 SGLGLETTRALAQAGAHVIVPARR   59 (315)
T ss_pred             chHHHHHHHHHHHCCCEEEEEeCC
Confidence            689999999999999999998875


No 139
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=67.35  E-value=8  Score=26.79  Aligned_cols=26  Identities=12%  Similarity=-0.018  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+++++.|..-|.+|+..++..
T Consensus        18 s~gIG~~la~~l~~~G~~v~~~~~~~   43 (266)
T PRK06171         18 SSGIGLAIVKELLANGANVVNADIHG   43 (266)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCCc
Confidence            36899999999999999999887653


No 140
>PRK05876 short chain dehydrogenase; Provisional
Probab=67.33  E-value=7.1  Score=27.58  Aligned_cols=25  Identities=4%  Similarity=-0.108  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++|+.|...|++|+..++.
T Consensus        15 s~gIG~ala~~La~~G~~Vv~~~r~   39 (275)
T PRK05876         15 ASGIGLATGTEFARRGARVVLGDVD   39 (275)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4689999999999999999988764


No 141
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=67.23  E-value=7.6  Score=26.93  Aligned_cols=24  Identities=8%  Similarity=-0.050  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+.|..-|++|+..+|.
T Consensus        19 ~gIG~a~a~~la~~G~~Vi~~~r~   42 (252)
T PRK06079         19 RSIAWGCAQAIKDQGATVIYTYQN   42 (252)
T ss_pred             CchHHHHHHHHHHCCCEEEEecCc
Confidence            369999999999999999988764


No 142
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=67.09  E-value=6.1  Score=27.62  Aligned_cols=24  Identities=0%  Similarity=-0.208  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.|...|.+|+..+|.
T Consensus        20 ~giG~~ia~~l~~~G~~V~~~~r~   43 (278)
T PRK08277         20 GVLGGAMAKELARAGAKVAILDRN   43 (278)
T ss_pred             chHHHHHHHHHHHCCCEEEEEeCC
Confidence            679999999999999999998875


No 143
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann
Probab=66.82  E-value=5.7  Score=25.28  Aligned_cols=25  Identities=4%  Similarity=-0.211  Sum_probs=21.8

Q ss_pred             cchHHHHHHHHhhcC-CEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASI-MQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg-~~V~~~~r~~  108 (109)
                      |.+|+.+++.+...| .+|..+||..
T Consensus        28 G~~g~~~a~~l~~~g~~~v~v~~r~~   53 (155)
T cd01065          28 GGAARAVAYALAELGAAKIVIVNRTL   53 (155)
T ss_pred             cHHHHHHHHHHHHCCCCEEEEEcCCH
Confidence            789999999999886 6899999864


No 144
>PRK09072 short chain dehydrogenase; Provisional
Probab=66.72  E-value=7.5  Score=26.94  Aligned_cols=25  Identities=8%  Similarity=-0.116  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|.+|+..+|.
T Consensus        14 s~~iG~~ia~~l~~~G~~V~~~~r~   38 (263)
T PRK09072         14 SGGIGQALAEALAAAGARLLLVGRN   38 (263)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEECC
Confidence            4689999999999999999998875


No 145
>PRK06138 short chain dehydrogenase; Provisional
Probab=66.54  E-value=6.6  Score=26.79  Aligned_cols=25  Identities=4%  Similarity=-0.164  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+..-|++|+..+|.
T Consensus        14 sg~iG~~la~~l~~~G~~v~~~~r~   38 (252)
T PRK06138         14 GSGIGRATAKLFAREGARVVVADRD   38 (252)
T ss_pred             CchHHHHHHHHHHHCCCeEEEecCC
Confidence            4789999999999999999988765


No 146
>PRK05875 short chain dehydrogenase; Provisional
Probab=66.50  E-value=6.9  Score=27.29  Aligned_cols=25  Identities=4%  Similarity=-0.162  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+..-|.+|+.++|.
T Consensus        16 sg~IG~~la~~l~~~G~~V~~~~r~   40 (276)
T PRK05875         16 GSGIGKGVAAGLVAAGAAVMIVGRN   40 (276)
T ss_pred             CcHHHHHHHHHHHHCCCeEEEEeCC
Confidence            3789999999999999999998875


No 147
>PF01488 Shikimate_DH:  Shikimate / quinate 5-dehydrogenase;  InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases. Shikimate 5-dehydrogenase (1.1.1.25 from EC) catalyses the conversion of shikimate to 5-dehydroshikimate [, ]. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids []. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites, 3-dehydroquinate and dehydroshikimate. Glutamyl-tRNA reductase (1.2.1.70 from EC) catalyzes the first step of tetrapyrrole biosynthesis in plants, archaea and most bacteria. The dimeric enzyme has an unusual V-shaped architecture where each monomer consists of three domains linked by a long 'spinal' alpha-helix. The central catalytic domain specifically recognises the glutamate moiety of the substrate []. ; PDB: 2EV9_B 2CY0_B 1WXD_A 2D5C_A 1NVT_B 2EGG_A 3PWZ_A 3DOO_A 3DON_A 3FBT_C ....
Probab=66.43  E-value=4.4  Score=25.77  Aligned_cols=25  Identities=4%  Similarity=-0.177  Sum_probs=22.6

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~~  108 (109)
                      |..|+.++..|...|++ |..++|+.
T Consensus        21 Gg~ar~v~~~L~~~g~~~i~i~nRt~   46 (135)
T PF01488_consen   21 GGAARAVAAALAALGAKEITIVNRTP   46 (135)
T ss_dssp             SHHHHHHHHHHHHTTSSEEEEEESSH
T ss_pred             HHHHHHHHHHHHHcCCCEEEEEECCH
Confidence            78999999999999997 99999864


No 148
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase
Probab=66.13  E-value=7  Score=29.37  Aligned_cols=25  Identities=4%  Similarity=-0.178  Sum_probs=22.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.||+.+++.|..-|.+|++++|..
T Consensus        70 G~IG~~l~~~Ll~~G~~V~~l~R~~   94 (390)
T PLN02657         70 GYIGKFVVRELVRRGYNVVAVAREK   94 (390)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEEech
Confidence            7899999999999999999998753


No 149
>PRK06057 short chain dehydrogenase; Provisional
Probab=66.08  E-value=6.7  Score=27.02  Aligned_cols=25  Identities=12%  Similarity=-0.071  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|++|+..+|.
T Consensus        16 sggIG~~~a~~l~~~G~~v~~~~r~   40 (255)
T PRK06057         16 GSGIGLATARRLAAEGATVVVGDID   40 (255)
T ss_pred             CchHHHHHHHHHHHcCCEEEEEeCC
Confidence            4789999999999999999998764


No 150
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional
Probab=66.07  E-value=6.9  Score=26.80  Aligned_cols=25  Identities=0%  Similarity=-0.245  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||..+++.|...|++|+..+|.
T Consensus        21 ~g~iG~~la~~l~~~G~~Vi~~~r~   45 (247)
T PRK08945         21 GDGIGREAALTYARHGATVILLGRT   45 (247)
T ss_pred             CchHHHHHHHHHHHCCCcEEEEeCC
Confidence            3689999999999999999999875


No 151
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NAD(P)+. This subfamily includes glutamate, leucine, phenylalanine, and valine DHs. Glutamate DH is a multi-domain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms.  Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent.  As in other NAD+-dependent DHs, monomers in this family have 2 domains separated by a deep cleft. Here the c-terminal domain contains a modified NAD-binding Rossmann fold with 7 rather than the usual 6 beta strands and one strand anti-parral
Probab=65.93  E-value=7.2  Score=27.13  Aligned_cols=22  Identities=0%  Similarity=-0.108  Sum_probs=19.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~  104 (109)
                      +|++|+.+|+.|...|.+|++.
T Consensus        31 fGnVG~~~a~~L~~~G~~vV~v   52 (217)
T cd05211          31 LGNVGWGLAKKLAEEGGKVLAV   52 (217)
T ss_pred             CCHHHHHHHHHHHHcCCEEEEE
Confidence            4899999999999999987765


No 152
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=65.71  E-value=8.1  Score=26.65  Aligned_cols=25  Identities=8%  Similarity=-0.142  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||..+|+.+...|.+|+..+|.
T Consensus        21 ~g~IG~~la~~l~~~G~~V~~~~r~   45 (259)
T PRK08213         21 SRGLGLQIAEALGEAGARVVLSARK   45 (259)
T ss_pred             CchHHHHHHHHHHHcCCEEEEEeCC
Confidence            3789999999999999999998874


No 153
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated
Probab=65.46  E-value=5.5  Score=31.03  Aligned_cols=26  Identities=8%  Similarity=-0.143  Sum_probs=23.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+..-|.+|..||+..
T Consensus        12 ~G~MG~~iA~~la~~G~~V~v~D~~~   37 (495)
T PRK07531         12 GGVIGGGWAARFLLAGIDVAVFDPHP   37 (495)
T ss_pred             cCHHHHHHHHHHHhCCCeEEEEeCCH
Confidence            48999999999999999999999864


No 154
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=65.15  E-value=8.1  Score=26.31  Aligned_cols=25  Identities=4%  Similarity=-0.193  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..+|.
T Consensus        12 s~~iG~~la~~l~~~g~~v~~~~r~   36 (250)
T TIGR03206        12 GGGIGGATCRRFAEEGAKVAVFDLN   36 (250)
T ss_pred             CChHHHHHHHHHHHCCCEEEEecCC
Confidence            4789999999999999999988765


No 155
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=65.00  E-value=7.1  Score=26.69  Aligned_cols=27  Identities=4%  Similarity=-0.146  Sum_probs=23.3

Q ss_pred             hhccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         81 ELITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        81 ~l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .-.|.||+.+++.+...|.+|+..+|.
T Consensus        11 G~sg~iG~~la~~l~~~g~~v~~~~r~   37 (258)
T PRK12429         11 GAASGIGLEIALALAKEGAKVVIADLN   37 (258)
T ss_pred             CCCchHHHHHHHHHHHCCCeEEEEeCC
Confidence            345889999999999999999998875


No 156
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional
Probab=64.94  E-value=6.4  Score=31.57  Aligned_cols=24  Identities=4%  Similarity=-0.061  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+++.|...|.+|.+++|.
T Consensus        90 GgIG~aLAr~LLk~G~~Vval~Rn  113 (576)
T PLN03209         90 GKVGSRTVRELLKLGFRVRAGVRS  113 (576)
T ss_pred             CHHHHHHHHHHHHCCCeEEEEeCC
Confidence            789999999999999999998875


No 157
>PRK07774 short chain dehydrogenase; Provisional
Probab=64.84  E-value=7.3  Score=26.57  Aligned_cols=25  Identities=4%  Similarity=-0.141  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..+|.
T Consensus        15 sg~iG~~la~~l~~~g~~vi~~~r~   39 (250)
T PRK07774         15 AGGIGQAYAEALAREGASVVVADIN   39 (250)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999999875


No 158
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated
Probab=64.84  E-value=7.9  Score=29.53  Aligned_cols=24  Identities=0%  Similarity=-0.165  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|.++|+.+...|.+|+++++.
T Consensus       214 G~~G~aiA~~l~~~Ga~V~~v~~~  237 (399)
T PRK05579        214 GKMGYALARAAARRGADVTLVSGP  237 (399)
T ss_pred             chHHHHHHHHHHHCCCEEEEeCCC
Confidence            889999999999999999998753


No 159
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=64.81  E-value=8.6  Score=26.41  Aligned_cols=25  Identities=0%  Similarity=-0.162  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+..-|.+|+.++|.
T Consensus        20 s~~IG~~la~~l~~~G~~v~~~~r~   44 (256)
T PRK06124         20 ARGLGFEIARALAGAGAHVLVNGRN   44 (256)
T ss_pred             CchHHHHHHHHHHHcCCeEEEEeCC
Confidence            3689999999999999999999875


No 160
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins. Amino acid dehydrogenase(DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and are found in glutamate, leucine, and phenylalanine DHs (DHs), methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel  domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an al
Probab=64.76  E-value=9.7  Score=22.11  Aligned_cols=23  Identities=4%  Similarity=-0.087  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhc-CCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLAS-IMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~f-g~~V~~~~r  106 (109)
                      |.+|+.+++.+..+ +.+|..+||
T Consensus        32 G~~g~~~a~~l~~~~~~~v~v~~r   55 (86)
T cd05191          32 GEVGKGIAKLLADEGGKKVVLCDR   55 (86)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEEcC
Confidence            88999999999988 678888886


No 161
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=64.66  E-value=7.8  Score=29.36  Aligned_cols=24  Identities=4%  Similarity=-0.158  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..+|+.|...|++|+++|+.
T Consensus        14 g~~G~s~a~~l~~~G~~V~~~d~~   37 (447)
T PRK02472         14 AKSGYAAAKLLHKLGANVTVNDGK   37 (447)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEcCC
Confidence            569999999999999999999864


No 162
>PRK08589 short chain dehydrogenase; Validated
Probab=64.59  E-value=8.6  Score=26.93  Aligned_cols=25  Identities=4%  Similarity=-0.222  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+..-|.+|+..+|.
T Consensus        15 s~gIG~aia~~l~~~G~~vi~~~r~   39 (272)
T PRK08589         15 STGIGQASAIALAQEGAYVLAVDIA   39 (272)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCc
Confidence            3679999999999999999998864


No 163
>PRK08643 acetoin reductase; Validated
Probab=64.26  E-value=8.9  Score=26.35  Aligned_cols=25  Identities=4%  Similarity=-0.096  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|++|+..+|.
T Consensus        11 s~giG~~la~~l~~~G~~v~~~~r~   35 (256)
T PRK08643         11 GQGIGFAIAKRLVEDGFKVAIVDYN   35 (256)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999988764


No 164
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=64.21  E-value=8.1  Score=26.05  Aligned_cols=26  Identities=12%  Similarity=-0.061  Sum_probs=22.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+.+++.+...|.+|+..+|..
T Consensus        14 sg~iG~~l~~~l~~~g~~v~~~~r~~   39 (246)
T PRK05653         14 SRGIGRAIALRLAADGAKVVIYDSNE   39 (246)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEeCCh
Confidence            47899999999999999999988753


No 165
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=63.98  E-value=6.2  Score=28.45  Aligned_cols=26  Identities=8%  Similarity=-0.032  Sum_probs=23.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+..-|.+|+.||+..
T Consensus        12 aG~mG~~iA~~l~~~g~~V~~~d~~~   37 (311)
T PRK06130         12 AGTMGSGIAALFARKGLQVVLIDVME   37 (311)
T ss_pred             CCHHHHHHHHHHHhCCCeEEEEECCH
Confidence            48899999999999999999999753


No 166
>PRK08226 short chain dehydrogenase; Provisional
Probab=63.98  E-value=9  Score=26.42  Aligned_cols=25  Identities=4%  Similarity=-0.090  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|...|.+|+..+|.
T Consensus        15 s~giG~~la~~l~~~G~~Vv~~~r~   39 (263)
T PRK08226         15 LQGIGEGIARVFARHGANLILLDIS   39 (263)
T ss_pred             CChHHHHHHHHHHHCCCEEEEecCC
Confidence            4689999999999999999998875


No 167
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=63.90  E-value=8.1  Score=29.29  Aligned_cols=24  Identities=4%  Similarity=-0.183  Sum_probs=22.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|.++|+.|...|.+|.++|+.
T Consensus        14 g~~G~~~A~~l~~~G~~V~~~d~~   37 (450)
T PRK14106         14 GVSGLALAKFLKKLGAKVILTDEK   37 (450)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCC
Confidence            569999999999999999999985


No 168
>PRK06914 short chain dehydrogenase; Provisional
Probab=63.63  E-value=8.1  Score=26.99  Aligned_cols=25  Identities=4%  Similarity=-0.218  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+.++|.
T Consensus        12 sg~iG~~la~~l~~~G~~V~~~~r~   36 (280)
T PRK06914         12 SSGFGLLTTLELAKKGYLVIATMRN   36 (280)
T ss_pred             CchHHHHHHHHHHhCCCEEEEEeCC
Confidence            4789999999999999999998764


No 169
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed
Probab=63.46  E-value=6.4  Score=28.17  Aligned_cols=25  Identities=4%  Similarity=-0.197  Sum_probs=22.5

Q ss_pred             cchHHHHHHHHhhcC-CEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASI-MQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg-~~V~~~~r~~  108 (109)
                      |.+|+.++..|..+| .+|..++|..
T Consensus       132 Gg~a~ai~~aL~~~g~~~V~v~~R~~  157 (278)
T PRK00258        132 GGAARAVILPLLDLGVAEITIVNRTV  157 (278)
T ss_pred             cHHHHHHHHHHHHcCCCEEEEEeCCH
Confidence            679999999999999 6899999864


No 170
>PRK08818 prephenate dehydrogenase; Provisional
Probab=63.29  E-value=8.6  Score=29.07  Aligned_cols=27  Identities=0%  Similarity=-0.245  Sum_probs=22.9

Q ss_pred             hhccchHHHHHHHHhh-cCCEEEEEccc
Q psy15800         81 ELITQSDTNHTQRCLA-SIMQLVYSTCY  107 (109)
Q Consensus        81 ~l~G~IG~~va~~~~~-fg~~V~~~~r~  107 (109)
                      .+.|.||+.+|+.++. ++.+|+++|+.
T Consensus        11 Gl~GliGgslA~alk~~~~~~V~g~D~~   38 (370)
T PRK08818         11 GSAGAYGRWLARFLRTRMQLEVIGHDPA   38 (370)
T ss_pred             CCCCHHHHHHHHHHHhcCCCEEEEEcCC
Confidence            3458999999999995 69999999973


No 171
>KOG0023|consensus
Probab=63.19  E-value=8.1  Score=29.01  Aligned_cols=23  Identities=13%  Similarity=-0.094  Sum_probs=20.4

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -+|.--.+.++||||+|++.|+.
T Consensus       192 GLGh~aVq~AKAMG~rV~vis~~  214 (360)
T KOG0023|consen  192 GLGHMAVQYAKAMGMRVTVISTS  214 (360)
T ss_pred             ccchHHHHHHHHhCcEEEEEeCC
Confidence            38888888999999999999976


No 172
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional
Probab=63.10  E-value=12  Score=27.46  Aligned_cols=25  Identities=4%  Similarity=-0.117  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|-||+.+++.|..-|.+|+++|+.
T Consensus        24 tGfiG~~lv~~L~~~g~~V~~~d~~   48 (348)
T PRK15181         24 AGFIGSGLLEELLFLNQTVIGLDNF   48 (348)
T ss_pred             ccHHHHHHHHHHHHCCCEEEEEeCC
Confidence            4889999999999999999999874


No 173
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional
Probab=62.93  E-value=8.9  Score=26.56  Aligned_cols=24  Identities=8%  Similarity=-0.017  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+++.|..-|.+|++..|.
T Consensus        27 G~iG~~l~~~L~~~g~~V~~~~R~   50 (251)
T PLN00141         27 GRTGKRIVEQLLAKGFAVKAGVRD   50 (251)
T ss_pred             cHHHHHHHHHHHhCCCEEEEEecC
Confidence            789999999999889999987664


No 174
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=62.85  E-value=9.8  Score=26.25  Aligned_cols=24  Identities=8%  Similarity=-0.083  Sum_probs=21.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+++.+...|++|+..++.
T Consensus        25 ~gIG~~ia~~l~~~G~~v~~~~~~   48 (258)
T PRK06935         25 TGLGQGYAVALAKAGADIIITTHG   48 (258)
T ss_pred             chHHHHHHHHHHHCCCEEEEEeCC
Confidence            689999999999999999988764


No 175
>PRK09414 glutamate dehydrogenase; Provisional
Probab=62.85  E-value=8.3  Score=29.94  Aligned_cols=21  Identities=5%  Similarity=-0.067  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEE
Q psy15800         84 TQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~  104 (109)
                      |++|+.+|+.|..+|++|++.
T Consensus       241 GnVG~~~A~~L~~~GakVVav  261 (445)
T PRK09414        241 GNVAIYAIEKAQQLGAKVVTC  261 (445)
T ss_pred             CHHHHHHHHHHHHCCCEEEEE
Confidence            899999999999999999988


No 176
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=62.83  E-value=8.3  Score=26.57  Aligned_cols=24  Identities=8%  Similarity=-0.085  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+++.+...|++|+..+|.
T Consensus        21 ~gIG~~la~~l~~~G~~vv~~~r~   44 (255)
T PRK06113         21 AGIGKEIAITFATAGASVVVSDIN   44 (255)
T ss_pred             chHHHHHHHHHHHCCCeEEEEeCC
Confidence            689999999999999999988765


No 177
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=62.77  E-value=10  Score=26.38  Aligned_cols=24  Identities=4%  Similarity=-0.093  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+.+..-|.+|+..+|.
T Consensus        19 ~GIG~a~a~~la~~G~~v~l~~r~   42 (256)
T PRK07889         19 SSIAFHVARVAQEQGAEVVLTGFG   42 (256)
T ss_pred             chHHHHHHHHHHHCCCEEEEecCc
Confidence            479999999999999999988754


No 178
>PRK06197 short chain dehydrogenase; Provisional
Probab=62.75  E-value=10  Score=27.05  Aligned_cols=24  Identities=13%  Similarity=-0.046  Sum_probs=21.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++|+.+...|.+|+..+|.
T Consensus        26 ~gIG~~~a~~l~~~G~~vi~~~r~   49 (306)
T PRK06197         26 TGLGYETAAALAAKGAHVVLAVRN   49 (306)
T ss_pred             CcHHHHHHHHHHHCCCEEEEEeCC
Confidence            679999999999999999888764


No 179
>PRK14030 glutamate dehydrogenase; Provisional
Probab=62.71  E-value=8.8  Score=29.82  Aligned_cols=20  Identities=5%  Similarity=-0.090  Sum_probs=19.5

Q ss_pred             cchHHHHHHHHhhcCCEEEE
Q psy15800         84 TQSDTNHTQRCLASIMQLVY  103 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~  103 (109)
                      |++|+..|+.|..+|++|++
T Consensus       237 GnVG~~aA~~L~e~GakvVa  256 (445)
T PRK14030        237 GNVAWGAATKATELGAKVVT  256 (445)
T ss_pred             CHHHHHHHHHHHHCCCEEEE
Confidence            89999999999999999999


No 180
>PLN02350 phosphogluconate dehydrogenase (decarboxylating)
Probab=62.68  E-value=7.1  Score=30.66  Aligned_cols=26  Identities=4%  Similarity=-0.097  Sum_probs=23.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|..|+.+|+.+..-|.+|.+|||++
T Consensus        14 LG~MG~~mA~nL~~~G~~V~V~NRt~   39 (493)
T PLN02350         14 LAVMGQNLALNIAEKGFPISVYNRTT   39 (493)
T ss_pred             eHHHHHHHHHHHHhCCCeEEEECCCH
Confidence            48899999999999999999999974


No 181
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=62.68  E-value=11  Score=26.77  Aligned_cols=24  Identities=8%  Similarity=0.170  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+.+..-|++|+..+|.
T Consensus        17 ~GIG~aiA~~la~~G~~Vil~~r~   40 (274)
T PRK08415         17 KSIAYGIAKACFEQGAELAFTYLN   40 (274)
T ss_pred             CCHHHHHHHHHHHCCCEEEEEecC
Confidence            369999999999999999988764


No 182
>PRK06198 short chain dehydrogenase; Provisional
Probab=62.66  E-value=7.7  Score=26.69  Aligned_cols=25  Identities=8%  Similarity=-0.124  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+ |+.++|.
T Consensus        15 ~g~iG~~la~~l~~~G~~~V~~~~r~   40 (260)
T PRK06198         15 TQGLGAAIARAFAERGAAGLVICGRN   40 (260)
T ss_pred             CchHHHHHHHHHHHCCCCeEEEEcCC
Confidence            478999999999999999 9888875


No 183
>PRK05872 short chain dehydrogenase; Provisional
Probab=62.61  E-value=7.4  Score=27.74  Aligned_cols=25  Identities=12%  Similarity=-0.041  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+..-|++|+..+|.
T Consensus        18 s~gIG~~ia~~l~~~G~~V~~~~r~   42 (296)
T PRK05872         18 ARGIGAELARRLHARGAKLALVDLE   42 (296)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            3679999999999999999988874


No 184
>PRK08628 short chain dehydrogenase; Provisional
Probab=62.42  E-value=9.3  Score=26.28  Aligned_cols=25  Identities=8%  Similarity=-0.217  Sum_probs=21.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+|+.+...|.+|+..+|.
T Consensus        16 sggiG~~la~~l~~~G~~v~~~~r~   40 (258)
T PRK08628         16 ASGIGAAISLRLAEEGAIPVIFGRS   40 (258)
T ss_pred             CChHHHHHHHHHHHcCCcEEEEcCC
Confidence            3689999999999999999888764


No 185
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=61.74  E-value=6.5  Score=28.03  Aligned_cols=26  Identities=12%  Similarity=0.101  Sum_probs=23.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+...|.+|+.+|+..
T Consensus        11 ~G~mG~~ia~~la~~g~~V~~~d~~~   36 (282)
T PRK05808         11 AGTMGNGIAQVCAVAGYDVVMVDISD   36 (282)
T ss_pred             cCHHHHHHHHHHHHCCCceEEEeCCH
Confidence            48899999999999999999999753


No 186
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=61.73  E-value=9.3  Score=26.53  Aligned_cols=24  Identities=4%  Similarity=-0.057  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+...|.+|+..++.
T Consensus        20 ~~iG~~ia~~l~~~G~~vv~~~~~   43 (265)
T PRK07097         20 YGIGFAIAKAYAKAGATIVFNDIN   43 (265)
T ss_pred             chHHHHHHHHHHHCCCeEEEEeCC
Confidence            689999999999999999988765


No 187
>PRK07060 short chain dehydrogenase; Provisional
Probab=61.61  E-value=8.4  Score=26.14  Aligned_cols=24  Identities=4%  Similarity=-0.139  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+++.+...|.+|+..+|.
T Consensus        19 g~iG~~~a~~l~~~g~~V~~~~r~   42 (245)
T PRK07060         19 SGIGRACAVALAQRGARVVAAARN   42 (245)
T ss_pred             chHHHHHHHHHHHCCCEEEEEeCC
Confidence            689999999999999999999875


No 188
>PRK06139 short chain dehydrogenase; Provisional
Probab=61.59  E-value=7.6  Score=28.50  Aligned_cols=25  Identities=8%  Similarity=-0.055  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+..-|++|+..+|.
T Consensus        16 s~GIG~aia~~la~~G~~Vvl~~R~   40 (330)
T PRK06139         16 SSGIGQATAEAFARRGARLVLAARD   40 (330)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEECC
Confidence            3679999999999999999998875


No 189
>PLN02662 cinnamyl-alcohol dehydrogenase family protein
Probab=61.55  E-value=9.6  Score=27.14  Aligned_cols=27  Identities=4%  Similarity=-0.263  Sum_probs=22.8

Q ss_pred             hhccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         81 ELITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        81 ~l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .-.|-||+.+++.|..-|.+|.+.+|.
T Consensus        11 GatGfIG~~l~~~L~~~g~~V~~~~r~   37 (322)
T PLN02662         11 GASGYIASWLVKLLLQRGYTVKATVRD   37 (322)
T ss_pred             CChHHHHHHHHHHHHHCCCEEEEEEcC
Confidence            345889999999999999999887654


No 190
>PLN02858 fructose-bisphosphate aldolase
Probab=61.47  E-value=6.4  Score=34.70  Aligned_cols=25  Identities=12%  Similarity=0.049  Sum_probs=23.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.+|..+|+.|...|.+|.+|||++
T Consensus       333 G~MG~~mA~~L~~~G~~V~v~dr~~  357 (1378)
T PLN02858        333 GAMGFGMASHLLKSNFSVCGYDVYK  357 (1378)
T ss_pred             hHHHHHHHHHHHHCCCEEEEEeCCH
Confidence            7899999999999999999999874


No 191
>PRK12742 oxidoreductase; Provisional
Probab=61.42  E-value=11  Score=25.52  Aligned_cols=24  Identities=4%  Similarity=0.033  Sum_probs=20.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+++++.+...|++|+...+
T Consensus        15 sggIG~~~a~~l~~~G~~v~~~~~   38 (237)
T PRK12742         15 SRGIGAAIVRRFVTDGANVRFTYA   38 (237)
T ss_pred             CChHHHHHHHHHHHCCCEEEEecC
Confidence            478999999999999999887643


No 192
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=61.40  E-value=11  Score=25.22  Aligned_cols=24  Identities=4%  Similarity=-0.198  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.+...|.+|..++|.
T Consensus        38 G~iG~~~a~~l~~~g~~V~l~~R~   61 (194)
T cd01078          38 GPVGQRAAVLLAREGARVVLVGRD   61 (194)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEcCC
Confidence            789999999999999999998875


No 193
>PRK08303 short chain dehydrogenase; Provisional
Probab=60.92  E-value=11  Score=27.29  Aligned_cols=24  Identities=4%  Similarity=-0.194  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+.+...|++|+..+|.
T Consensus        18 ~GIG~aia~~la~~G~~Vv~~~r~   41 (305)
T PRK08303         18 RGAGRGIAVELGAAGATVYVTGRS   41 (305)
T ss_pred             chHHHHHHHHHHHCCCEEEEEecc
Confidence            569999999999999999988875


No 194
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=60.81  E-value=11  Score=26.59  Aligned_cols=23  Identities=9%  Similarity=-0.067  Sum_probs=20.7

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||+++|+.|..-|.+|+..+|.
T Consensus        20 GIG~aiA~~la~~Ga~V~~~~r~   42 (271)
T PRK06505         20 SIAWGIAKQLAAQGAELAFTYQG   42 (271)
T ss_pred             cHHHHHHHHHHhCCCEEEEecCc
Confidence            69999999999999999988763


No 195
>PRK06720 hypothetical protein; Provisional
Probab=60.80  E-value=10  Score=25.16  Aligned_cols=24  Identities=4%  Similarity=-0.114  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++++.+..-|.+|+.+++.
T Consensus        26 ~GIG~aia~~l~~~G~~V~l~~r~   49 (169)
T PRK06720         26 IGIGRNTALLLAKQGAKVIVTDID   49 (169)
T ss_pred             ChHHHHHHHHHHHCCCEEEEEECC
Confidence            469999999999999999988864


No 196
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=60.77  E-value=12  Score=25.36  Aligned_cols=25  Identities=8%  Similarity=-0.060  Sum_probs=22.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..+|.
T Consensus        15 sg~iG~~l~~~l~~~g~~V~~~~r~   39 (251)
T PRK12826         15 ARGIGRAIAVRLAADGAEVIVVDIC   39 (251)
T ss_pred             CCcHHHHHHHHHHHCCCEEEEEeCC
Confidence            4789999999999999999998875


No 197
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=60.71  E-value=12  Score=26.11  Aligned_cols=23  Identities=9%  Similarity=0.014  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      +.||+++|+.+..-|.+|+..+|
T Consensus        19 ~GIG~aia~~la~~G~~v~~~~r   41 (257)
T PRK08594         19 RSIAWGIARSLHNAGAKLVFTYA   41 (257)
T ss_pred             CCHHHHHHHHHHHCCCEEEEecC
Confidence            46999999999999999998765


No 198
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional
Probab=60.70  E-value=9.9  Score=28.56  Aligned_cols=25  Identities=12%  Similarity=-0.230  Sum_probs=22.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|..+|+.++.-|.+|.+||+.
T Consensus       107 ~GlmG~slA~~l~~~G~~V~~~d~~  131 (374)
T PRK11199        107 KGQLGRLFAKMLTLSGYQVRILEQD  131 (374)
T ss_pred             CChhhHHHHHHHHHCCCeEEEeCCC
Confidence            4889999999999999999999974


No 199
>PRK07502 cyclohexadienyl dehydrogenase; Validated
Probab=60.69  E-value=7.7  Score=28.03  Aligned_cols=26  Identities=8%  Similarity=-0.068  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCC--EEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIM--QLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~--~V~~~~r~~  108 (109)
                      .|.+|..+++.++..|.  +|++|||..
T Consensus        14 ~G~mG~sla~~l~~~g~~~~V~~~dr~~   41 (307)
T PRK07502         14 IGLIGSSLARAIRRLGLAGEIVGADRSA   41 (307)
T ss_pred             eCHHHHHHHHHHHhcCCCcEEEEEECCH
Confidence            48999999999997774  899999863


No 200
>PLN02695 GDP-D-mannose-3',5'-epimerase
Probab=60.39  E-value=11  Score=27.98  Aligned_cols=25  Identities=12%  Similarity=-0.113  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|-||+.+++.|...|.+|++.+|.
T Consensus        30 tGfIG~~l~~~L~~~G~~V~~v~r~   54 (370)
T PLN02695         30 GGFIASHIARRLKAEGHYIIASDWK   54 (370)
T ss_pred             ccHHHHHHHHHHHhCCCEEEEEEec
Confidence            3789999999999999999999864


No 201
>PRK09242 tropinone reductase; Provisional
Probab=60.17  E-value=11  Score=25.96  Aligned_cols=25  Identities=4%  Similarity=-0.142  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++++...|.+|+..+|.
T Consensus        18 ~~gIG~~~a~~l~~~G~~v~~~~r~   42 (257)
T PRK09242         18 SKGIGLAIAREFLGLGADVLIVARD   42 (257)
T ss_pred             CchHHHHHHHHHHHcCCEEEEEeCC
Confidence            3689999999999999999988764


No 202
>PRK07791 short chain dehydrogenase; Provisional
Probab=59.97  E-value=12  Score=26.59  Aligned_cols=25  Identities=12%  Similarity=-0.098  Sum_probs=21.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .+.||+++|+.+...|++|+..++.
T Consensus        15 s~GIG~aia~~la~~G~~vii~~~~   39 (286)
T PRK07791         15 GGGIGRAHALAFAAEGARVVVNDIG   39 (286)
T ss_pred             CchHHHHHHHHHHHCCCEEEEeeCC
Confidence            3579999999999999999988754


No 203
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic. This model represents a bifunctional enzyme that catalyzes the second and third steps (cysteine ligation, EC 6.3.2.5, and decarboxylation, EC 4.1.1.36) in the biosynthesis of coenzyme A (CoA) from pantothenate in bacteria. In early descriptions of this flavoprotein, a ts mutation in one region of the protein appeared to cause a defect in DNA metaobolism rather than an increased need for the pantothenate precursor beta-alanine. This protein was then called dfp, for DNA/pantothenate metabolism flavoprotein. The authors responsible for detecting phosphopantothenate--cysteine ligase activity suggest renaming this bifunctional protein coaBC for its role in CoA biosynthesis. This enzyme contains the FMN cofactor, but no FAD or pyruvoyl group. The amino-terminal region contains the phosphopantothenoylcysteine decarboxylase activity.
Probab=59.96  E-value=12  Score=28.50  Aligned_cols=23  Identities=4%  Similarity=-0.093  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|.++|+.+...|.+|+++++
T Consensus       211 G~~g~~~a~~~~~~Ga~V~~~~g  233 (390)
T TIGR00521       211 GKMGLALAEAAYKRGADVTLITG  233 (390)
T ss_pred             chHHHHHHHHHHHCCCEEEEeCC
Confidence            88999999999999999998764


No 204
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=59.61  E-value=12  Score=25.35  Aligned_cols=25  Identities=4%  Similarity=-0.056  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+|+.+..-|.+|+..+|.
T Consensus        11 s~~iG~~la~~l~~~g~~vi~~~r~   35 (245)
T PRK12824         11 KRGIGSAIARELLNDGYRVIATYFS   35 (245)
T ss_pred             CchHHHHHHHHHHHcCCEEEEEeCC
Confidence            5789999999999889999998765


No 205
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=59.54  E-value=12  Score=25.72  Aligned_cols=26  Identities=0%  Similarity=-0.142  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+.+++.|...|.+|+..+|..
T Consensus        16 sg~iG~~la~~l~~~G~~v~~~~r~~   41 (262)
T PRK13394         16 ASGIGKEIALELARAGAAVAIADLNQ   41 (262)
T ss_pred             CChHHHHHHHHHHHCCCeEEEEeCCh
Confidence            47899999999999999999887753


No 206
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=59.46  E-value=8.6  Score=27.54  Aligned_cols=26  Identities=0%  Similarity=-0.172  Sum_probs=22.8

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+..-|.+|..||+..
T Consensus        11 aG~mG~~iA~~la~~G~~V~l~d~~~   36 (287)
T PRK08293         11 AGVLGSQIAFQTAFHGFDVTIYDISD   36 (287)
T ss_pred             CCHHHHHHHHHHHhcCCeEEEEeCCH
Confidence            47899999999998899999999863


No 207
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=59.45  E-value=12  Score=25.74  Aligned_cols=24  Identities=8%  Similarity=0.074  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||..+++.+...|.+|+..+|.
T Consensus        17 ~giG~~la~~l~~~G~~vi~~~r~   40 (256)
T PRK12748         17 NGIGAAVCRRLAAKGIDIFFTYWS   40 (256)
T ss_pred             CCHHHHHHHHHHHcCCcEEEEcCC
Confidence            469999999999999999998764


No 208
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=59.36  E-value=12  Score=25.49  Aligned_cols=23  Identities=4%  Similarity=-0.119  Sum_probs=20.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|.||+++++.+...|.+|+..+
T Consensus        14 s~gIG~~la~~l~~~G~~vv~~~   36 (253)
T PRK08642         14 SRGLGAAIARAFAREGARVVVNY   36 (253)
T ss_pred             CCcHHHHHHHHHHHCCCeEEEEc
Confidence            47899999999999999998654


No 209
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=59.28  E-value=9.5  Score=29.14  Aligned_cols=24  Identities=8%  Similarity=-0.132  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+...|.+|+..+|.
T Consensus       188 gGIG~aLA~~La~~G~~Vi~l~r~  211 (406)
T PRK07424        188 GTLGQALLKELHQQGAKVVALTSN  211 (406)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCC
Confidence            569999999999999999988865


No 210
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional
Probab=59.21  E-value=13  Score=25.93  Aligned_cols=23  Identities=9%  Similarity=0.154  Sum_probs=20.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      +.||+++|+.+...|++|+..++
T Consensus        18 ~GIG~a~a~~l~~~G~~v~~~~~   40 (261)
T PRK08690         18 RSIAYGIAKACREQGAELAFTYV   40 (261)
T ss_pred             CcHHHHHHHHHHHCCCEEEEEcC
Confidence            46999999999999999987644


No 211
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=58.84  E-value=11  Score=29.13  Aligned_cols=25  Identities=12%  Similarity=0.120  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|..|..+|+.|+..|.+|.++|..
T Consensus        15 ~G~sG~s~a~~L~~~G~~v~~~D~~   39 (498)
T PRK02006         15 LGESGLAMARWCARHGARLRVADTR   39 (498)
T ss_pred             ecHhHHHHHHHHHHCCCEEEEEcCC
Confidence            3789999999999999999999953


No 212
>PRK07109 short chain dehydrogenase; Provisional
Probab=58.82  E-value=9  Score=28.02  Aligned_cols=25  Identities=4%  Similarity=-0.149  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|.+|+..+|.
T Consensus        17 s~gIG~~la~~la~~G~~Vvl~~R~   41 (334)
T PRK07109         17 SAGVGRATARAFARRGAKVVLLARG   41 (334)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEECC
Confidence            3679999999999999999998875


No 213
>TIGR01035 hemA glutamyl-tRNA reductase. This enzyme, together with glutamate-1-semialdehyde-2,1-aminomutase (TIGR00713), leads to the production of delta-amino-levulinic acid from Glu-tRNA.
Probab=58.53  E-value=8.5  Score=29.34  Aligned_cols=25  Identities=4%  Similarity=-0.098  Sum_probs=22.4

Q ss_pred             cchHHHHHHHHhhcC-CEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASI-MQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg-~~V~~~~r~~  108 (109)
                      |.+|+.+++.+...| .+|+.++|..
T Consensus       189 G~iG~~~a~~L~~~G~~~V~v~~rs~  214 (417)
T TIGR01035       189 GEMGELVAKHLLRKGVGKILIANRTY  214 (417)
T ss_pred             hHHHHHHHHHHHHCCCCEEEEEeCCH
Confidence            789999999999999 6899999863


No 214
>KOG1207|consensus
Probab=58.44  E-value=11  Score=26.09  Aligned_cols=24  Identities=4%  Similarity=-0.144  Sum_probs=22.1

Q ss_pred             chHHHHHHHHhhcCCEEEEEcccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .||+++...|..-|.+|+++.|..
T Consensus        18 GIG~~~v~~La~aGA~ViAvaR~~   41 (245)
T KOG1207|consen   18 GIGKEIVLSLAKAGAQVIAVARNE   41 (245)
T ss_pred             cccHHHHHHHHhcCCEEEEEecCH
Confidence            599999999999999999998864


No 215
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=58.39  E-value=14  Score=26.08  Aligned_cols=23  Identities=13%  Similarity=0.144  Sum_probs=20.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      +.||+++|+.+...|++|+...|
T Consensus        22 ~GIG~aia~~la~~G~~V~l~~r   44 (272)
T PRK08159         22 RSIAWGIAKACRAAGAELAFTYQ   44 (272)
T ss_pred             CcHHHHHHHHHHHCCCEEEEEcC
Confidence            35999999999999999987654


No 216
>PRK05854 short chain dehydrogenase; Provisional
Probab=58.37  E-value=10  Score=27.40  Aligned_cols=24  Identities=8%  Similarity=0.003  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+.|..-|++|+..+|.
T Consensus        24 ~GIG~~~a~~La~~G~~Vil~~R~   47 (313)
T PRK05854         24 DGLGLGLARRLAAAGAEVILPVRN   47 (313)
T ss_pred             ChHHHHHHHHHHHCCCEEEEEeCC
Confidence            579999999999999999988775


No 217
>KOG1370|consensus
Probab=58.28  E-value=9.4  Score=28.68  Aligned_cols=21  Identities=5%  Similarity=-0.053  Sum_probs=19.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEE
Q psy15800         84 TQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~  104 (109)
                      |.+|+..|+.|++||++|+..
T Consensus       223 GdVGKgCaqaLkg~g~~VivT  243 (434)
T KOG1370|consen  223 GDVGKGCAQALKGFGARVIVT  243 (434)
T ss_pred             CccchhHHHHHhhcCcEEEEe
Confidence            689999999999999999875


No 218
>PRK12747 short chain dehydrogenase; Provisional
Probab=58.19  E-value=13  Score=25.52  Aligned_cols=23  Identities=4%  Similarity=-0.153  Sum_probs=20.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|.||+++++.+..-|++|+..+
T Consensus        13 s~gIG~~ia~~l~~~G~~v~~~~   35 (252)
T PRK12747         13 SRGIGRAIAKRLANDGALVAIHY   35 (252)
T ss_pred             CChHHHHHHHHHHHCCCeEEEEc
Confidence            47899999999999999998764


No 219
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional
Probab=58.07  E-value=12  Score=28.72  Aligned_cols=24  Identities=8%  Similarity=-0.175  Sum_probs=22.1

Q ss_pred             cchHHH-HHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTN-HTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~-va~~~~~fg~~V~~~~r~  107 (109)
                      |..|.. +|+.|+..|.+|.++|..
T Consensus        16 G~sG~s~~a~~L~~~G~~V~~~D~~   40 (461)
T PRK00421         16 GGIGMSGLAEVLLNLGYKVSGSDLK   40 (461)
T ss_pred             chhhHHHHHHHHHhCCCeEEEECCC
Confidence            789999 799999999999999964


No 220
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=57.95  E-value=13  Score=25.69  Aligned_cols=24  Identities=13%  Similarity=-0.076  Sum_probs=20.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+++++.+...|++|+...|
T Consensus        16 ~~gIG~~ia~~l~~~G~~vvi~~~   39 (261)
T PRK08936         16 STGLGRAMAVRFGKEKAKVVINYR   39 (261)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeC
Confidence            368999999999999999887655


No 221
>PRK06484 short chain dehydrogenase; Validated
Probab=57.91  E-value=10  Score=29.14  Aligned_cols=24  Identities=17%  Similarity=-0.038  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+.+...|++|+..+|.
T Consensus        15 ~gIG~aia~~l~~~G~~V~~~~r~   38 (520)
T PRK06484         15 GGIGRAACQRFARAGDQVVVADRN   38 (520)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeCC
Confidence            579999999999999999998774


No 222
>PLN02989 cinnamyl-alcohol dehydrogenase family protein
Probab=57.80  E-value=13  Score=26.69  Aligned_cols=25  Identities=4%  Similarity=-0.283  Sum_probs=21.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|-||+.+++.|..-|.+|+..+|.
T Consensus        14 ~G~IG~~l~~~L~~~G~~V~~~~r~   38 (325)
T PLN02989         14 SGYIASWIVKLLLFRGYTINATVRD   38 (325)
T ss_pred             chHHHHHHHHHHHHCCCEEEEEEcC
Confidence            4789999999999999999876543


No 223
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=57.77  E-value=13  Score=25.29  Aligned_cols=25  Identities=0%  Similarity=-0.229  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.+...|.+|+..++.
T Consensus        17 s~~iG~~la~~l~~~G~~v~~~~~~   41 (252)
T PRK08220         17 AQGIGYAVALAFVEAGAKVIGFDQA   41 (252)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEecc
Confidence            3689999999999999999998864


No 224
>PLN02572 UDP-sulfoquinovose synthase
Probab=57.75  E-value=12  Score=28.74  Aligned_cols=23  Identities=0%  Similarity=-0.227  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |-||+.+++.|..-|.+|+++|+
T Consensus        57 GfIGs~Lv~~L~~~G~~V~~~d~   79 (442)
T PLN02572         57 GYCGWATALHLSKRGYEVAIVDN   79 (442)
T ss_pred             cHHHHHHHHHHHHCCCeEEEEec
Confidence            78999999999999999999874


No 225
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=57.64  E-value=13  Score=25.51  Aligned_cols=24  Identities=4%  Similarity=-0.141  Sum_probs=20.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+++|+.+...|.+|+..++
T Consensus        16 s~gIG~~~a~~l~~~G~~v~~~~~   39 (255)
T PRK06463         16 TRGIGRAIAEAFLREGAKVAVLYN   39 (255)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeC
Confidence            368999999999999999987654


No 226
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=57.60  E-value=13  Score=25.79  Aligned_cols=23  Identities=4%  Similarity=-0.041  Sum_probs=20.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      +.||+++|+.+...|++|+...+
T Consensus        18 ~gIG~~ia~~l~~~G~~v~~~~~   40 (260)
T PRK08416         18 RGIGKAIVYEFAQSGVNIAFTYN   40 (260)
T ss_pred             chHHHHHHHHHHHCCCEEEEEcC
Confidence            67999999999999999987643


No 227
>PRK06482 short chain dehydrogenase; Provisional
Probab=57.39  E-value=10  Score=26.42  Aligned_cols=25  Identities=16%  Similarity=-0.002  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|..-|.+|+..+|.
T Consensus        11 sg~IG~~la~~L~~~g~~v~~~~r~   35 (276)
T PRK06482         11 SSGFGRGMTERLLARGDRVAATVRR   35 (276)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEeCC
Confidence            5789999999999999999988764


No 228
>PRK07985 oxidoreductase; Provisional
Probab=57.29  E-value=15  Score=26.16  Aligned_cols=23  Identities=4%  Similarity=-0.153  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.||+++|+.|...|.+|+..++
T Consensus        59 ~gIG~aia~~L~~~G~~Vi~~~~   81 (294)
T PRK07985         59 SGIGRAAAIAYAREGADVAISYL   81 (294)
T ss_pred             CcHHHHHHHHHHHCCCEEEEecC
Confidence            68999999999999999988764


No 229
>PRK14031 glutamate dehydrogenase; Provisional
Probab=57.03  E-value=13  Score=28.89  Aligned_cols=23  Identities=9%  Similarity=-0.038  Sum_probs=20.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |++|...|+.|..+|++|++++.
T Consensus       237 GNVG~~aA~~L~e~GAkVVaVSD  259 (444)
T PRK14031        237 GNVAQYTAEKVLELGGKVVTMSD  259 (444)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEEC
Confidence            79999999999999999998554


No 230
>PRK12827 short chain dehydrogenase; Provisional
Probab=56.63  E-value=15  Score=24.80  Aligned_cols=24  Identities=8%  Similarity=-0.112  Sum_probs=21.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+.+|+.+...|.+|+..++
T Consensus        15 sg~iG~~la~~l~~~g~~v~~~~~   38 (249)
T PRK12827         15 SGGLGRAIAVRLAADGADVIVLDI   38 (249)
T ss_pred             CChHHHHHHHHHHHCCCeEEEEcC
Confidence            478999999999999999988664


No 231
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional
Probab=56.45  E-value=11  Score=28.70  Aligned_cols=26  Identities=4%  Similarity=-0.100  Sum_probs=23.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..|...|.+|++||+..
T Consensus        11 lG~~G~~~A~~La~~G~~V~~~D~~~   36 (415)
T PRK11064         11 LGYIGLPTAAAFASRQKQVIGVDINQ   36 (415)
T ss_pred             cchhhHHHHHHHHhCCCEEEEEeCCH
Confidence            48899999999999999999999864


No 232
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=56.43  E-value=13  Score=28.92  Aligned_cols=24  Identities=0%  Similarity=-0.341  Sum_probs=22.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|...++.|+..|.+|+++|..
T Consensus        21 G~sG~aa~~~L~~~G~~v~~~D~~   44 (488)
T PRK03369         21 GVTGRAVLAALTRFGARPTVCDDD   44 (488)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEcCC
Confidence            899999999999999999999953


No 233
>PRK07453 protochlorophyllide oxidoreductase; Validated
Probab=56.07  E-value=15  Score=26.46  Aligned_cols=25  Identities=0%  Similarity=-0.132  Sum_probs=22.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||.++++.|..-|.+|+..+|.
T Consensus        15 s~gIG~~~a~~L~~~G~~V~~~~r~   39 (322)
T PRK07453         15 SSGVGLYAAKALAKRGWHVIMACRN   39 (322)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEECC
Confidence            4689999999999999999998874


No 234
>PLN00016 RNA-binding protein; Provisional
Probab=55.97  E-value=13  Score=27.47  Aligned_cols=26  Identities=4%  Similarity=-0.201  Sum_probs=22.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.||+.+++.|..-|.+|++.+|..
T Consensus        65 tG~iG~~lv~~L~~~G~~V~~l~R~~   90 (378)
T PLN00016         65 HAFIGFYLAKELVKAGHEVTLFTRGK   90 (378)
T ss_pred             ceeEhHHHHHHHHHCCCEEEEEecCC
Confidence            47899999999999999999998753


No 235
>PRK10669 putative cation:proton antiport protein; Provisional
Probab=55.93  E-value=9.2  Score=30.12  Aligned_cols=25  Identities=16%  Similarity=0.076  Sum_probs=22.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |++|+.+++.++..|.+|+..|+.+
T Consensus       426 G~~G~~la~~L~~~g~~vvvId~d~  450 (558)
T PRK10669        426 GRVGSLLGEKLLAAGIPLVVIETSR  450 (558)
T ss_pred             ChHHHHHHHHHHHCCCCEEEEECCH
Confidence            7999999999999999999998753


No 236
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=55.72  E-value=13  Score=25.11  Aligned_cols=25  Identities=4%  Similarity=-0.153  Sum_probs=21.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE-ccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS-TCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~-~r~  107 (109)
                      .|.||+.+++.+..-|.+|+.. +|.
T Consensus        14 sg~iG~~la~~l~~~g~~v~~~~~r~   39 (247)
T PRK05565         14 SGGIGRAIAELLAKEGAKVVIAYDIN   39 (247)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEcCCC
Confidence            4789999999999899999887 764


No 237
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=55.38  E-value=17  Score=25.18  Aligned_cols=21  Identities=0%  Similarity=-0.021  Sum_probs=19.1

Q ss_pred             chHHHHHHHHhhcCCEEEEEc
Q psy15800         85 QSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .||+++|+.+...|++|+..+
T Consensus        19 giG~~~a~~l~~~G~~vi~~~   39 (256)
T PRK12859         19 GIGAAICKELAEAGADIFFTY   39 (256)
T ss_pred             ChHHHHHHHHHHCCCeEEEEe
Confidence            699999999999999998864


No 238
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]
Probab=55.31  E-value=15  Score=26.63  Aligned_cols=26  Identities=4%  Similarity=-0.045  Sum_probs=23.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .+.||+++|+.+..-|++|+.+.|..
T Consensus        15 SsGIG~~~A~~lA~~g~~liLvaR~~   40 (265)
T COG0300          15 SSGIGAELAKQLARRGYNLILVARRE   40 (265)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCcH
Confidence            36799999999999999999988864


No 239
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=55.24  E-value=16  Score=25.46  Aligned_cols=23  Identities=9%  Similarity=0.147  Sum_probs=19.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      +.||+++|+++...|++|+..++
T Consensus        18 ~GIG~a~a~~l~~~G~~v~~~~~   40 (260)
T PRK06997         18 RSIAYGIAKACKREGAELAFTYV   40 (260)
T ss_pred             CcHHHHHHHHHHHCCCeEEEEcc
Confidence            46999999999999999987643


No 240
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=55.21  E-value=13  Score=28.65  Aligned_cols=24  Identities=8%  Similarity=-0.180  Sum_probs=22.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |..|+++|+.|...|.+|.++|+.
T Consensus        24 G~sG~a~a~~L~~~G~~V~~~D~~   47 (473)
T PRK00141         24 GVSGRGIAAMLSELGCDVVVADDN   47 (473)
T ss_pred             CHHHHHHHHHHHHCCCEEEEECCC
Confidence            789999999999999999999964


No 241
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional
Probab=55.15  E-value=8.1  Score=26.52  Aligned_cols=59  Identities=5%  Similarity=-0.123  Sum_probs=38.4

Q ss_pred             CCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhhccchHHHHHHHH--hhcCCEEEEE-cc
Q psy15800         39 PVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRC--LASIMQLVYS-TC  106 (109)
Q Consensus        39 g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l~G~IG~~va~~~--~~fg~~V~~~-~r  106 (109)
                      +....+.+||.+..++...|++.....     .|    ...---.|.+|+.+++.+  ...|++++++ |+
T Consensus        57 ~~~G~~~~gy~v~~l~~~~~~~l~~~~-----~~----rV~IIGaG~iG~~l~~~~~~~~~g~~ivgv~D~  118 (213)
T PRK05472         57 GEFGKRGVGYNVEELLEFIEKILGLDR-----TW----NVALVGAGNLGRALLNYNGFEKRGFKIVAAFDV  118 (213)
T ss_pred             HhcCCCCCCeeHHHHHHHHHHHhCCCC-----Cc----EEEEECCCHHHHHHHHhhhcccCCcEEEEEEEC
Confidence            345577788999999998888873331     12    111111378999999863  3678998864 54


No 242
>TIGR00507 aroE shikimate 5-dehydrogenase. This model finds proteins from prokaryotes and functionally equivalent domains from larger, multifunctional proteins of fungi and plants. Below the trusted cutoff of 180, but above the noise cutoff of 20, are the putative shikimate dehydrogenases of Thermotoga maritima and Mycobacterium tuberculosis, and uncharacterized paralogs of shikimate dehydrogenase from E. coli and H. influenzae. The related enzyme quinate 5-dehydrogenase scores below the noise cutoff. A neighbor-joining tree, constructed with quinate 5-dehydrogenases as the outgroup, shows the Clamydial homolog as clustering among the shikimate dehydrogenases, although the sequence is unusual in the degree of sequence divergence and the presence of an additional N-terminal domain.
Probab=55.08  E-value=12  Score=26.58  Aligned_cols=25  Identities=4%  Similarity=-0.091  Sum_probs=22.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.+|+.++..+...|.+|..++|..
T Consensus       126 Gg~g~aia~~L~~~g~~v~v~~R~~  150 (270)
T TIGR00507       126 GGAARAVALPLLKADCNVIIANRTV  150 (270)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeCCH
Confidence            6799999999999999999999863


No 243
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=54.94  E-value=16  Score=26.18  Aligned_cols=24  Identities=4%  Similarity=-0.168  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++|+.|..-|.+|+..++.
T Consensus        22 ~gIG~~ia~~L~~~Ga~Vv~~~~~   45 (306)
T PRK07792         22 AGLGRAEALGLARLGATVVVNDVA   45 (306)
T ss_pred             ChHHHHHHHHHHHCCCEEEEecCC
Confidence            579999999999999999988763


No 244
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed
Probab=54.68  E-value=11  Score=29.38  Aligned_cols=24  Identities=4%  Similarity=-0.140  Sum_probs=22.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.++..+...|++|..++|.
T Consensus       341 GgiG~aia~~L~~~G~~V~i~~R~  364 (477)
T PRK09310        341 GGAAKAIATTLARAGAELLIFNRT  364 (477)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeCC
Confidence            679999999999999999999875


No 245
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catal
Probab=54.54  E-value=14  Score=26.61  Aligned_cols=25  Identities=12%  Similarity=-0.181  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|+.+++.++++|.+|++.++.
T Consensus       172 ~g~iG~~~~~~a~~~G~~vi~~~~~  196 (333)
T cd08296         172 IGGLGHLAVQYAAKMGFRTVAISRG  196 (333)
T ss_pred             CcHHHHHHHHHHHHCCCeEEEEeCC
Confidence            4889999999999999999988764


No 246
>PLN02583 cinnamoyl-CoA reductase
Probab=54.41  E-value=16  Score=26.11  Aligned_cols=24  Identities=8%  Similarity=-0.164  Sum_probs=21.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+.+++.|..-|.+|.+.+|
T Consensus        15 tG~IG~~lv~~Ll~~G~~V~~~~R   38 (297)
T PLN02583         15 SGYVGFWLVKRLLSRGYTVHAAVQ   38 (297)
T ss_pred             CCHHHHHHHHHHHhCCCEEEEEEc
Confidence            478999999999999999998776


No 247
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=54.37  E-value=14  Score=28.20  Aligned_cols=24  Identities=8%  Similarity=-0.078  Sum_probs=22.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..+|+.|+..|.+|.++|..
T Consensus        18 G~~G~~~a~~l~~~G~~v~~~D~~   41 (460)
T PRK01390         18 GGSGLATARALVAGGAEVIAWDDN   41 (460)
T ss_pred             cHhHHHHHHHHHHCCCEEEEECCC
Confidence            789999999999999999999964


No 248
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases. Yhdh putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catal
Probab=54.29  E-value=14  Score=26.18  Aligned_cols=23  Identities=13%  Similarity=-0.136  Sum_probs=20.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++++|++|++.+.
T Consensus       157 g~vg~~~~~~A~~~G~~vi~~~~  179 (324)
T cd08288         157 GGVGSVAVALLARLGYEVVASTG  179 (324)
T ss_pred             cHHHHHHHHHHHHCCCeEEEEeC
Confidence            78999999999999999988754


No 249
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional
Probab=54.26  E-value=13  Score=29.35  Aligned_cols=25  Identities=0%  Similarity=-0.348  Sum_probs=22.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.+|...+..++.+|++|+++|+..
T Consensus       174 G~iGL~Ai~~Ak~lGA~V~a~D~~~  198 (509)
T PRK09424        174 GVAGLAAIGAAGSLGAIVRAFDTRP  198 (509)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeCCH
Confidence            6899999999999999999999763


No 250
>PLN02477 glutamate dehydrogenase
Probab=53.95  E-value=15  Score=28.19  Aligned_cols=22  Identities=9%  Similarity=-0.126  Sum_probs=20.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~  104 (109)
                      +|++|+.+|+.|...|++|+++
T Consensus       214 fGnVG~~~A~~L~e~GakVVaV  235 (410)
T PLN02477        214 FGNVGSWAAQLIHEKGGKIVAV  235 (410)
T ss_pred             CCHHHHHHHHHHHHcCCEEEEE
Confidence            4899999999999999999965


No 251
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=53.89  E-value=17  Score=25.33  Aligned_cols=23  Identities=9%  Similarity=-0.140  Sum_probs=20.0

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||+++|+.+...|++|+..+|.
T Consensus        21 GIG~a~a~~la~~G~~v~~~~r~   43 (260)
T PRK06603         21 SISWAIAQLAKKHGAELWFTYQS   43 (260)
T ss_pred             chHHHHHHHHHHcCCEEEEEeCc
Confidence            49999999999999999887653


No 252
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed
Probab=53.86  E-value=11  Score=28.76  Aligned_cols=25  Identities=0%  Similarity=-0.142  Sum_probs=22.3

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~~  108 (109)
                      |.+|+.+++.+...|+ +|+.++|..
T Consensus       191 G~iG~~~a~~L~~~G~~~V~v~~r~~  216 (423)
T PRK00045        191 GEMGELVAKHLAEKGVRKITVANRTL  216 (423)
T ss_pred             hHHHHHHHHHHHHCCCCeEEEEeCCH
Confidence            7899999999999998 799999863


No 253
>PF11798 IMS_HHH:  IMS family HHH motif;  InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases []. This type of polymerases are thought to be involved in UV protection and mutation [, ]. ; PDB: 3PZP_B 2OH2_B 2W7O_B 3IN5_B 1T94_A 2W7P_B 2W8K_A 2AGQ_A 1RYR_A 3RAX_A ....
Probab=53.84  E-value=9.9  Score=18.18  Aligned_cols=14  Identities=0%  Similarity=-0.206  Sum_probs=11.5

Q ss_pred             chHHHHHHHHhhcC
Q psy15800         85 QSDTNHTQRCLASI   98 (109)
Q Consensus        85 ~IG~~va~~~~~fg   98 (109)
                      .||+.++++|+.+|
T Consensus        18 GIG~kt~~kL~~~G   31 (32)
T PF11798_consen   18 GIGKKTAKKLNKLG   31 (32)
T ss_dssp             TS-HHHHHHHHCTT
T ss_pred             CccHHHHHHHHHcc
Confidence            58999999999887


No 254
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional
Probab=53.62  E-value=18  Score=25.40  Aligned_cols=23  Identities=9%  Similarity=-0.064  Sum_probs=20.4

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||+++|+.+..-|.+|+..+|.
T Consensus        19 GIG~aia~~la~~G~~vil~~r~   41 (262)
T PRK07984         19 SIAYGIAQAMHREGAELAFTYQN   41 (262)
T ss_pred             cHHHHHHHHHHHCCCEEEEEecc
Confidence            69999999999999999887653


No 255
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=53.49  E-value=20  Score=24.94  Aligned_cols=22  Identities=14%  Similarity=-0.094  Sum_probs=19.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      +.||+++|+.+...|++|+...
T Consensus        18 ~GIG~aia~~la~~G~~v~~~~   39 (258)
T PRK07370         18 RSIAWGIAQQLHAAGAELGITY   39 (258)
T ss_pred             CchHHHHHHHHHHCCCEEEEEe
Confidence            4699999999999999987653


No 256
>PRK07775 short chain dehydrogenase; Provisional
Probab=53.48  E-value=18  Score=25.39  Aligned_cols=25  Identities=4%  Similarity=-0.094  Sum_probs=21.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|..-|++|+..+|.
T Consensus        19 ~g~iG~~la~~L~~~G~~V~~~~r~   43 (274)
T PRK07775         19 SSGIGAATAIELAAAGFPVALGARR   43 (274)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            3689999999999999999887753


No 257
>PRK08263 short chain dehydrogenase; Provisional
Probab=53.38  E-value=14  Score=25.86  Aligned_cols=26  Identities=12%  Similarity=-0.077  Sum_probs=22.5

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -.|.||+.+++.+..-|.+|+..+|.
T Consensus        11 asg~iG~~~a~~l~~~g~~V~~~~r~   36 (275)
T PRK08263         11 ASRGFGRAWTEAALERGDRVVATARD   36 (275)
T ss_pred             CCChHHHHHHHHHHHCCCEEEEEECC
Confidence            35789999999999899999988775


No 258
>PLN02650 dihydroflavonol-4-reductase
Probab=53.10  E-value=16  Score=26.66  Aligned_cols=27  Identities=7%  Similarity=-0.216  Sum_probs=22.5

Q ss_pred             hhccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         81 ELITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        81 ~l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .-.|-||+.+++.|..-|.+|++.+|.
T Consensus        12 GatGfIGs~l~~~L~~~G~~V~~~~r~   38 (351)
T PLN02650         12 GASGFIGSWLVMRLLERGYTVRATVRD   38 (351)
T ss_pred             CCcHHHHHHHHHHHHHCCCEEEEEEcC
Confidence            335789999999999999999887654


No 259
>PRK06701 short chain dehydrogenase; Provisional
Probab=53.02  E-value=18  Score=25.74  Aligned_cols=24  Identities=0%  Similarity=-0.251  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||..+++.+...|.+|+.+++.
T Consensus        56 ggIG~~la~~l~~~G~~V~l~~r~   79 (290)
T PRK06701         56 SGIGRAVAVLFAKEGADIAIVYLD   79 (290)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeCC
Confidence            679999999999999999988764


No 260
>PRK05855 short chain dehydrogenase; Validated
Probab=52.95  E-value=16  Score=28.16  Aligned_cols=24  Identities=8%  Similarity=-0.094  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.|..-|++|+..+|.
T Consensus       325 ~giG~~~a~~l~~~G~~v~~~~r~  348 (582)
T PRK05855        325 SGIGRETALAFAREGAEVVASDID  348 (582)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCC
Confidence            679999999999999999998875


No 261
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. This group includes proteins identified as the Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase.  The Arabidopsis enzyme, a member of the medium chain dehydrogenase/reductase family, catalyzes the reduction of 7-8-double bond of phenylpropanal substrates as a plant defense mechanism.  Prostaglandins and related eicosanoids (lipid mediators involved in host defense and inflamation) are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. Leukotriene B4 (LTB4) can be metabolized by LTB4 20-hydroxylase in
Probab=52.89  E-value=13  Score=26.82  Aligned_cols=24  Identities=13%  Similarity=-0.240  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+..++.++.+|++|++.++.
T Consensus       162 G~vG~~aiqlAk~~G~~Vi~~~~~  185 (338)
T cd08295         162 GAVGQLVGQLAKLKGCYVVGSAGS  185 (338)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeCC
Confidence            789999999999999999887653


No 262
>PLN02166 dTDP-glucose 4,6-dehydratase
Probab=52.55  E-value=16  Score=27.99  Aligned_cols=24  Identities=0%  Similarity=0.015  Sum_probs=21.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |-||+.+++.|..-|.+|+++|+.
T Consensus       130 GFIGs~Lv~~Ll~~G~~V~~ldr~  153 (436)
T PLN02166        130 GFVGSHLVDKLIGRGDEVIVIDNF  153 (436)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeCC
Confidence            789999999999999999999863


No 263
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=52.25  E-value=18  Score=27.57  Aligned_cols=24  Identities=0%  Similarity=-0.208  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..+|+.|...|.+|.++|..
T Consensus        14 g~~G~~~a~~l~~~g~~v~~~d~~   37 (445)
T PRK04308         14 GGTGISMIAYLRKNGAEVAAYDAE   37 (445)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCC
Confidence            689999999999999999999864


No 264
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=52.18  E-value=13  Score=28.12  Aligned_cols=25  Identities=0%  Similarity=-0.318  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |++|+.+++.|...|.+|+.+|+.+
T Consensus       240 G~~g~~l~~~L~~~~~~v~vid~~~  264 (453)
T PRK09496        240 GNIGYYLAKLLEKEGYSVKLIERDP  264 (453)
T ss_pred             CHHHHHHHHHHHhCCCeEEEEECCH
Confidence            7899999999999999999997653


No 265
>PRK06719 precorrin-2 dehydrogenase; Validated
Probab=52.14  E-value=19  Score=23.66  Aligned_cols=24  Identities=0%  Similarity=-0.242  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |++|...++.|...|.+|..++|.
T Consensus        22 G~va~rka~~Ll~~ga~V~VIsp~   45 (157)
T PRK06719         22 GKIAYRKASGLKDTGAFVTVVSPE   45 (157)
T ss_pred             CHHHHHHHHHHHhCCCEEEEEcCc
Confidence            789999999999999999988764


No 266
>PF00208 ELFV_dehydrog:  Glutamate/Leucine/Phenylalanine/Valine dehydrogenase;  InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related. They contain a Gly-rich region containing a conserved Lys residue, which has been implicated in the catalytic activity, in each case a reversible oxidative deamination reaction. Glutamate dehydrogenases (1.4.1.2 from EC, 1.4.1.3 from EC, and 1.4.1.4 from EC) (GluDH) are enzymes that catalyse the NAD- and/or NADP-dependent reversible deamination of L-glutamate into alpha-ketoglutarate [, ]. GluDH isozymes are generally involved with either ammonia assimilation or glutamate catabolism. Two separate enzymes are present in yeasts: the NADP-dependent enzyme, which catalyses the amination of alpha-ketoglutarate to L-glutamate; and the NAD-dependent enzyme, which catalyses the reverse reaction [] - this form links the L-amino acids with the Krebs cycle, which provides a major pathway for metabolic interconversion of alpha-amino acids and alpha- keto acids []. Leucine dehydrogenase (1.4.1.9 from EC) (LeuDH) is a NAD-dependent enzyme that catalyses the reversible deamination of leucine and several other aliphatic amino acids to their keto analogues []. Each subunit of this octameric enzyme from Bacillus sphaericus contains 364 amino acids and folds into two domains, separated by a deep cleft. The nicotinamide ring of the NAD+ cofactor binds deep in this cleft, which is thought to close during the hydride transfer step of the catalytic cycle. Phenylalanine dehydrogenase (1.4.1.20 from EC) (PheDH) is na NAD-dependent enzyme that catalyses the reversible deamidation of L-phenylalanine into phenyl-pyruvate []. Valine dehydrogenase (1.4.1.8 from EC) (ValDH) is an NADP-dependent enzyme that catalyses the reversible deamidation of L-valine into 3-methyl-2-oxobutanoate []. This entry represents the C-terminal domain of these proteins.; GO: 0016491 oxidoreductase activity, 0006520 cellular amino acid metabolic process, 0055114 oxidation-reduction process; PDB: 1LEH_A 3AOG_D 3AOE_A 2YFQ_B 2YFH_B 1HRD_A 1K89_A 1AUP_A 1BGV_A 1B26_C ....
Probab=51.75  E-value=15  Score=26.01  Aligned_cols=22  Identities=5%  Similarity=-0.088  Sum_probs=20.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~  104 (109)
                      .|++|+.+|+.|...|++|++.
T Consensus        40 fG~VG~~~a~~l~~~Ga~vv~v   61 (244)
T PF00208_consen   40 FGNVGSHAARFLAELGAKVVAV   61 (244)
T ss_dssp             SSHHHHHHHHHHHHTTEEEEEE
T ss_pred             CCHHHHHHHHHHHHcCCEEEEE
Confidence            3899999999999999999887


No 267
>PRK12743 oxidoreductase; Provisional
Probab=51.54  E-value=20  Score=24.72  Aligned_cols=23  Identities=0%  Similarity=-0.252  Sum_probs=19.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|.||+++++.+...|.+|+...
T Consensus        11 s~giG~~~a~~l~~~G~~V~~~~   33 (256)
T PRK12743         11 DSGIGKACALLLAQQGFDIGITW   33 (256)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEe
Confidence            46799999999999999998764


No 268
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an 
Probab=51.25  E-value=16  Score=26.09  Aligned_cols=24  Identities=17%  Similarity=-0.173  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++.+|.+|+..++.
T Consensus       172 g~iG~~~~~~a~~~G~~v~~~~~~  195 (330)
T cd08245         172 GGLGHLAVQYARAMGFETVAITRS  195 (330)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCC
Confidence            569999999999999999988764


No 269
>PRK14982 acyl-ACP reductase; Provisional
Probab=51.12  E-value=31  Score=25.86  Aligned_cols=24  Identities=4%  Similarity=-0.100  Sum_probs=20.1

Q ss_pred             cchHHHHHHHHh-hcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCL-ASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~-~fg~-~V~~~~r~  107 (109)
                      |.||+.+++.+. ..|. +++.++|.
T Consensus       165 G~IGs~lar~L~~~~gv~~lilv~R~  190 (340)
T PRK14982        165 GDIGSAVCRWLDAKTGVAELLLVARQ  190 (340)
T ss_pred             hHHHHHHHHHHHhhCCCCEEEEEcCC
Confidence            799999999996 4674 88888875


No 270
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=51.05  E-value=18  Score=27.13  Aligned_cols=25  Identities=12%  Similarity=-0.136  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |-.|.-..+.++++|++|+++|+..
T Consensus       176 GGlGh~avQ~Aka~ga~Via~~~~~  200 (339)
T COG1064         176 GGLGHMAVQYAKAMGAEVIAITRSE  200 (339)
T ss_pred             cHHHHHHHHHHHHcCCeEEEEeCCh
Confidence            6788889999999999999999864


No 271
>PF00861 Ribosomal_L18p:  Ribosomal L18p/L5e family;  InterPro: IPR005484 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family includes L18 from bacteria and L5 from eukaryotes. The ribosomal 5S RNA is the only known rRNA species to bind a ribosomal protein before its assembly into the ribosomal subunits []. In eukaryotes, the 5S rRNA molecule binds one protein species, a 34kDa protein which has been implicated in the intracellular transport of 5 S rRNA, while in bacteria it binds two or three different protein species []. ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_M 4A1C_M 4A1A_M 4A17_M 3IZR_Q 3O58_E 1S1I_E 3IZS_Q 3O5H_E 1KQS_M ....
Probab=50.93  E-value=20  Score=22.58  Aligned_cols=24  Identities=13%  Similarity=-0.090  Sum_probs=21.5

Q ss_pred             chHHHHHHHHhhcCCEEEEEcccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .+|..+|+++...|...+.+||..
T Consensus        75 ~vG~lla~ra~~~gi~~v~fdr~~   98 (119)
T PF00861_consen   75 LVGELLAKRALEKGIAKVVFDRGG   98 (119)
T ss_dssp             HHHHHHHHHHHHTTSSEEEECTST
T ss_pred             HHHHHHHHHHHHcCCcEEEEcCCC
Confidence            489999999999999999999753


No 272
>cd01977 Nitrogenase_VFe_alpha Nitrogenase_VFe_alpha -like: Nitrogenase VFe protein, alpha subunit like. This group contains proteins similar to the alpha subunits of,  the VFe protein of the vanadium-dependent (V-) nitrogenase and the FeFe protein of the iron only (Fe-) nitrogenase Nitrogenase catalyzes the ATP-dependent reduction of dinitrogen (N2) to ammonia. In addition to V- and Fe- nitrogenases there is a molybdenum (Mo)-dependent nitrogenase which is the most widespread and best characterized of these systems.  These systems consist of component 1 (VFe protein, FeFe protein or, MoFe protein  respectively) and, component 2 (Fe protein). MoFe is an alpha2beta2 tetramer, V-and Fe- nitrogenases are alpha2beta2delta2 hexamers. The alpha and beta subunits of VFe and FeFe are similar to the alpha and beta subunits of MoFe. For MoFe each alphabeta pair contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha sub
Probab=50.92  E-value=87  Score=23.80  Aligned_cols=40  Identities=10%  Similarity=0.137  Sum_probs=24.9

Q ss_pred             CCCCceEEEecCccCCcc---cHHHHh-----hcC---cEEEecCCCCccc
Q psy15800          5 AGENLKVISTFSVGHDHL---HLDQIK-----SRG---IRVGTVGPVSSDA   44 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~i---d~~~~~-----~~g---i~v~n~~g~~~~~   44 (109)
                      .+|+.|+|...++-+..+   |++...     +.+   |..+++||+....
T Consensus        85 ~~p~p~~i~V~~tc~~~liGdDi~~v~~~~~~~~~~~~vi~v~tpgf~g~~  135 (415)
T cd01977          85 EFPDIKRMTVYTTCTTALIGDDIKAVAKEVMEELPDVDIFVCNAPGFAGPS  135 (415)
T ss_pred             hCCCCcEEEEECCCchhhhcCCHHHHHHHHHHhcCCCeEEEEeCCCcCCcc
Confidence            357778877777666543   554432     334   6667889987643


No 273
>PLN02240 UDP-glucose 4-epimerase
Probab=50.73  E-value=21  Score=25.83  Aligned_cols=24  Identities=8%  Similarity=-0.043  Sum_probs=21.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+.+++.|..-|.+|++.++
T Consensus        14 tG~iG~~l~~~L~~~g~~V~~~~~   37 (352)
T PLN02240         14 AGYIGSHTVLQLLLAGYKVVVIDN   37 (352)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEeC
Confidence            478999999999988999999875


No 274
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
Probab=50.53  E-value=16  Score=29.74  Aligned_cols=26  Identities=4%  Similarity=-0.139  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcC--CEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASI--MQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg--~~V~~~~r~~  108 (109)
                      .|.+|..+++.++..|  .+|++|||..
T Consensus        11 ~G~mG~ala~~l~~~G~~~~V~~~d~~~   38 (735)
T PRK14806         11 LGLIGGSFAKALRERGLAREVVAVDRRA   38 (735)
T ss_pred             eCHHHHHHHHHHHhcCCCCEEEEEECCh
Confidence            5899999999999887  5899999864


No 275
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). The gene neighborhood of members of this family is not conserved and it appears that no members are characterized. The sequence of the family includes 6 invariant cysteine residues and one invariant histidine. It appears that no member is characterized.
Probab=50.32  E-value=18  Score=26.30  Aligned_cols=24  Identities=21%  Similarity=-0.094  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|...++.++..|++|++.++.
T Consensus       175 g~iG~~a~~~a~~~G~~vi~~~~~  198 (329)
T TIGR02822       175 GGSAHLTAQVALAQGATVHVMTRG  198 (329)
T ss_pred             CHHHHHHHHHHHHCCCeEEEEeCC
Confidence            789999999999999999988764


No 276
>PRK04148 hypothetical protein; Provisional
Probab=50.24  E-value=19  Score=23.28  Aligned_cols=24  Identities=4%  Similarity=-0.112  Sum_probs=20.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      | -|..+|..|+..|.+|++.|..+
T Consensus        26 G-fG~~vA~~L~~~G~~ViaIDi~~   49 (134)
T PRK04148         26 G-FYFKVAKKLKESGFDVIVIDINE   49 (134)
T ss_pred             c-CCHHHHHHHHHCCCEEEEEECCH
Confidence            6 78889999999999999999653


No 277
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto- 13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of ac
Probab=50.15  E-value=16  Score=26.01  Aligned_cols=23  Identities=4%  Similarity=-0.187  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+..++.++.+|++|++.++
T Consensus       154 g~vG~~aiqlA~~~G~~vi~~~~  176 (329)
T cd08294         154 GAVGSLVGQIAKIKGCKVIGCAG  176 (329)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeC
Confidence            78999999999999999988764


No 278
>cd00432 Ribosomal_L18_L5e Ribosomal L18/L5e:  L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit. L18 binds 5S rRNA and induces a conformational change that stimulates the binding of L5 to 5S rRNA. Association of 5S rRNA with 23S rRNA depends on the binding of L18 and L5 to 5S rRNA. L18/L5e is generally described as L18 in prokaryotes and archaea, and as L5e (or L5) in eukaryotes. In bacteria, the CP proteins L5, L18, and L25 are required for the ribosome to incorporate 5S rRNA into the large subunit, one of the last steps in ribosome assembly. In archaea, both L18 and L5 bind 5S rRNA; in eukaryotes, only the L18 homolog (L5e) binds 5S rRNA but a homolog to L5 is also identified.
Probab=50.08  E-value=21  Score=21.62  Aligned_cols=23  Identities=13%  Similarity=-0.077  Sum_probs=20.8

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||..+|+++...|..-+++|+-
T Consensus        61 ~vG~~la~r~~~~gi~~vv~D~~   83 (103)
T cd00432          61 LVGRLLAKRALEKGIKKVVFDRG   83 (103)
T ss_pred             HHHHHHHHHHHHCCCCEEEEeCC
Confidence            68999999999999998888874


No 279
>PRK12744 short chain dehydrogenase; Provisional
Probab=49.98  E-value=22  Score=24.44  Aligned_cols=23  Identities=9%  Similarity=-0.177  Sum_probs=19.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|.||+++|+.+...|.+|+..+
T Consensus        17 ~~gIG~~~a~~l~~~G~~vv~i~   39 (257)
T PRK12744         17 AKNLGGLIARDLAAQGAKAVAIH   39 (257)
T ss_pred             CchHHHHHHHHHHHCCCcEEEEe
Confidence            46899999999999999966654


No 280
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=49.96  E-value=21  Score=24.30  Aligned_cols=23  Identities=9%  Similarity=-0.117  Sum_probs=19.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|.||+.+|+.+...|.+|+...
T Consensus        15 s~~iG~~la~~l~~~g~~v~~~~   37 (247)
T PRK12935         15 AKGIGKAITVALAQEGAKVVINY   37 (247)
T ss_pred             CCHHHHHHHHHHHHcCCEEEEEc
Confidence            47899999999999999998653


No 281
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated
Probab=49.94  E-value=14  Score=28.96  Aligned_cols=25  Identities=4%  Similarity=-0.104  Sum_probs=23.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |..|..+|..+..-|.+|..||+..
T Consensus        16 G~MG~gIA~~la~aG~~V~l~D~~~   40 (507)
T PRK08268         16 GAMGAGIAQVAAQAGHTVLLYDARA   40 (507)
T ss_pred             CHHHHHHHHHHHhCCCeEEEEeCCH
Confidence            7899999999998899999999864


No 282
>PRK06484 short chain dehydrogenase; Validated
Probab=49.65  E-value=16  Score=28.17  Aligned_cols=24  Identities=13%  Similarity=-0.072  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++|+.+...|.+|+..+|.
T Consensus       279 ~gIG~~~a~~l~~~G~~V~~~~r~  302 (520)
T PRK06484        279 RGIGRAVADRFAAAGDRLLIIDRD  302 (520)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeCC
Confidence            469999999999999999998874


No 283
>PLN02896 cinnamyl-alcohol dehydrogenase
Probab=49.65  E-value=19  Score=26.32  Aligned_cols=25  Identities=4%  Similarity=-0.258  Sum_probs=21.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|-||+.+++.|..-|.+|++.+|.
T Consensus        19 ~GfIG~~l~~~L~~~G~~V~~~~r~   43 (353)
T PLN02896         19 TGYIGSWLVKLLLQRGYTVHATLRD   43 (353)
T ss_pred             CcHHHHHHHHHHHHCCCEEEEEeCC
Confidence            3789999999999999999987653


No 284
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit. In some species, such as Rhodospirillum rubrum, the alpha chain is replaced by two shorter chains, both with some homology to the full-length alpha chain modeled here. These score below the trusted cutoff.
Probab=49.63  E-value=19  Score=28.51  Aligned_cols=25  Identities=0%  Similarity=-0.330  Sum_probs=22.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.+|...++.++.+|++|+++|+..
T Consensus       173 G~iGl~Aa~~ak~lGA~V~v~d~~~  197 (511)
T TIGR00561       173 GVAGLAAIGAANSLGAIVRAFDTRP  197 (511)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCCH
Confidence            7899999999999999999998753


No 285
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases. yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone  + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH
Probab=49.42  E-value=18  Score=25.63  Aligned_cols=24  Identities=13%  Similarity=-0.165  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..+++.++..|++|+..++.
T Consensus       157 g~vg~~~~~~a~~~g~~v~~~~~~  180 (326)
T cd08289         157 GGVGSLAVSILAKLGYEVVASTGK  180 (326)
T ss_pred             chHHHHHHHHHHHCCCeEEEEecC
Confidence            789999999999999999887653


No 286
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=49.37  E-value=16  Score=24.81  Aligned_cols=22  Identities=5%  Similarity=-0.148  Sum_probs=19.3

Q ss_pred             hccchHHHHHHHHhhcCCEEEE
Q psy15800         82 LITQSDTNHTQRCLASIMQLVY  103 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~  103 (109)
                      -.|.||+++++.+...|.+|+.
T Consensus        12 a~g~iG~~~a~~l~~~g~~v~~   33 (250)
T PRK08063         12 SSRGIGKAIALRLAEEGYDIAV   33 (250)
T ss_pred             CCchHHHHHHHHHHHCCCEEEE
Confidence            3588999999999999999875


No 287
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=49.37  E-value=22  Score=25.25  Aligned_cols=23  Identities=9%  Similarity=-0.075  Sum_probs=21.2

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||.++|+++..+|=+|+...|.
T Consensus        16 GIGl~lak~f~elgN~VIi~gR~   38 (245)
T COG3967          16 GIGLALAKRFLELGNTVIICGRN   38 (245)
T ss_pred             hhhHHHHHHHHHhCCEEEEecCc
Confidence            59999999999999999998875


No 288
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism]
Probab=49.24  E-value=16  Score=27.38  Aligned_cols=18  Identities=11%  Similarity=0.106  Sum_probs=15.7

Q ss_pred             hHHHHHHHHhhcCCEEEE
Q psy15800         86 SDTNHTQRCLASIMQLVY  103 (109)
Q Consensus        86 IG~~va~~~~~fg~~V~~  103 (109)
                      --.++|+|++.+||+|+.
T Consensus       105 k~ieiakRAk~~GmKVl~  122 (403)
T COG3867         105 KAIEIAKRAKNLGMKVLL  122 (403)
T ss_pred             HHHHHHHHHHhcCcEEEe
Confidence            466899999999999985


No 289
>PF13241 NAD_binding_7:  Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B.
Probab=49.17  E-value=20  Score=21.63  Aligned_cols=24  Identities=4%  Similarity=-0.090  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..-++.|...|++|+.++|.
T Consensus        16 G~va~~k~~~Ll~~gA~v~vis~~   39 (103)
T PF13241_consen   16 GPVAARKARLLLEAGAKVTVISPE   39 (103)
T ss_dssp             SHHHHHHHHHHCCCTBEEEEEESS
T ss_pred             CHHHHHHHHHHHhCCCEEEEECCc
Confidence            789999999999999999999875


No 290
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=49.17  E-value=23  Score=23.83  Aligned_cols=24  Identities=13%  Similarity=-0.011  Sum_probs=20.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+.+++.+..-|.+|+...+
T Consensus        14 sg~iG~~l~~~l~~~G~~v~~~~~   37 (248)
T PRK05557         14 SRGIGRAIAERLAAQGANVVINYA   37 (248)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeC
Confidence            478999999999988999866554


No 291
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC. This 3-hydroxyacyl-CoA dehydrogenase is involved in the degradation of phenylacetic acid, presumably in steps following the opening of the phenyl ring. The sequences included in this model are all found in aparrent operons with other related genes such as paaA, paaB, paaD, paaE, paaF and paaN. Some genomes contain these other genes without an apparent paaC in the same operon - possibly in these cases a different dehydrogenase involved in fatty acid degradation may fill in the needed activity. This enzyme has domains which are members of the pfam02737 and pfam00725 families.
Probab=49.09  E-value=14  Score=28.95  Aligned_cols=26  Identities=8%  Similarity=-0.079  Sum_probs=23.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|..|..+|..+..-|.+|..||+..
T Consensus        13 aG~MG~gIA~~la~aG~~V~l~d~~~   38 (503)
T TIGR02279        13 AGAMGAGIAQVAASAGHQVLLYDIRA   38 (503)
T ss_pred             cCHHHHHHHHHHHhCCCeEEEEeCCH
Confidence            37899999999999999999999864


No 292
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]
Probab=49.07  E-value=20  Score=27.68  Aligned_cols=24  Identities=4%  Similarity=-0.126  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |+.|+..|+.+...|.+|+++|-.
T Consensus       216 GNVg~~aa~~l~~~GAkvva~sds  239 (411)
T COG0334         216 GNVGQYAAEKLHELGAKVVAVSDS  239 (411)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEEcC
Confidence            799999999999999999998753


No 293
>PF11430 EGL-1:  Programmed cell death activator EGL-1;  InterPro: IPR021543  Initiation of programmed cell death in C.elegans occurs by the binding of EGL-1 to CED-9 which disrupts a complex involving CED-4/CED-9 and allows CED-4 to activate CED-3, a caspase. It is the C-terminal domain of EGL-1 which is involved in the formation of the complex with CED-9. The formation of the complex induces structural rearrangements in CED-9 and EGL-1 adopts an extended alpha-helical conformation []. ; PDB: 1TY4_D.
Probab=48.95  E-value=15  Score=15.96  Aligned_cols=16  Identities=13%  Similarity=0.038  Sum_probs=13.0

Q ss_pred             chHHHHHHHHhhcCCE
Q psy15800         85 QSDTNHTQRCLASIMQ  100 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~  100 (109)
                      .||+.+|.+|-.|+.+
T Consensus         2 ~IG~kla~MCDdFD~e   17 (21)
T PF11430_consen    2 EIGTKLAAMCDDFDAE   17 (21)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHH
Confidence            4899999999888643


No 294
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase. Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (EC 1.3.1.74), while 1.3.1.48 is 15-oxoprostaglandin 13-reductase.
Probab=48.92  E-value=22  Score=25.48  Aligned_cols=24  Identities=8%  Similarity=-0.182  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+..++.++.+|++|++.++.
T Consensus       149 g~vG~~aiqlAk~~G~~Vi~~~~s  172 (325)
T TIGR02825       149 GAVGSVVGQIAKLKGCKVVGAAGS  172 (325)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeCC
Confidence            789999999999999999887653


No 295
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=48.80  E-value=20  Score=27.54  Aligned_cols=24  Identities=8%  Similarity=-0.184  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|.++|+.|...|.+|.++|+.
T Consensus        25 G~~G~~~A~~L~~~G~~V~~~d~~   48 (480)
T PRK01438         25 GVSGFAAADALLELGARVTVVDDG   48 (480)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCC
Confidence            789999999999999999999854


No 296
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic
Probab=48.77  E-value=19  Score=26.00  Aligned_cols=25  Identities=8%  Similarity=-0.217  Sum_probs=22.0

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|+.++++++.+|++|++.++.
T Consensus       178 ~g~vG~~~~~~a~~~G~~v~~~~~~  202 (337)
T cd05283         178 IGGLGHLAVKFAKALGAEVTAFSRS  202 (337)
T ss_pred             CcHHHHHHHHHHHHcCCeEEEEcCC
Confidence            3789999999999999999988764


No 297
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=48.71  E-value=20  Score=24.15  Aligned_cols=25  Identities=4%  Similarity=-0.265  Sum_probs=21.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+++++.+...|..|...++.
T Consensus        15 ~g~iG~~la~~l~~~g~~v~~~~~~   39 (245)
T PRK12936         15 SGGIGEEIARLLHAQGAIVGLHGTR   39 (245)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEcCC
Confidence            4789999999999999988877654


No 298
>PRK12548 shikimate 5-dehydrogenase; Provisional
Probab=48.55  E-value=19  Score=25.93  Aligned_cols=25  Identities=8%  Similarity=0.048  Sum_probs=22.0

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~~  108 (109)
                      |.+|++++..|...|++ |..++|..
T Consensus       135 GGagrAia~~La~~G~~~V~I~~R~~  160 (289)
T PRK12548        135 GGAATAIQVQCALDGAKEITIFNIKD  160 (289)
T ss_pred             cHHHHHHHHHHHHCCCCEEEEEeCCc
Confidence            67999999999999996 99998863


No 299
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional
Probab=48.44  E-value=21  Score=27.93  Aligned_cols=21  Identities=5%  Similarity=-0.040  Sum_probs=19.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEE
Q psy15800         84 TQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~  104 (109)
                      |++|+..|+.|..+|++|+++
T Consensus       246 GnVg~~aa~~L~e~GakVVav  266 (454)
T PTZ00079        246 GNVAQYAVEKLLQLGAKVLTM  266 (454)
T ss_pred             CHHHHHHHHHHHHCCCEEEEE
Confidence            789999999999999999954


No 300
>PLN02730 enoyl-[acyl-carrier-protein] reductase
Probab=48.16  E-value=23  Score=25.86  Aligned_cols=19  Identities=5%  Similarity=-0.111  Sum_probs=17.9

Q ss_pred             chHHHHHHHHhhcCCEEEE
Q psy15800         85 QSDTNHTQRCLASIMQLVY  103 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~  103 (109)
                      .||.++|+.+..-|++|+.
T Consensus        22 GIG~a~A~~la~~Ga~Vv~   40 (303)
T PLN02730         22 GYGWAIAKALAAAGAEILV   40 (303)
T ss_pred             cHHHHHHHHHHHCCCEEEE
Confidence            4999999999999999988


No 301
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordina
Probab=48.16  E-value=18  Score=25.57  Aligned_cols=23  Identities=4%  Similarity=-0.146  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++++|++|+...+
T Consensus       150 g~ig~~~~~~a~~~G~~v~~~~~  172 (324)
T cd08292         150 GAVGKLVAMLAAARGINVINLVR  172 (324)
T ss_pred             cHHHHHHHHHHHHCCCeEEEEec
Confidence            67999999999999999887754


No 302
>KOG1687|consensus
Probab=48.10  E-value=43  Score=22.04  Aligned_cols=61  Identities=13%  Similarity=0.089  Sum_probs=41.6

Q ss_pred             CCCCceEEEecCc-----cCCcccHHHHh--hcCcEEE-ecCCCCccchHHHHHHHHHHHhcCchHhHHHH
Q psy15800          5 AGENLKVISTFSV-----GHDHLHLDQIK--SRGIRVG-TVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCI   67 (109)
Q Consensus         5 ~~p~Lk~i~~~~~-----G~d~id~~~~~--~~gi~v~-n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~   67 (109)
                      +.|.-||+.+.++     |+=|.-....+  ++=|+|- ..||  .++.||..+..+|-|.+++.+....|
T Consensus        95 QMPEpr~VisMGsCangGGyyhysYSvvRGcDriiPVDiYvPG--CPPtaEAllygilqLqkKi~R~r~~q  163 (168)
T KOG1687|consen   95 QMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPG--CPPTAEALLYGILQLQKKIKRIRPLQ  163 (168)
T ss_pred             hCCCCeeEEEecccccCCceEEEEehhhccccceeeeeeecCC--CCCCHHHHHHHHHHHHHHHHHhhhhh
Confidence            5788899977654     44454433332  2345553 4677  67899999999999999988655444


No 303
>PF04127 DFP:  DNA / pantothenate metabolism flavoprotein;  InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism. These proteins contain ATP, phosphopantothenate, and cysteine binding sites. The structure of this domain has been determined in human phosphopantothenoylcysteine (PPC) synthetase [] and as the PPC synthase domain (CoaB) from the Escherichia coli coenzyme A bifunctional protein CoaBC []. This domain adopts a 3-layer alpha/beta/alpha fold with mixed beta-sheets, which topologically resembles a combination of Rossmann-like and ribokinase-like folds. The structure of these proteins predicts a ping pong mechanism with initial formation of an acyladenylate intermediate, followed by release of pyrophosphate and attack by cysteine to form the final products PPC and AMP. ; PDB: 1U7W_A 1U7U_A 1U80_C 1U7Z_A 1P9O_B 2GK4_A.
Probab=48.05  E-value=22  Score=24.13  Aligned_cols=24  Identities=0%  Similarity=-0.121  Sum_probs=19.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|+.|.++|+.+...|.+|+++..
T Consensus        28 SG~~G~~lA~~~~~~Ga~V~li~g   51 (185)
T PF04127_consen   28 SGKMGAALAEEAARRGAEVTLIHG   51 (185)
T ss_dssp             -SHHHHHHHHHHHHTT-EEEEEE-
T ss_pred             cCHHHHHHHHHHHHCCCEEEEEec
Confidence            399999999999999999998753


No 304
>PRK06128 oxidoreductase; Provisional
Probab=47.66  E-value=26  Score=24.90  Aligned_cols=23  Identities=0%  Similarity=-0.145  Sum_probs=19.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.||+++++.+...|.+|+...+
T Consensus        65 ~gIG~~~a~~l~~~G~~V~i~~~   87 (300)
T PRK06128         65 SGIGRATAIAFAREGADIALNYL   87 (300)
T ss_pred             CcHHHHHHHHHHHcCCEEEEEeC
Confidence            67999999999999999987543


No 305
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=47.57  E-value=15  Score=29.42  Aligned_cols=25  Identities=8%  Similarity=-0.110  Sum_probs=22.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |++|+.+++.|+..|.++++.|..+
T Consensus       409 Gr~G~~va~~L~~~g~~vvvID~d~  433 (601)
T PRK03659        409 GRFGQVIGRLLMANKMRITVLERDI  433 (601)
T ss_pred             chHHHHHHHHHHhCCCCEEEEECCH
Confidence            8999999999999999999998653


No 306
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]
Probab=47.51  E-value=21  Score=27.74  Aligned_cols=25  Identities=4%  Similarity=-0.219  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |-||-++|..++.||.+|..+.+..
T Consensus       182 G~IGlE~a~~~~~LG~~VTiie~~~  206 (454)
T COG1249         182 GYIGLEFASVFAALGSKVTVVERGD  206 (454)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEecCC
Confidence            6799999999999999999887643


No 307
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=47.44  E-value=24  Score=23.64  Aligned_cols=24  Identities=8%  Similarity=-0.132  Sum_probs=20.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+.+++.+...|.+|+...+
T Consensus        15 sg~iG~~l~~~l~~~g~~v~~~~~   38 (249)
T PRK12825         15 ARGLGRAIALRLARAGADVVVHYR   38 (249)
T ss_pred             CchHHHHHHHHHHHCCCeEEEEeC
Confidence            478999999999999999877443


No 308
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=47.32  E-value=22  Score=27.43  Aligned_cols=23  Identities=4%  Similarity=-0.074  Sum_probs=20.5

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .-...++++|+..|.+|.+|||-
T Consensus       330 Spa~~vi~~L~~~Ga~V~aYDP~  352 (414)
T COG1004         330 SPALDIIKRLQEKGAEVIAYDPV  352 (414)
T ss_pred             chHHHHHHHHHHCCCEEEEECch
Confidence            45778999999999999999985


No 309
>PRK09134 short chain dehydrogenase; Provisional
Probab=47.32  E-value=25  Score=24.22  Aligned_cols=23  Identities=4%  Similarity=-0.142  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.||+.+++.+...|++|+..++
T Consensus        19 ~giG~~la~~l~~~g~~v~~~~~   41 (258)
T PRK09134         19 RRIGRAIALDLAAHGFDVAVHYN   41 (258)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEeC
Confidence            68999999999999999987654


No 310
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=47.18  E-value=15  Score=29.51  Aligned_cols=24  Identities=8%  Similarity=-0.122  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |++|+.+++.|+..|.+++..|..
T Consensus       409 Gr~G~~va~~L~~~g~~vvvID~d  432 (621)
T PRK03562        409 GRFGQIVGRLLLSSGVKMTVLDHD  432 (621)
T ss_pred             ChHHHHHHHHHHhCCCCEEEEECC
Confidence            899999999999999999988764


No 311
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the
Probab=46.74  E-value=20  Score=26.34  Aligned_cols=24  Identities=0%  Similarity=-0.176  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|...++.++.+|+ +|++.++.
T Consensus       197 g~vG~~a~q~ak~~G~~~vi~~~~~  221 (369)
T cd08301         197 GAVGLAVAEGARIRGASRIIGVDLN  221 (369)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEcCC
Confidence            7899999999999999 79988764


No 312
>PRK06123 short chain dehydrogenase; Provisional
Probab=46.58  E-value=24  Score=23.93  Aligned_cols=23  Identities=0%  Similarity=-0.184  Sum_probs=19.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|.||..+++.+...|++|+..+
T Consensus        11 ~~~iG~~~a~~l~~~G~~vv~~~   33 (248)
T PRK06123         11 SRGIGAATALLAAERGYAVCLNY   33 (248)
T ss_pred             CchHHHHHHHHHHHCCCeEEEec
Confidence            47899999999999999887654


No 313
>PLN03154 putative allyl alcohol dehydrogenase; Provisional
Probab=46.45  E-value=25  Score=25.78  Aligned_cols=24  Identities=13%  Similarity=-0.244  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|...++.++.+|++|++.++.
T Consensus       169 G~vG~~aiqlAk~~G~~Vi~~~~~  192 (348)
T PLN03154        169 GAVGQLVGQLAKLHGCYVVGSAGS  192 (348)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEcCC
Confidence            789999999999999999987653


No 314
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases. Yhdh and yhfp-like putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and so
Probab=46.22  E-value=21  Score=25.20  Aligned_cols=24  Identities=8%  Similarity=-0.251  Sum_probs=21.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..+++.++..|.+|+..++.
T Consensus       157 g~vg~~~~~~a~~~g~~v~~~~~~  180 (325)
T cd05280         157 GGVGSIAVAILAKLGYTVVALTGK  180 (325)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeCC
Confidence            789999999999999999887764


No 315
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like. MDR/AHD-like proteins, including a protein annotated as a threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones.  Zinc-dependent ADHs are medium chain dehydrogenase/reductase type proteins (MDRs) and have a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. In addition to alcohol dehydrogenases, this group includes quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc at
Probab=46.22  E-value=17  Score=26.17  Aligned_cols=24  Identities=4%  Similarity=-0.252  Sum_probs=21.5

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.+|...++.++.+|++ |++.++.
T Consensus       173 G~vG~~~~~~ak~~G~~~vi~~~~~  197 (339)
T cd08239         173 GPVGLGALMLARALGAEDVIGVDPS  197 (339)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEECCC
Confidence            78999999999999999 9888764


No 316
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]
Probab=46.11  E-value=23  Score=25.42  Aligned_cols=25  Identities=4%  Similarity=-0.023  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ..||.++|+++..-|.+|+...|..
T Consensus        16 SGiG~A~A~~l~~~G~~vvl~aRR~   40 (246)
T COG4221          16 SGIGEATARALAEAGAKVVLAARRE   40 (246)
T ss_pred             chHHHHHHHHHHHCCCeEEEEeccH
Confidence            4699999999999999999988763


No 317
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=45.82  E-value=25  Score=26.69  Aligned_cols=23  Identities=4%  Similarity=-0.123  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.||+.+++.+...|++|+..++
T Consensus       220 ggIG~~la~~l~~~Ga~vi~~~~  242 (450)
T PRK08261        220 RGIGAAIAEVLARDGAHVVCLDV  242 (450)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeC
Confidence            67999999999999999999876


No 318
>PRK12937 short chain dehydrogenase; Provisional
Probab=45.80  E-value=26  Score=23.67  Aligned_cols=24  Identities=8%  Similarity=-0.031  Sum_probs=20.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.||+.+|+.+...|.+|+...+
T Consensus        14 ~~~iG~~la~~l~~~g~~v~~~~~   37 (245)
T PRK12937         14 SRGIGAAIARRLAADGFAVAVNYA   37 (245)
T ss_pred             CchHHHHHHHHHHHCCCEEEEecC
Confidence            478999999999999999876643


No 319
>PRK07201 short chain dehydrogenase; Provisional
Probab=45.78  E-value=18  Score=28.64  Aligned_cols=24  Identities=0%  Similarity=-0.108  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+..-|.+|+..+|.
T Consensus       381 ~giG~~la~~l~~~G~~V~~~~r~  404 (657)
T PRK07201        381 SGIGRATAIKVAEAGATVFLVARN  404 (657)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECC
Confidence            469999999999999999998875


No 320
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase. This clade of zinc-binding alcohol dehydrogenases (members of pfam00107) are repeatedly associated with genes proposed to be involved with the catabolism of phosphonate compounds.
Probab=45.76  E-value=18  Score=25.55  Aligned_cols=24  Identities=8%  Similarity=-0.128  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.||...++.++.+|.+ |++.++.
T Consensus       130 G~vG~~~~~~ak~~G~~~Vi~~~~~  154 (280)
T TIGR03366       130 GMLGLTAAAAAAAAGAARVVAADPS  154 (280)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEECCC
Confidence            78999999999999997 8887653


No 321
>CHL00139 rpl18 ribosomal protein L18; Validated
Probab=45.71  E-value=28  Score=21.70  Aligned_cols=24  Identities=8%  Similarity=-0.076  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -.+|..+|+++...|.+-++|||.
T Consensus        64 ~~vG~lla~ra~~~gi~~vvfDrg   87 (109)
T CHL00139         64 KLVGQKLAKKSLKKGITKVVFDRG   87 (109)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEcCC
Confidence            368999999999999988899974


No 322
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]
Probab=45.68  E-value=25  Score=27.37  Aligned_cols=25  Identities=12%  Similarity=-0.045  Sum_probs=22.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.-|..+++.|+..|.+|.++|..
T Consensus        15 LG~sG~a~a~~L~~~G~~v~v~D~~   39 (448)
T COG0771          15 LGKSGLAAARFLLKLGAEVTVSDDR   39 (448)
T ss_pred             cccccHHHHHHHHHCCCeEEEEcCC
Confidence            3899999999999999999999943


No 323
>PRK06249 2-dehydropantoate 2-reductase; Provisional
Probab=45.66  E-value=26  Score=25.42  Aligned_cols=25  Identities=0%  Similarity=-0.261  Sum_probs=22.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||..+|.+|...|.+|..+.|.
T Consensus        13 ~GaiG~~lA~~L~~~g~~V~~~~r~   37 (313)
T PRK06249         13 TGAIGGFYGAMLARAGFDVHFLLRS   37 (313)
T ss_pred             CCHHHHHHHHHHHHCCCeEEEEEeC
Confidence            3789999999999999999988874


No 324
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=45.53  E-value=24  Score=27.28  Aligned_cols=23  Identities=4%  Similarity=-0.070  Sum_probs=21.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |+-|+.+++.|...|++|+++|.
T Consensus        17 G~sG~~~~~~l~~~g~~v~~~d~   39 (468)
T PRK04690         17 GREGRAAYRALRAHLPAQALTLF   39 (468)
T ss_pred             chhhHHHHHHHHHcCCEEEEEcC
Confidence            89999999999999999999994


No 325
>PLN02178 cinnamyl-alcohol dehydrogenase
Probab=45.46  E-value=23  Score=26.34  Aligned_cols=24  Identities=4%  Similarity=-0.237  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|...++.++++|++|++.++.
T Consensus       188 G~vG~~avq~Ak~~Ga~Vi~~~~~  211 (375)
T PLN02178        188 GGLGHIAVKIGKAFGLRVTVISRS  211 (375)
T ss_pred             cHHHHHHHHHHHHcCCeEEEEeCC
Confidence            789999999999999999887643


No 326
>PRK08324 short chain dehydrogenase; Validated
Probab=45.46  E-value=22  Score=28.78  Aligned_cols=24  Identities=13%  Similarity=-0.042  Sum_probs=22.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+++.+...|.+|+..+|.
T Consensus       432 ggIG~~la~~L~~~Ga~Vvl~~r~  455 (681)
T PRK08324        432 GGIGKATAKRLAAEGACVVLADLD  455 (681)
T ss_pred             CHHHHHHHHHHHHCcCEEEEEeCC
Confidence            679999999999999999999875


No 327
>PLN02206 UDP-glucuronate decarboxylase
Probab=45.35  E-value=23  Score=27.17  Aligned_cols=23  Identities=9%  Similarity=-0.012  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |-||+.+++.|..-|.+|+++|+
T Consensus       129 GfIGs~Lv~~Ll~~G~~V~~ld~  151 (442)
T PLN02206        129 GFVGSHLVDRLMARGDSVIVVDN  151 (442)
T ss_pred             cHHHHHHHHHHHHCcCEEEEEeC
Confidence            67999999999999999999875


No 328
>cd08244 MDR_enoyl_red Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydr
Probab=45.11  E-value=22  Score=25.07  Aligned_cols=25  Identities=12%  Similarity=-0.186  Sum_probs=21.8

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|..++++++.+|.+|++.++.
T Consensus       152 ~~~~g~~~~~la~~~g~~v~~~~~~  176 (324)
T cd08244         152 AGGLGSLLVQLAKAAGATVVGAAGG  176 (324)
T ss_pred             CchHHHHHHHHHHHCCCEEEEEeCC
Confidence            3789999999999999999888753


No 329
>PLN02214 cinnamoyl-CoA reductase
Probab=44.99  E-value=26  Score=25.64  Aligned_cols=25  Identities=4%  Similarity=-0.303  Sum_probs=21.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|-||+.+++.|..-|.+|.+.+|.
T Consensus        19 tGfIG~~l~~~L~~~G~~V~~~~r~   43 (342)
T PLN02214         19 GGYIASWIVKILLERGYTVKGTVRN   43 (342)
T ss_pred             CcHHHHHHHHHHHHCcCEEEEEeCC
Confidence            3789999999999999999988764


No 330
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=44.81  E-value=29  Score=23.53  Aligned_cols=22  Identities=18%  Similarity=0.086  Sum_probs=19.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~  104 (109)
                      .|.||+.+|+.+...|.+|+..
T Consensus        12 s~giG~~~a~~l~~~G~~vv~~   33 (246)
T PRK12938         12 MGGIGTSICQRLHKDGFKVVAG   33 (246)
T ss_pred             CChHHHHHHHHHHHcCCEEEEE
Confidence            4789999999999999998874


No 331
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase.
Probab=44.55  E-value=25  Score=28.55  Aligned_cols=24  Identities=13%  Similarity=0.040  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+++++.+...|.+|+..++.
T Consensus       424 ggIG~aiA~~La~~Ga~Vvi~~r~  447 (676)
T TIGR02632       424 GGIGRETARRLAAEGAHVVLADLN  447 (676)
T ss_pred             cHHHHHHHHHHHhCCCEEEEEeCC
Confidence            579999999999999999998875


No 332
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=44.55  E-value=21  Score=25.36  Aligned_cols=24  Identities=13%  Similarity=-0.158  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|++|++.++.
T Consensus       151 g~ig~~~~~lak~~G~~v~~~~~~  174 (327)
T PRK10754        151 GGVGLIACQWAKALGAKLIGTVGS  174 (327)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeCC
Confidence            689999999999999999887653


No 333
>PLN02427 UDP-apiose/xylose synthase
Probab=44.50  E-value=27  Score=25.82  Aligned_cols=25  Identities=4%  Similarity=0.024  Sum_probs=21.4

Q ss_pred             ccchHHHHHHHHhhc-CCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLAS-IMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~f-g~~V~~~~r~  107 (109)
                      .|-||+.+++.|..- |.+|+++|+.
T Consensus        23 tGfIGs~lv~~L~~~~g~~V~~l~r~   48 (386)
T PLN02427         23 GGFIGSHLCEKLMTETPHKVLALDVY   48 (386)
T ss_pred             cchHHHHHHHHHHhcCCCEEEEEecC
Confidence            378999999999987 5899999864


No 334
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=44.37  E-value=21  Score=26.00  Aligned_cols=24  Identities=13%  Similarity=-0.177  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|...++.++..|.+|++.++.
T Consensus       176 G~vG~~a~~~a~~~G~~vi~~~~~  199 (349)
T TIGR03201       176 GGVGGYMVQTAKAMGAAVVAIDID  199 (349)
T ss_pred             CHHHHHHHHHHHHcCCeEEEEcCC
Confidence            889999999999999999988754


No 335
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase. The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated alcohol dehydrogenase (EC 1.1.1.1) of class III, for activities that do not require glutathione; they tend to show poor activity for ethanol among their various substrate alcohols.
Probab=44.10  E-value=22  Score=26.24  Aligned_cols=24  Identities=4%  Similarity=-0.112  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.||...++.++.+|. +|++.++.
T Consensus       195 G~iG~~a~q~Ak~~G~~~Vi~~~~~  219 (368)
T TIGR02818       195 GGIGLSVIQGARMAKASRIIAIDIN  219 (368)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEcCC
Confidence            7899999999999999 79988754


No 336
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. 
Probab=44.02  E-value=22  Score=25.08  Aligned_cols=24  Identities=13%  Similarity=-0.111  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|.+|+..++.
T Consensus       173 g~vG~~~~~~a~~~g~~v~~~~~~  196 (332)
T cd08259         173 GGVGIHAIQLAKALGARVIAVTRS  196 (332)
T ss_pred             CHHHHHHHHHHHHcCCeEEEEeCC
Confidence            689999999999999999887653


No 337
>PLN02858 fructose-bisphosphate aldolase
Probab=43.86  E-value=20  Score=31.79  Aligned_cols=26  Identities=8%  Similarity=-0.072  Sum_probs=23.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|+.|..-|.+|.+|||.+
T Consensus        12 LG~MG~~mA~~L~~~G~~v~v~dr~~   37 (1378)
T PLN02858         12 LDSLSFELASSLLRSGFKVQAFEIST   37 (1378)
T ss_pred             hhHHHHHHHHHHHHCCCeEEEEcCCH
Confidence            58999999999999999999999874


No 338
>TIGR01289 LPOR light-dependent protochlorophyllide reductase. This model represents the light-dependent, NADPH-dependent form of protochlorophyllide reductase. It belongs to the short chain alcohol dehydrogenase family, in contrast to the nitrogenase-related light-independent form.
Probab=43.84  E-value=23  Score=25.51  Aligned_cols=25  Identities=4%  Similarity=-0.105  Sum_probs=21.5

Q ss_pred             ccchHHHHHHHHhhcC-CEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASI-MQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg-~~V~~~~r~  107 (109)
                      .+.||+++|+.+...| .+|+..+|.
T Consensus        12 s~GIG~aia~~L~~~G~~~V~l~~r~   37 (314)
T TIGR01289        12 SSGLGLYAAKALAATGEWHVIMACRD   37 (314)
T ss_pred             CChHHHHHHHHHHHcCCCEEEEEeCC
Confidence            3679999999999999 999888764


No 339
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=43.53  E-value=27  Score=24.38  Aligned_cols=24  Identities=8%  Similarity=-0.181  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++.+|++|++.++.
T Consensus       143 ~~~g~~~~~~a~~~g~~v~~~~~~  166 (305)
T cd08270         143 GGVGRFAVQLAALAGAHVVAVVGS  166 (305)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeCC
Confidence            689999999999999999887653


No 340
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=43.52  E-value=21  Score=25.07  Aligned_cols=24  Identities=8%  Similarity=-0.200  Sum_probs=21.0

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.+|+.++++++..|++ |++.++.
T Consensus       139 g~vg~~~~~la~~~g~~~v~~~~~~  163 (312)
T cd08269         139 GFIGLLFLQLAAAAGARRVIAIDRR  163 (312)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEECCC
Confidence            78999999999999999 8877653


No 341
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzyme catalyzes the first step in the biosynthesis of pseudaminic acid, the conversion of UDP-N-acetylglucosamine to UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences are members of the broader pfam01073 (3-beta hydroxysteroid dehydrogenase/isomerase family) family.
Probab=43.47  E-value=26  Score=25.35  Aligned_cols=27  Identities=7%  Similarity=-0.032  Sum_probs=21.7

Q ss_pred             hhccchHHHHHHHHhhcC--CEEEEEccc
Q psy15800         81 ELITQSDTNHTQRCLASI--MQLVYSTCY  107 (109)
Q Consensus        81 ~l~G~IG~~va~~~~~fg--~~V~~~~r~  107 (109)
                      .-.|.||+.+++.|..-|  .+|+.++|.
T Consensus        11 GatG~IG~~l~~~L~~~g~~~~V~~~~r~   39 (324)
T TIGR03589        11 GGTGSFGKAFISRLLENYNPKKIIIYSRD   39 (324)
T ss_pred             CCCCHHHHHHHHHHHHhCCCcEEEEEcCC
Confidence            335899999999998775  689888764


No 342
>cd08230 glucose_DH Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contai
Probab=43.14  E-value=27  Score=25.43  Aligned_cols=23  Identities=0%  Similarity=-0.312  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|...++.++..|++|+++++
T Consensus       182 G~vG~~a~q~ak~~G~~vi~~~~  204 (355)
T cd08230         182 GPIGLLAALLLRLRGFEVYVLNR  204 (355)
T ss_pred             CHHHHHHHHHHHHcCCeEEEEec
Confidence            88999999999999999999876


No 343
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain. This model represents a subfamily of CysG N-terminal region-related sequences. All sequences in the seed alignment for this model are N-terminal regions of known or predicted siroheme synthases. The C-terminal region of each is uroporphyrin-III C-methyltransferase (EC 2.1.1.107), which catalyzes the first step committed to the biosynthesis of either siroheme or cobalamin (vitamin B12) rather than protoheme (heme). The region represented by this model completes the process of oxidation and iron insertion to yield siroheme. Siroheme is a cofactor for nitrite and sulfite reductases, so siroheme synthase is CysG of cysteine biosynthesis in some organisms.
Probab=42.99  E-value=31  Score=23.70  Aligned_cols=24  Identities=13%  Similarity=-0.098  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..-++.|..+|++|..++|.
T Consensus        18 G~va~rk~~~Ll~~ga~VtVvsp~   41 (205)
T TIGR01470        18 GDVALRKARLLLKAGAQLRVIAEE   41 (205)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEcCC
Confidence            789999999999999999999875


No 344
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein. This model represents a sister clade to the authenticated coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin reductase (HMD) of TIGR01723. Two members, designated HmdII and HmdIII, are found. Members are restricted to methanogens, but the function is unknown.
Probab=42.92  E-value=28  Score=26.15  Aligned_cols=23  Identities=4%  Similarity=-0.061  Sum_probs=20.2

Q ss_pred             hHHHHHHHHhhcCCEEEEEcccc
Q psy15800         86 SDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        86 IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      =|..+|+.|..-|.+|++|||.+
T Consensus        31 gGspMArnLlkAGheV~V~Drnr   53 (341)
T TIGR01724        31 GGSRMAIEFAMAGHDVVLAEPNR   53 (341)
T ss_pred             CHHHHHHHHHHCCCEEEEEeCCh
Confidence            38999999999999999998753


No 345
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dim
Probab=42.62  E-value=24  Score=25.94  Aligned_cols=24  Identities=8%  Similarity=-0.121  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.||...++.++.+|+ +|++.++.
T Consensus       196 G~vG~~a~~~ak~~G~~~vi~~~~~  220 (368)
T cd08300         196 GAVGLAVIQGAKAAGASRIIGIDIN  220 (368)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEeCC
Confidence            7899999999999999 69888754


No 346
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional
Probab=42.11  E-value=33  Score=24.92  Aligned_cols=21  Identities=5%  Similarity=-0.108  Sum_probs=19.4

Q ss_pred             chHHHHHHHHhhcCCEEEEEc
Q psy15800         85 QSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .||+++|+.|..-|++|+..+
T Consensus        21 GIG~a~A~~la~~Ga~Vvv~~   41 (299)
T PRK06300         21 GYGWGIAKALAEAGATILVGT   41 (299)
T ss_pred             CHHHHHHHHHHHCCCEEEEEe
Confidence            699999999999999998865


No 347
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordin
Probab=42.09  E-value=24  Score=25.26  Aligned_cols=24  Identities=8%  Similarity=0.055  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|...++.++.+|++|++.++.
T Consensus       154 g~vG~~a~q~a~~~G~~vi~~~~~  177 (324)
T cd08291         154 SALGRMLVRLCKADGIKVINIVRR  177 (324)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeCC
Confidence            789999999999999999887653


No 348
>PRK06718 precorrin-2 dehydrogenase; Reviewed
Probab=42.00  E-value=32  Score=23.51  Aligned_cols=24  Identities=8%  Similarity=-0.100  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|...++.|...|.+|+.++|.
T Consensus        19 G~va~~ka~~Ll~~ga~V~VIs~~   42 (202)
T PRK06718         19 GKVAGRRAITLLKYGAHIVVISPE   42 (202)
T ss_pred             CHHHHHHHHHHHHCCCeEEEEcCC
Confidence            789999999999999999998874


No 349
>PRK05593 rplR 50S ribosomal protein L18; Reviewed
Probab=41.94  E-value=34  Score=21.60  Aligned_cols=24  Identities=13%  Similarity=-0.071  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      -.+|..+|+++...|.+=++|||-
T Consensus        72 ~~vG~~la~ra~~~gi~~vvfDrg   95 (117)
T PRK05593         72 KKVGKLIAERAKAKGIKQVVFDRG   95 (117)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEcCC
Confidence            358999999999999988899974


No 350
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding
Probab=41.91  E-value=28  Score=24.17  Aligned_cols=24  Identities=13%  Similarity=-0.042  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|.+|+..++.
T Consensus       150 ~~ig~~~~~~~~~~g~~v~~~~~~  173 (323)
T cd05276         150 SGVGTAAIQLAKALGARVIATAGS  173 (323)
T ss_pred             ChHHHHHHHHHHHcCCEEEEEcCC
Confidence            679999999999999999887653


No 351
>KOG0409|consensus
Probab=41.79  E-value=31  Score=25.70  Aligned_cols=26  Identities=0%  Similarity=-0.051  Sum_probs=23.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|..|..++.-|-.-|.+|++|||+.
T Consensus        43 LG~MG~~M~~nLik~G~kVtV~dr~~   68 (327)
T KOG0409|consen   43 LGNMGSAMVSNLIKAGYKVTVYDRTK   68 (327)
T ss_pred             eccchHHHHHHHHHcCCEEEEEeCcH
Confidence            38899999999999999999999974


No 352
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH). This group contains the hypothetical TM0436 alcohol dehydrogenase from Thermotoga maritima,  proteins annotated as 5-exo-alcohol dehydrogenase, and other members of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family.  MDR, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quino
Probab=41.62  E-value=25  Score=25.56  Aligned_cols=24  Identities=0%  Similarity=-0.204  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|+.+++.++.+|+ +|++.++.
T Consensus       187 g~vG~~~~~lak~~G~~~v~~~~~~  211 (361)
T cd08231         187 GPLGLYAVAAAKLAGARRVIVIDGS  211 (361)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEcCC
Confidence            7899999999999999 89887653


No 353
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family, including threonine dehydrogenase. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reducta
Probab=41.18  E-value=24  Score=25.02  Aligned_cols=24  Identities=8%  Similarity=-0.248  Sum_probs=21.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.+|+.+++.++..|.+|++.++
T Consensus       164 ~g~vg~~~~q~a~~~G~~vi~~~~  187 (319)
T cd08242         164 DGKLGLLIAQVLALTGPDVVLVGR  187 (319)
T ss_pred             CCHHHHHHHHHHHHcCCeEEEEcC
Confidence            378999999999999999988765


No 354
>COG0794 GutQ Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane]
Probab=41.14  E-value=25  Score=24.41  Aligned_cols=24  Identities=4%  Similarity=-0.099  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||+.+|-+|.-+|.+++++.|.
T Consensus        51 G~Igkk~Aa~L~s~G~~a~fv~p~   74 (202)
T COG0794          51 GLIGKKFAARLASTGTPAFFVGPA   74 (202)
T ss_pred             HHHHHHHHHHHHccCCceEEecCc
Confidence            679999999999999999988754


No 355
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=41.12  E-value=28  Score=24.80  Aligned_cols=24  Identities=13%  Similarity=-0.076  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|++|++.++.
T Consensus       173 g~~g~~~~~la~~~g~~vi~~~~~  196 (334)
T PRK13771        173 GGVGIHAIQVAKALGAKVIAVTSS  196 (334)
T ss_pred             ccHHHHHHHHHHHcCCEEEEEeCC
Confidence            789999999999999999887653


No 356
>cd08293 PTGR2 Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acid
Probab=40.98  E-value=33  Score=24.61  Aligned_cols=24  Identities=8%  Similarity=-0.283  Sum_probs=21.0

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|+..++.++.+|+ +|++.++.
T Consensus       165 g~vG~~aiqlAk~~G~~~Vi~~~~s  189 (345)
T cd08293         165 GACGSLAGQIGRLLGCSRVVGICGS  189 (345)
T ss_pred             cHHHHHHHHHHHHcCCCEEEEEcCC
Confidence            7899999999999999 79887653


No 357
>cd08234 threonine_DH_like L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria),  and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=40.39  E-value=24  Score=25.18  Aligned_cols=24  Identities=4%  Similarity=-0.272  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.+|+.+++++++.|++ |++.++.
T Consensus       169 g~vg~~~~~la~~~G~~~v~~~~~~  193 (334)
T cd08234         169 GPIGLLLAQLLKLNGASRVTVAEPN  193 (334)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEECCC
Confidence            78999999999999998 7777653


No 358
>PLN00198 anthocyanidin reductase; Provisional
Probab=40.38  E-value=35  Score=24.65  Aligned_cols=24  Identities=4%  Similarity=-0.231  Sum_probs=20.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|-||+.+++.|..-|.+|.+..|
T Consensus        18 ~GfIG~~l~~~L~~~g~~V~~~~r   41 (338)
T PLN00198         18 TGFLASLLIKLLLQKGYAVNTTVR   41 (338)
T ss_pred             chHHHHHHHHHHHHCCCEEEEEEC
Confidence            378999999999999999876654


No 359
>PLN02740 Alcohol dehydrogenase-like
Probab=40.19  E-value=28  Score=25.74  Aligned_cols=24  Identities=4%  Similarity=-0.126  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.||...++.++.+|. +|++.|+.
T Consensus       208 G~vG~~a~q~ak~~G~~~Vi~~~~~  232 (381)
T PLN02740        208 GAVGLAVAEGARARGASKIIGVDIN  232 (381)
T ss_pred             CHHHHHHHHHHHHCCCCcEEEEcCC
Confidence            7899999999999999 59888754


No 360
>TIGR00060 L18_bact ribosomal protein L18, bacterial type. The archaeal and eukaryotic type rpL18 is not detectable under this model.
Probab=39.93  E-value=38  Score=21.33  Aligned_cols=23  Identities=9%  Similarity=-0.171  Sum_probs=20.5

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .+|..+|+++...|.+-+.|||-
T Consensus        70 ~vG~~la~ra~~~gi~~vvfDrg   92 (114)
T TIGR00060        70 KVGKLVAERLKEKGIKDVVFDRG   92 (114)
T ss_pred             HHHHHHHHHHHHCCCCEEEEeCC
Confidence            58999999999999988889974


No 361
>cd08241 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic
Probab=39.92  E-value=30  Score=24.07  Aligned_cols=24  Identities=8%  Similarity=-0.099  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|.+|+..++.
T Consensus       150 ~~~g~~~~~~a~~~g~~v~~~~~~  173 (323)
T cd08241         150 GGVGLAAVQLAKALGARVIAAASS  173 (323)
T ss_pred             chHHHHHHHHHHHhCCEEEEEeCC
Confidence            679999999999999999887653


No 362
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, 
Probab=39.82  E-value=25  Score=25.60  Aligned_cols=25  Identities=4%  Similarity=-0.096  Sum_probs=20.9

Q ss_pred             cchHHHHHHHHhhcC-CEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASI-MQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg-~~V~~~~r~~  108 (109)
                      |.||+.+++.++..| .+|+.+||..
T Consensus       187 G~iG~~~a~~L~~~g~~~V~v~~r~~  212 (311)
T cd05213         187 GEMGELAAKHLAAKGVAEITIANRTY  212 (311)
T ss_pred             HHHHHHHHHHHHHcCCCEEEEEeCCH
Confidence            689999999999876 4788898863


No 363
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts
Probab=39.82  E-value=29  Score=24.10  Aligned_cols=24  Identities=4%  Similarity=-0.108  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.+++.|.+|+..++.
T Consensus       155 ~~~g~~~~~~a~~~g~~v~~~~~~  178 (325)
T cd08253         155 GAVGHAAVQLARWAGARVIATASS  178 (325)
T ss_pred             chHHHHHHHHHHHcCCEEEEEeCC
Confidence            679999999999999999887663


No 364
>PF13380 CoA_binding_2:  CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A.
Probab=39.72  E-value=55  Score=20.24  Aligned_cols=25  Identities=4%  Similarity=-0.213  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ++.|..+.+.++..|.+|+.++|..
T Consensus        13 ~~~g~~v~~~l~~~G~~v~~Vnp~~   37 (116)
T PF13380_consen   13 GKFGYRVLRNLKAAGYEVYPVNPKG   37 (116)
T ss_dssp             TSHHHHHHHHHHHTT-EEEEESTTC
T ss_pred             CChHHHHHHHHHhCCCEEEEECCCc
Confidence            6789999999999999999998764


No 365
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=39.50  E-value=36  Score=25.76  Aligned_cols=25  Identities=8%  Similarity=-0.121  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|..|...++.|+..|.+|.++|..
T Consensus        14 ~G~sG~s~~~~l~~~G~~v~~~D~~   38 (438)
T PRK03806         14 LGLTGLSCVDFFLARGVTPRVIDTR   38 (438)
T ss_pred             eCHHHHHHHHHHHHCCCeEEEEcCC
Confidence            3789999999999999999999953


No 366
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=39.44  E-value=27  Score=25.48  Aligned_cols=24  Identities=0%  Similarity=-0.176  Sum_probs=20.9

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.+|...++.++.+|.+ |++.++.
T Consensus       186 g~vG~~a~~~ak~~G~~~Vi~~~~~  210 (358)
T TIGR03451       186 GGVGDAAIAGAALAGASKIIAVDID  210 (358)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEcCC
Confidence            78999999999999995 8888754


No 367
>PRK12549 shikimate 5-dehydrogenase; Reviewed
Probab=39.31  E-value=29  Score=25.01  Aligned_cols=25  Identities=8%  Similarity=-0.064  Sum_probs=22.2

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~~  108 (109)
                      |..|+.++..|...|+ +|..+||..
T Consensus       136 GGaaraia~aL~~~G~~~I~I~nR~~  161 (284)
T PRK12549        136 GGAGAAVAHALLTLGVERLTIFDVDP  161 (284)
T ss_pred             cHHHHHHHHHHHHcCCCEEEEECCCH
Confidence            6789999999999998 799999864


No 368
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=39.29  E-value=39  Score=25.52  Aligned_cols=26  Identities=0%  Similarity=-0.267  Sum_probs=22.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ..+-...+++.|...|.+|.+|||+.
T Consensus       331 r~sp~~~~~~~L~~~g~~v~~~DP~~  356 (411)
T TIGR03026       331 RESPALDIIELLKEKGAKVKAYDPLV  356 (411)
T ss_pred             ccChHHHHHHHHHhCCCEEEEECCCC
Confidence            34678899999999999999999974


No 369
>cd08246 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl-CoA reductase, a member of the medium chain dehydrogenase/reductase family, catalyzes the NADPH-dependent conversion of crotonyl-CoA to butyryl-CoA, a step in (2S)-methylmalonyl-CoA  production for straight-chain fatty acid biosynthesis.  Like enoyl reductase, another enzyme in fatty acid synthesis, crotonyl-CoA reductase is a member of the zinc-dependent alcohol dehydrogenase-like medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossma
Probab=39.24  E-value=28  Score=25.71  Aligned_cols=24  Identities=13%  Similarity=-0.168  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..++..++++|++|++.++.
T Consensus       204 g~iG~a~~~lak~~G~~vv~~~~s  227 (393)
T cd08246         204 GGLGSMAIQLARAAGANPVAVVSS  227 (393)
T ss_pred             cHHHHHHHHHHHHcCCeEEEEeCC
Confidence            789999999999999998887653


No 370
>PLN02586 probable cinnamyl alcohol dehydrogenase
Probab=39.21  E-value=38  Score=24.89  Aligned_cols=23  Identities=4%  Similarity=-0.178  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.||...++.++.+|.+|++.+.
T Consensus       193 G~vG~~avq~Ak~~Ga~vi~~~~  215 (360)
T PLN02586        193 GGLGHVAVKIGKAFGLKVTVISS  215 (360)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeC
Confidence            78999999999999999887654


No 371
>cd08252 AL_MDR Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, whil
Probab=39.12  E-value=35  Score=24.28  Aligned_cols=25  Identities=4%  Similarity=-0.059  Sum_probs=21.8

Q ss_pred             ccchHHHHHHHHhhcC-CEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASI-MQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg-~~V~~~~r~  107 (109)
                      .|.+|+.+++.++..| ++|++.++.
T Consensus       159 ~g~vg~~~~~~a~~~G~~~v~~~~~~  184 (336)
T cd08252         159 AGGVGSIAIQLAKQLTGLTVIATASR  184 (336)
T ss_pred             CchHHHHHHHHHHHcCCcEEEEEcCC
Confidence            3789999999999999 999988653


No 372
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]
Probab=38.87  E-value=43  Score=22.76  Aligned_cols=24  Identities=4%  Similarity=-0.100  Sum_probs=20.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.||+++|+.+..-|.+|++..+.
T Consensus        15 ~GiG~aia~~l~~~G~~v~~~~~~   38 (251)
T COG1028          15 SGIGRAIARALAREGARVVVAARR   38 (251)
T ss_pred             CHHHHHHHHHHHHCCCeEEEEcCC
Confidence            369999999999999997776554


No 373
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=38.86  E-value=32  Score=24.02  Aligned_cols=23  Identities=9%  Similarity=-0.123  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++..|++|+..++
T Consensus       153 g~~g~~~~~~a~~~g~~v~~~~~  175 (320)
T cd08243         153 SSVGLAALKLAKALGATVTATTR  175 (320)
T ss_pred             ChHHHHHHHHHHHcCCEEEEEeC
Confidence            78999999999999999987754


No 374
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=38.78  E-value=31  Score=25.04  Aligned_cols=24  Identities=4%  Similarity=-0.159  Sum_probs=20.9

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|...++.++..|+ +|++.++.
T Consensus       179 G~vG~~aiqlak~~G~~~Vi~~~~~  203 (343)
T PRK09880        179 GPIGCLIVAAVKTLGAAEIVCADVS  203 (343)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEEeCC
Confidence            7899999999999999 58887754


No 375
>PF08004 DUF1699:  Protein of unknown function (DUF1699);  InterPro: IPR012546 This family contains many archaeal proteins which have very conserved sequences.
Probab=38.70  E-value=11  Score=24.28  Aligned_cols=32  Identities=22%  Similarity=0.103  Sum_probs=20.4

Q ss_pred             CCCCceEEEecCccCCcccH---HHHhhcCcEEEe
Q psy15800          5 AGENLKVISTFSVGHDHLHL---DQIKSRGIRVGT   36 (109)
Q Consensus         5 ~~p~Lk~i~~~~~G~d~id~---~~~~~~gi~v~n   36 (109)
                      .||+||.||++++=+..+--   -.+.-.||.+.-
T Consensus        39 ~CP~lk~iqiP~SY~~t~Sksi~mfL~mqgI~Lle   73 (131)
T PF08004_consen   39 RCPNLKAIQIPPSYYKTLSKSIKMFLEMQGIELLE   73 (131)
T ss_pred             hCCCCeEEeCChHHHHHHhHHHHHHHHhcCceeec
Confidence            68999999998876655431   123345666643


No 376
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed
Probab=38.66  E-value=33  Score=24.38  Aligned_cols=25  Identities=12%  Similarity=-0.104  Sum_probs=19.9

Q ss_pred             ccchHHHHHHHHhhcC----CEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASI----MQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg----~~V~~~~r~  107 (109)
                      .|++|..+++.+..-|    -+|+++||.
T Consensus        11 ~G~mG~aia~~l~~~g~~~~~~v~v~~r~   39 (279)
T PRK07679         11 AGSIAEAIIGGLLHANVVKGEQITVSNRS   39 (279)
T ss_pred             ccHHHHHHHHHHHHCCCCCcceEEEECCC
Confidence            5888999999887665    578888875


No 377
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family. This model represents a subfamily of pfam00107 as defined by Pfam, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc. This subfamily includes proteins studied crystallographically for insight into function: YhdH from Escherichia coli and YhfP from Bacillus subtilis. Members bind NADPH or NAD, but not zinc.
Probab=38.49  E-value=33  Score=24.27  Aligned_cols=23  Identities=13%  Similarity=-0.161  Sum_probs=20.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++.+|++|++.+.
T Consensus       156 g~vg~~~~~la~~~G~~vi~~~~  178 (323)
T TIGR02823       156 GGVGSLAVAILSKLGYEVVASTG  178 (323)
T ss_pred             cHHHHHHHHHHHHcCCeEEEEeC
Confidence            78999999999999999887643


No 378
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme.   Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well a
Probab=38.08  E-value=43  Score=22.31  Aligned_cols=24  Identities=4%  Similarity=-0.083  Sum_probs=21.0

Q ss_pred             cc-hHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQ-SDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~-IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |. +|+.+++.|...|.+|...+|+
T Consensus        53 G~~~G~~~a~~L~~~g~~V~v~~r~   77 (168)
T cd01080          53 SNIVGKPLAALLLNRNATVTVCHSK   77 (168)
T ss_pred             cHHHHHHHHHHHhhCCCEEEEEECC
Confidence            66 4899999999999999988875


No 379
>cd05282 ETR_like 2-enoyl thioester reductase-like. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossman
Probab=37.76  E-value=37  Score=23.92  Aligned_cols=23  Identities=4%  Similarity=-0.187  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.+++.|.+|++..+
T Consensus       149 ~~vg~~~~~~a~~~g~~v~~~~~  171 (323)
T cd05282         149 SAVGRMLIQLAKLLGFKTINVVR  171 (323)
T ss_pred             cHHHHHHHHHHHHCCCeEEEEec
Confidence            67999999999999999987654


No 380
>cd05288 PGDH Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino 
Probab=37.67  E-value=39  Score=23.94  Aligned_cols=24  Identities=8%  Similarity=-0.249  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|.+|++.++.
T Consensus       156 g~ig~~~~~~a~~~G~~vi~~~~~  179 (329)
T cd05288         156 GAVGSVVGQIAKLLGARVVGIAGS  179 (329)
T ss_pred             chHHHHHHHHHHHcCCEEEEEeCC
Confidence            689999999999999999988653


No 381
>PRK12746 short chain dehydrogenase; Provisional
Probab=37.58  E-value=42  Score=22.84  Aligned_cols=22  Identities=5%  Similarity=-0.170  Sum_probs=19.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~  104 (109)
                      .|.||..+++.+...|.+|+..
T Consensus        15 sg~iG~~la~~l~~~G~~v~i~   36 (254)
T PRK12746         15 SRGIGRAIAMRLANDGALVAIH   36 (254)
T ss_pred             CchHHHHHHHHHHHCCCEEEEE
Confidence            4789999999999999998764


No 382
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydro
Probab=37.40  E-value=43  Score=22.67  Aligned_cols=23  Identities=9%  Similarity=-0.091  Sum_probs=20.5

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .+|+.+++.++..|.+|++.++.
T Consensus       145 ~~G~~~~~~a~~~g~~v~~~~~~  167 (271)
T cd05188         145 GVGLLAAQLAKAAGARVIVTDRS  167 (271)
T ss_pred             HHHHHHHHHHHHcCCeEEEEcCC
Confidence            39999999999999999988764


No 383
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E. coli subfamily. Members of the HesA/MoeB/ThiF family of proteins (pfam00899) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees, with the Escherichia. coli ThiF and the E. coli MoeB proteins seemingly more closely related than E. coli ThiF and Campylobacter (for example) ThiF. This model represents the more widely distributed clade of ThiF proteins such found in E. coli.
Probab=37.39  E-value=40  Score=22.93  Aligned_cols=24  Identities=4%  Similarity=-0.172  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|.++++.|...|. ++..+|+.
T Consensus        30 GglGs~ia~~La~~Gv~~i~lvD~d   54 (202)
T TIGR02356        30 GGLGSPAALYLAGAGVGTIVIVDDD   54 (202)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEecCC
Confidence            7899999999999998 79888864


No 384
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated
Probab=37.38  E-value=34  Score=27.62  Aligned_cols=25  Identities=12%  Similarity=-0.116  Sum_probs=21.6

Q ss_pred             ccchHHHHHHHHhhc-CCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLAS-IMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~f-g~~V~~~~r~  107 (109)
                      .|-||+.+++.|..- |.+|+++||.
T Consensus       324 tGFIGs~Lv~~Ll~~~g~~V~~l~r~  349 (660)
T PRK08125        324 NGFIGNHLTERLLRDDNYEVYGLDIG  349 (660)
T ss_pred             CchHHHHHHHHHHhCCCcEEEEEeCC
Confidence            378999999999874 7999999874


No 385
>KOG1014|consensus
Probab=37.20  E-value=41  Score=24.98  Aligned_cols=25  Identities=4%  Similarity=-0.085  Sum_probs=22.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ..||++.|+.|.--|++|+..+|+.
T Consensus        59 DGIGKayA~eLAkrG~nvvLIsRt~   83 (312)
T KOG1014|consen   59 DGIGKAYARELAKRGFNVVLISRTQ   83 (312)
T ss_pred             CcchHHHHHHHHHcCCEEEEEeCCH
Confidence            3799999999999999999988864


No 386
>cd08251 polyketide_synthase polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde a
Probab=37.11  E-value=44  Score=23.04  Aligned_cols=25  Identities=4%  Similarity=-0.149  Sum_probs=21.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|+.++++++++|++|++.++.
T Consensus       130 ~~~~g~~~~~~a~~~g~~v~~~~~~  154 (303)
T cd08251         130 TGGTGLMAVQLARLKGAEIYATASS  154 (303)
T ss_pred             CcHHHHHHHHHHHHcCCEEEEEcCC
Confidence            3689999999999999999887653


No 387
>PTZ00032 60S ribosomal protein L18; Provisional
Probab=37.00  E-value=41  Score=23.50  Aligned_cols=23  Identities=9%  Similarity=-0.086  Sum_probs=21.0

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .+|+.+|+++..-|.+=++|||.
T Consensus       167 ~VGk~IAerAl~kGI~kVvFDRg  189 (211)
T PTZ00032        167 ELGKLIGRKALSKGISKVRFDRA  189 (211)
T ss_pred             HHHHHHHHHHHHCCCCEEEEeCC
Confidence            58999999999999998899985


No 388
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenases of the medium chain dehydrogenase family. However, this subgroup does not contain the characteristic catalytic zinc site. Also, it contains an atypical structural zinc-binding pattern: DxxCxxCxxxxxxxC. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the clo
Probab=36.85  E-value=40  Score=23.93  Aligned_cols=23  Identities=4%  Similarity=-0.127  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.+++.|.+|++.++
T Consensus       173 g~vg~~~~~~a~~~G~~v~~~~~  195 (325)
T cd08264         173 GNTGIFAVQLAKMMGAEVIAVSR  195 (325)
T ss_pred             chHHHHHHHHHHHcCCeEEEEeH
Confidence            78999999999999999988653


No 389
>TIGR01751 crot-CoA-red crotonyl-CoA reductase. The enzyme modelled by this alignment is responsible for the conversion of crotonyl-CoA reductase to butyryl-CoA. In serine cycle methylotrophic bacteria this enzyme is involved in the process of acetyl-CoA to glyoxylate. In other bacteria the enzyme is used to produce butyrate for incorporation into polyketides such as tylosin from Streptomyces fradiae and coronatine from Pseudomonas syringae.
Probab=36.68  E-value=33  Score=25.54  Aligned_cols=23  Identities=17%  Similarity=-0.142  Sum_probs=20.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++++|++|++.++
T Consensus       200 g~vG~~ai~~ak~~G~~vi~~~~  222 (398)
T TIGR01751       200 GGLGSYATQLARAGGGNPVAVVS  222 (398)
T ss_pred             cHHHHHHHHHHHHcCCeEEEEcC
Confidence            78999999999999999887764


No 390
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members. Includes Human Mgc45594 gene product of undetermined function. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=36.67  E-value=36  Score=24.17  Aligned_cols=24  Identities=4%  Similarity=-0.132  Sum_probs=21.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++.+|.+|+..++.
T Consensus       150 g~ig~~~~~~a~~~g~~v~~~~~~  173 (329)
T cd08250         150 GGTGQFAVQLAKLAGCHVIGTCSS  173 (329)
T ss_pred             cHHHHHHHHHHHHcCCeEEEEeCc
Confidence            679999999999999999887653


No 391
>PF02579 Nitro_FeMo-Co:  Dinitrogenase iron-molybdenum cofactor;  InterPro: IPR003731 This entry represents several Nif (B, X and Y) proteins, which are involved in the biosynthesis of the iron-molybdenum cofactor (FeMo-co) found in the dinitrogenase enzyme of the nitrogenase complex in nitrogen-fixing bacteria. The nitrogenase complex catalyses the reduction of atmospheric dinitrogen to ammonia, and is composed of an iron metalloprotein (dinitrogenase reductase; homodimer of NifH; IPR000392 from INTERPRO) and a Fe-Mo metalloprotein (dinitrogenase; heterotetramer of NifD and NifK; IPR000318 from INTERPRO). The pathway for the synthesis of the Fe-Mo cofactor involves several proteins, including NifB, NifE, NifH, NifN, NifQ, NifV and NifX. NifB appears to be an iron-sulphur source for FeMo-co biosynthesis, while NifX may be associated with the mature FeMo-co, in particular with the addition of homocitrate during the last step of biosynthesis []. The NifX protein shows sequence similarity with the C terminus of NifB [], as well as to the conserved protein MTH1175 from the archaeon Methanobacterium thermoautotrophicum, which displays a ribonuclease H-like motif of three layers, alpha/beta/alpha, with a single mixed beta-sheet [].; PDB: 2QTD_A 2KLA_A 1EO1_A 1P90_A 1RDU_A 2YX6_D 1O13_A 1T3V_A 2RE2_B 2WFB_A.
Probab=36.43  E-value=39  Score=19.45  Aligned_cols=22  Identities=0%  Similarity=-0.153  Sum_probs=20.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~  104 (109)
                      .|.||....+.|+..|.+|+..
T Consensus        59 ~~~iG~~~~~~L~~~gI~v~~~   80 (94)
T PF02579_consen   59 CGGIGEGAFRALKEAGIKVYQG   80 (94)
T ss_dssp             ESCSCHHHHHHHHHTTSEEEES
T ss_pred             EeCCCHHHHHHHHHCCCEEEEc
Confidence            3899999999999999999875


No 392
>cd05286 QOR2 Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone 
Probab=36.37  E-value=36  Score=23.54  Aligned_cols=25  Identities=12%  Similarity=-0.161  Sum_probs=21.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|+..++.++++|.+|+..++.
T Consensus       146 ~g~~g~~~~~~a~~~g~~v~~~~~~  170 (320)
T cd05286         146 AGGVGLLLTQWAKALGATVIGTVSS  170 (320)
T ss_pred             CchHHHHHHHHHHHcCCEEEEEcCC
Confidence            3679999999999999999887653


No 393
>PF07287 DUF1446:  Protein of unknown function (DUF1446);  InterPro: IPR010839 This family consists of several bacterial and plant proteins of around 400 residues in length. The function of this family is unknown.
Probab=36.19  E-value=45  Score=25.25  Aligned_cols=32  Identities=22%  Similarity=0.343  Sum_probs=24.3

Q ss_pred             HHHHhhcCcEE-EecCCCCccchHHHHHHHHHH
Q psy15800         24 LDQIKSRGIRV-GTVGPVSSDAVAEFNIGLAIA   55 (109)
Q Consensus        24 ~~~~~~~gi~v-~n~~g~~~~~vAE~~l~~~L~   55 (109)
                      ++++.++||+| +|..|.++...+|-+.-+.-.
T Consensus        64 L~~~~~~gIkvI~NaGg~np~~~a~~v~eia~e   96 (362)
T PF07287_consen   64 LPAAAEKGIKVITNAGGLNPAGCADIVREIARE   96 (362)
T ss_pred             HHHHHhCCCCEEEeCCCCCHHHHHHHHHHHHHh
Confidence            56788999976 788888888877776665544


No 394
>PRK13302 putative L-aspartate dehydrogenase; Provisional
Probab=35.89  E-value=32  Score=24.68  Aligned_cols=25  Identities=8%  Similarity=-0.121  Sum_probs=19.9

Q ss_pred             ccchHHHHHHHHhh--cCCEEE-EEccc
Q psy15800         83 ITQSDTNHTQRCLA--SIMQLV-YSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~--fg~~V~-~~~r~  107 (109)
                      .|+||+.+++.+..  .+++|. .+||.
T Consensus        14 ~G~IG~~~a~~L~~~~~~~el~aV~dr~   41 (271)
T PRK13302         14 LGAIGKAIAQALDRGLPGLTLSAVAVRD   41 (271)
T ss_pred             ccHHHHHHHHHHHhcCCCeEEEEEECCC
Confidence            48999999999985  588887 55764


No 395
>PLN02948 phosphoribosylaminoimidazole carboxylase
Probab=35.61  E-value=45  Score=26.72  Aligned_cols=25  Identities=8%  Similarity=-0.158  Sum_probs=22.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |+.|+.++..++.+|.+|+.+|+.+
T Consensus        31 Gqlg~mla~aA~~lG~~Vi~ld~~~   55 (577)
T PLN02948         31 GQLGRMLCQAASQMGIKVKVLDPLE   55 (577)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEeCCC
Confidence            6899999999999999999998754


No 396
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=35.54  E-value=54  Score=22.18  Aligned_cols=23  Identities=9%  Similarity=-0.158  Sum_probs=19.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|.||+.+++.+..-|.+|+...
T Consensus        15 sg~iG~~l~~~l~~~g~~v~~~~   37 (252)
T PRK06077         15 GRGIGRAIAVRLAKEGSLVVVNA   37 (252)
T ss_pred             CChHHHHHHHHHHHCCCEEEEEe
Confidence            47899999999999999987644


No 397
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ i
Probab=35.40  E-value=44  Score=24.50  Aligned_cols=24  Identities=0%  Similarity=-0.172  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|...++.++.+|. +|++.++.
T Consensus       194 g~vG~~~~~~a~~~G~~~Vi~~~~~  218 (365)
T cd08277         194 GAVGLSAIMGAKIAGASRIIGVDIN  218 (365)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEeCC
Confidence            7899999999999999 68888754


No 398
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family. This group contains proteins related to the zinc-dependent  alcohol dehydrogenases. However, while the group has structural zinc site characteristic of these enzymes, it lacks the consensus site for a catalytic zinc. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone
Probab=35.35  E-value=49  Score=23.24  Aligned_cols=24  Identities=4%  Similarity=-0.139  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +.+|+.+++.+++.|.+|+..++.
T Consensus       177 ~~iG~~~~~~~~~~g~~v~~~~~~  200 (342)
T cd08266         177 SGVGSAAIQIAKLFGATVIATAGS  200 (342)
T ss_pred             chHHHHHHHHHHHcCCEEEEEeCC
Confidence            479999999999999999887654


No 399
>KOG1201|consensus
Probab=35.22  E-value=49  Score=24.46  Aligned_cols=25  Identities=12%  Similarity=-0.133  Sum_probs=22.2

Q ss_pred             chHHHHHHHHhhcCCEEEEEccccC
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYNQ  109 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~~  109 (109)
                      .+|+++|.-+...|++++.||...|
T Consensus        49 GlGr~ialefa~rg~~~vl~Din~~   73 (300)
T KOG1201|consen   49 GLGRLIALEFAKRGAKLVLWDINKQ   73 (300)
T ss_pred             hHHHHHHHHHHHhCCeEEEEecccc
Confidence            5999999999999999999997653


No 400
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group contains members identified as zinc dependent alcohol dehydrogenases (ADH), and class III ADG (aka formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  Class III ADH are also know as glutathione-dependent formaldehyde dehyd
Probab=35.03  E-value=34  Score=25.17  Aligned_cols=24  Identities=13%  Similarity=-0.076  Sum_probs=21.0

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.||...++.++..|+ +|++.++.
T Consensus       201 G~vG~~a~~lak~~G~~~Vi~~~~~  225 (371)
T cd08281         201 GGVGLSALLGAVAAGASQVVAVDLN  225 (371)
T ss_pred             CHHHHHHHHHHHHcCCCcEEEEcCC
Confidence            7899999999999999 58888754


No 401
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase.
Probab=35.01  E-value=35  Score=24.47  Aligned_cols=23  Identities=4%  Similarity=-0.321  Sum_probs=19.4

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r  106 (109)
                      |.||...++.++.+|++ |++.|+
T Consensus       154 G~vG~~a~q~ak~~G~~~v~~~~~  177 (308)
T TIGR01202       154 GTLGRLLARLTKAAGGSPPAVWET  177 (308)
T ss_pred             CHHHHHHHHHHHHcCCceEEEeCC
Confidence            78999999999999998 555554


No 402
>PRK08219 short chain dehydrogenase; Provisional
Probab=35.00  E-value=30  Score=22.99  Aligned_cols=24  Identities=4%  Similarity=-0.087  Sum_probs=20.3

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.||+.+++.|..- .+|+..+|.
T Consensus        12 ~g~iG~~l~~~l~~~-~~V~~~~r~   35 (227)
T PRK08219         12 SRGIGAAIARELAPT-HTLLLGGRP   35 (227)
T ss_pred             CcHHHHHHHHHHHhh-CCEEEEeCC
Confidence            478999999998866 889998875


No 403
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group has the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (ty
Probab=34.96  E-value=40  Score=24.25  Aligned_cols=25  Identities=4%  Similarity=-0.209  Sum_probs=21.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|+.+++.++.+|++|++.++.
T Consensus       174 ~g~vg~~~~~~a~~~G~~vi~~~~~  198 (345)
T cd08260         174 CGGVGLSAVMIASALGARVIAVDID  198 (345)
T ss_pred             CCHHHHHHHHHHHHcCCeEEEEeCC
Confidence            4789999999999999999887653


No 404
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). While some current members of this family carry designations as putative alginate lyase, it seems no sequence with a direct characterization as such is detected by this model.
Probab=34.76  E-value=40  Score=24.00  Aligned_cols=23  Identities=4%  Similarity=-0.100  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhc-CCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLAS-IMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~f-g~~V~~~~r  106 (109)
                      |.+|+..+++++.+ |++|++.++
T Consensus       159 g~vg~~~~~~ak~~~G~~vi~~~~  182 (336)
T TIGR02817       159 GGVGSILIQLARQLTGLTVIATAS  182 (336)
T ss_pred             cHHHHHHHHHHHHhCCCEEEEEcC
Confidence            78999999999998 999988754


No 405
>PLN02986 cinnamyl-alcohol dehydrogenase family protein
Probab=34.39  E-value=52  Score=23.52  Aligned_cols=26  Identities=4%  Similarity=-0.254  Sum_probs=21.2

Q ss_pred             hhccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         81 ELITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        81 ~l~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .-.|-||+.+++.|..-|.+|.+..|
T Consensus        12 GatG~iG~~l~~~L~~~g~~V~~~~r   37 (322)
T PLN02986         12 GASGYIASWIVKLLLLRGYTVKATVR   37 (322)
T ss_pred             CCCcHHHHHHHHHHHHCCCEEEEEEC
Confidence            33578999999999988999986544


No 406
>PLN02686 cinnamoyl-CoA reductase
Probab=34.07  E-value=45  Score=24.70  Aligned_cols=23  Identities=9%  Similarity=-0.100  Sum_probs=20.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |-||+.+++.|..-|.+|.+..+
T Consensus        63 GfIG~~lv~~L~~~G~~V~~~~r   85 (367)
T PLN02686         63 SFLGLAIVDRLLRHGYSVRIAVD   85 (367)
T ss_pred             hHHHHHHHHHHHHCCCEEEEEeC
Confidence            67999999999999999987544


No 407
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=34.05  E-value=40  Score=23.52  Aligned_cols=24  Identities=13%  Similarity=-0.046  Sum_probs=21.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.+++.|.+|+..++.
T Consensus       155 ~~~g~~~~~~~~~~g~~v~~~~~~  178 (328)
T cd08268         155 SSVGLAAIQIANAAGATVIATTRT  178 (328)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEcCC
Confidence            689999999999999999887654


No 408
>PLN02514 cinnamyl-alcohol dehydrogenase
Probab=33.81  E-value=42  Score=24.61  Aligned_cols=23  Identities=4%  Similarity=-0.178  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|...++.++..|.+|+..++
T Consensus       190 G~vG~~av~~Ak~~G~~vi~~~~  212 (357)
T PLN02514        190 GGVGHMGVKIAKAMGHHVTVISS  212 (357)
T ss_pred             cHHHHHHHHHHHHCCCeEEEEeC
Confidence            78999999999999999887764


No 409
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase
Probab=33.80  E-value=37  Score=26.86  Aligned_cols=24  Identities=4%  Similarity=-0.112  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|++++..|...|++|+.++|.
T Consensus       388 GGagrAia~~L~~~G~~V~i~nR~  411 (529)
T PLN02520        388 GGAGKALAYGAKEKGARVVIANRT  411 (529)
T ss_pred             cHHHHHHHHHHHHCCCEEEEEcCC
Confidence            679999999999999999999885


No 410
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MD
Probab=33.69  E-value=34  Score=23.64  Aligned_cols=24  Identities=13%  Similarity=-0.206  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.+|..+++.++.+|.+ |++.++.
T Consensus       107 g~vg~~~i~~a~~~g~~~vi~~~~~  131 (277)
T cd08255         107 GLVGLLAAQLAKAAGAREVVGVDPD  131 (277)
T ss_pred             CHHHHHHHHHHHHcCCCcEEEECCC
Confidence            78999999999999999 8887753


No 411
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=33.66  E-value=51  Score=23.01  Aligned_cols=23  Identities=13%  Similarity=-0.185  Sum_probs=20.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++..|++|+..++
T Consensus       154 g~~g~~~~~la~~~g~~v~~~~~  176 (319)
T cd08267         154 GGVGTFAVQIAKALGAHVTGVCS  176 (319)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEeC
Confidence            67999999999999999987653


No 412
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH). Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent.  PFDH converts 2 molecules of aldehydes to corresponding carboxylic acid and alcohol.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins).  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fo
Probab=33.48  E-value=39  Score=24.87  Aligned_cols=24  Identities=0%  Similarity=-0.183  Sum_probs=20.9

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|..+++.++++|. +|++.|+.
T Consensus       186 g~vg~~~~~~a~~~G~~~vi~~~~~  210 (375)
T cd08282         186 GPVGLMAAYSAILRGASRVYVVDHV  210 (375)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEECCC
Confidence            7899999999999997 78887653


No 413
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=33.26  E-value=43  Score=22.72  Aligned_cols=25  Identities=4%  Similarity=-0.191  Sum_probs=21.4

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|+.+++.++++|.+|+..++.
T Consensus       114 ~~~~g~~~~~~a~~~g~~v~~~~~~  138 (288)
T smart00829      114 AGGVGQAAIQLAQHLGAEVFATAGS  138 (288)
T ss_pred             CcHHHHHHHHHHHHcCCEEEEEeCC
Confidence            3789999999999999999887653


No 414
>PF03686 UPF0146:  Uncharacterised protein family (UPF0146);  InterPro: IPR005353 The function of this family of proteins is unknown.; PDB: 2K4M_A.
Probab=33.19  E-value=49  Score=21.32  Aligned_cols=20  Identities=0%  Similarity=-0.019  Sum_probs=15.1

Q ss_pred             HHHHHHhhcCCEEEEEcccc
Q psy15800         89 NHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        89 ~va~~~~~fg~~V~~~~r~~  108 (109)
                      .+|+.|+..|++|++.|-..
T Consensus        27 ~vA~~L~~~G~dV~~tDi~~   46 (127)
T PF03686_consen   27 EVAKKLKERGFDVIATDINP   46 (127)
T ss_dssp             HHHHHHHHHS-EEEEE-SS-
T ss_pred             HHHHHHHHcCCcEEEEECcc
Confidence            58999999999999998653


No 415
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional
Probab=33.11  E-value=41  Score=25.85  Aligned_cols=25  Identities=8%  Similarity=-0.185  Sum_probs=21.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .|.+|..+|..+.. +.+|++||+..
T Consensus        14 lGyvGlpmA~~la~-~~~V~g~D~~~   38 (425)
T PRK15182         14 LGYVGLPLAVEFGK-SRQVVGFDVNK   38 (425)
T ss_pred             cCcchHHHHHHHhc-CCEEEEEeCCH
Confidence            48999999999876 79999999864


No 416
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  This group includes alcohol dehydrogenases corresponding to mammalian classes I, II, IV. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology  to GroES.  These proteins typically form dimers (typically
Probab=32.82  E-value=41  Score=24.86  Aligned_cols=24  Identities=8%  Similarity=0.039  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|..+++.++..|. +|++.++.
T Consensus       200 g~vG~~~~~~a~~~G~~~Vi~~~~~  224 (373)
T cd08299         200 GGVGLSAIMGCKAAGASRIIAVDIN  224 (373)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEcCC
Confidence            7899999999999999 79988764


No 417
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentatio
Probab=32.69  E-value=42  Score=23.81  Aligned_cols=24  Identities=13%  Similarity=-0.130  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.++++++.+|.+|++.++.
T Consensus       175 g~vG~~~~~la~~~G~~V~~~~~s  198 (338)
T cd08254         175 GGLGLNAVQIAKAMGAAVIAVDIK  198 (338)
T ss_pred             cHHHHHHHHHHHHcCCEEEEEcCC
Confidence            679999999999999999887653


No 418
>PTZ00354 alcohol dehydrogenase; Provisional
Probab=32.59  E-value=45  Score=23.55  Aligned_cols=23  Identities=13%  Similarity=-0.036  Sum_probs=20.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++..|++|+..++
T Consensus       151 g~~g~~~~~~a~~~g~~v~~~~~  173 (334)
T PTZ00354        151 SGVGTAAAQLAEKYGAATIITTS  173 (334)
T ss_pred             chHHHHHHHHHHHcCCEEEEEeC
Confidence            68999999999999999876654


No 419
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2. Members of the HesA/MoeB/ThiF family of proteins (pfam00899) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees, with one the E. coli ThiF and the E. coli MoeB proteins seemingly more closely related than E. coli ThiF and Campylobacter (for example) ThiF. This model represents the divergent clade of putative ThiF proteins such found in Campylobacter.
Probab=32.43  E-value=58  Score=22.23  Aligned_cols=24  Identities=8%  Similarity=-0.025  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|..+|..|...|. +|+.+|+.
T Consensus        30 GglGs~ia~~La~~Gvg~i~lvD~D   54 (200)
T TIGR02354        30 GGLGSNVAINLARAGIGKLILVDFD   54 (200)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEECCC
Confidence            7899999999999999 69999875


No 420
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional
Probab=32.27  E-value=56  Score=24.79  Aligned_cols=27  Identities=11%  Similarity=-0.041  Sum_probs=23.3

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      +..+-...+++.|..-|.+|.+|||..
T Consensus       313 ~R~Sp~~~i~~~L~~~G~~v~~~DP~~  339 (388)
T PRK15057        313 FRASSIQGIMKRIKAKGVEVIIYEPVM  339 (388)
T ss_pred             cccChHHHHHHHHHhCCCEEEEECCCC
Confidence            334678999999999999999999974


No 421
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional
Probab=32.24  E-value=50  Score=27.40  Aligned_cols=25  Identities=12%  Similarity=-0.101  Sum_probs=22.2

Q ss_pred             ccchHHHH-HHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNH-TQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~v-a~~~~~fg~~V~~~~r~  107 (109)
                      .|.+|... |+.|+..|.+|.++|..
T Consensus        12 ~G~sG~salA~~L~~~G~~V~~sD~~   37 (809)
T PRK14573         12 IGGIGMSALAHILLDRGYSVSGSDLS   37 (809)
T ss_pred             ecHHhHHHHHHHHHHCCCeEEEECCC
Confidence            47899997 99999999999999953


No 422
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family. Members of this family are putative quinone oxidoreductases that belong to the broader superfamily (modeled by Pfam pfam00107) of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxiooreductases. The alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, and members are likely to be quinone oxidoreductases instead. A member of this family in Homo sapiens, PIG3, is induced by p53 but is otherwise uncharacterized.
Probab=32.13  E-value=46  Score=23.13  Aligned_cols=24  Identities=13%  Similarity=-0.089  Sum_probs=21.0

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|.+|+..++.
T Consensus       150 ~~~g~~~~~~a~~~g~~v~~~~~~  173 (325)
T TIGR02824       150 SGIGTTAIQLAKAFGARVFTTAGS  173 (325)
T ss_pred             chHHHHHHHHHHHcCCEEEEEeCC
Confidence            679999999999999999887653


No 423
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Probab=32.11  E-value=69  Score=23.64  Aligned_cols=24  Identities=4%  Similarity=-0.103  Sum_probs=21.2

Q ss_pred             chHHHHHHHHhhcCCEEEEEcccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .+|+.+|.+|..-|.+|..|++..
T Consensus       170 ivG~PmA~~L~~~gatVtv~~~~t  193 (301)
T PRK14194        170 IVGKPMAALLLQAHCSVTVVHSRS  193 (301)
T ss_pred             ccHHHHHHHHHHCCCEEEEECCCC
Confidence            579999999999999999997653


No 424
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=31.82  E-value=64  Score=21.85  Aligned_cols=22  Identities=5%  Similarity=-0.204  Sum_probs=18.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEE
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYS  104 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~  104 (109)
                      .|.||+.+++.+..-|++|+..
T Consensus        11 s~giG~~la~~l~~~g~~v~~~   32 (248)
T PRK06947         11 SRGIGRATAVLAAARGWSVGIN   32 (248)
T ss_pred             CCcHHHHHHHHHHHCCCEEEEE
Confidence            4789999999999899998754


No 425
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of  a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1).
Probab=31.50  E-value=59  Score=22.46  Aligned_cols=23  Identities=9%  Similarity=-0.112  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r  106 (109)
                      |.+|.++|+.|...|. ++..+|+
T Consensus        30 GglGs~va~~La~~Gvg~i~lvD~   53 (228)
T cd00757          30 GGLGSPAAEYLAAAGVGKLGLVDD   53 (228)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEEcC
Confidence            7899999999999998 7888875


No 426
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.
Probab=31.32  E-value=46  Score=24.04  Aligned_cols=24  Identities=8%  Similarity=-0.168  Sum_probs=20.8

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|+..++.++.+|+ +|++.++.
T Consensus       182 g~vG~~a~q~a~~~G~~~v~~~~~~  206 (351)
T cd08233         182 GPIGLLTILALKAAGASKIIVSEPS  206 (351)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEECCC
Confidence            7899999999999999 78887653


No 427
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking  and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=31.06  E-value=61  Score=23.21  Aligned_cols=23  Identities=13%  Similarity=-0.171  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.+++.|++|++.++
T Consensus       173 g~ig~~~~~~a~~~G~~v~~~~~  195 (350)
T cd08248         173 GGVGTFAIQLLKAWGAHVTTTCS  195 (350)
T ss_pred             ChHHHHHHHHHHHCCCeEEEEeC
Confidence            78999999999999999887653


No 428
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase,
Probab=30.98  E-value=46  Score=23.85  Aligned_cols=23  Identities=9%  Similarity=-0.101  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.++++++.+|.+|++..+
T Consensus       169 g~vG~~a~~lA~~~g~~v~~~~~  191 (337)
T cd08261         169 GPIGLGVIQVAKARGARVIVVDI  191 (337)
T ss_pred             CHHHHHHHHHHHHcCCeEEEECC
Confidence            67999999999999999987754


No 429
>KOG1208|consensus
Probab=30.60  E-value=54  Score=24.19  Aligned_cols=23  Identities=4%  Similarity=-0.109  Sum_probs=20.9

Q ss_pred             chHHHHHHHHhhcCCEEEEEccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .||+++|+.|..-|++|+...|.
T Consensus        46 GIG~eta~~La~~Ga~Vv~~~R~   68 (314)
T KOG1208|consen   46 GIGFETARELALRGAHVVLACRN   68 (314)
T ss_pred             chHHHHHHHHHhCCCEEEEEeCC
Confidence            69999999999999999988765


No 430
>PF00185 OTCace:  Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain;  InterPro: IPR006131 This family contains two related enzymes:  Aspartate carbamoyltransferase (2.1.3.2 from EC) (ATCase) catalyzes the conversion of aspartate and carbamoyl phosphate to carbamoylaspartate, the second step in the de novo biosynthesis of pyrimidine nucleotides []. In prokaryotes ATCase consists of two subunits: a catalytic chain (gene pyrB) and a regulatory chain (gene pyrI), while in eukaryotes it is a domain in a multi- functional enzyme (called URA2 in yeast, rudimentary in Drosophila, and CAD in mammals []) that also catalyzes other steps of the biosynthesis of pyrimidines. Ornithine carbamoyltransferase (2.1.3.3 from EC) (OTCase) catalyzes the conversion of ornithine and carbamoyl phosphate to citrulline. In mammals this enzyme participates in the urea cycle [] and is located in the mitochondrial matrix. In prokaryotes and eukaryotic microorganisms it is involved in the biosynthesis of arginine. In some bacterial species it is also involved in the degradation of arginine [] (the arginine deaminase pathway).  It has been shown [] that these two enzymes are evolutionary related. The predicted secondary structure of both enzymes are similar and there are some regions of sequence similarities. One of these regions includes three residues which have been shown, by crystallographic studies [], to be implicated in binding the phosphoryl group of carbamoyl phosphate and is described by IPR006132 from INTERPRO. The carboxyl-terminal, aspartate/ornithine-binding domain is connected to the amino-terminal domain by two alpha-helices, which comprise a hinge between domains [].; GO: 0016597 amino acid binding, 0016743 carboxyl- or carbamoyltransferase activity, 0006520 cellular amino acid metabolic process; PDB: 1ML4_A 4EP1_B 3Q98_A 3E2P_A 2RGW_E 4EKN_B 2G7M_E 3D6N_B 3M4J_A 3L06_A ....
Probab=30.56  E-value=70  Score=20.93  Aligned_cols=26  Identities=8%  Similarity=-0.183  Sum_probs=22.5

Q ss_pred             hccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         82 LITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        82 l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      ..+++.+.++..+..||+++..+.|.
T Consensus        11 ~~~rv~~Sl~~~~~~~g~~~~~~~P~   36 (158)
T PF00185_consen   11 GHNRVAHSLIELLAKFGMEVVLIAPE   36 (158)
T ss_dssp             TTSHHHHHHHHHHHHTTSEEEEESSG
T ss_pred             CCChHHHHHHHHHHHcCCEEEEECCC
Confidence            45789999999999999999888774


No 431
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]
Probab=30.42  E-value=64  Score=23.40  Aligned_cols=25  Identities=0%  Similarity=-0.142  Sum_probs=19.9

Q ss_pred             ccchHHHHHHHHhhcCCEE--EEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQL--VYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V--~~~~r~  107 (109)
                      .|.||+.+|+.++.-|..|  +++|+.
T Consensus        11 ~GliG~s~a~~l~~~g~~v~i~g~d~~   37 (279)
T COG0287          11 LGLMGGSLARALKEAGLVVRIIGRDRS   37 (279)
T ss_pred             CchHHHHHHHHHHHcCCeEEEEeecCc
Confidence            5899999999999888766  555553


No 432
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to  6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate.  L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH.  This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domai
Probab=29.96  E-value=54  Score=23.45  Aligned_cols=24  Identities=4%  Similarity=-0.151  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|+.++++++.+|. +|++.++.
T Consensus       175 g~vG~~~~~lak~~G~~~v~~~~~s  199 (339)
T cd08232         175 GPIGALVVAAARRAGAAEIVATDLA  199 (339)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEECCC
Confidence            7899999999999999 78887653


No 433
>PF10727 Rossmann-like:  Rossmann-like domain;  InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins. This Rossmann-fold domain consists of 3-layers alpha/beta/alpha, where the six beta strands are parallel in the order 321456.; PDB: 3DFU_A 3C24_A.
Probab=29.88  E-value=46  Score=21.18  Aligned_cols=24  Identities=8%  Similarity=-0.100  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEE-ccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYS-TCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~-~r~  107 (109)
                      |+.|+.+++.|+.-|..|..+ +|.
T Consensus        19 GrVG~~La~aL~~ag~~v~~v~srs   43 (127)
T PF10727_consen   19 GRVGTALARALARAGHEVVGVYSRS   43 (127)
T ss_dssp             SCCCCHHHHHHHHTTSEEEEESSCH
T ss_pred             CHHHHHHHHHHHHCCCeEEEEEeCC
Confidence            899999999999999998765 554


No 434
>KOG0022|consensus
Probab=29.80  E-value=54  Score=24.79  Aligned_cols=24  Identities=4%  Similarity=-0.155  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|.++++-+++.|+ +|++.|-.
T Consensus       202 G~VGLav~~Gaka~GAsrIIgvDiN  226 (375)
T KOG0022|consen  202 GGVGLAVAMGAKAAGASRIIGVDIN  226 (375)
T ss_pred             chHHHHHHHhHHhcCcccEEEEecC
Confidence            6799999999999998 79999854


No 435
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=29.77  E-value=65  Score=22.87  Aligned_cols=24  Identities=13%  Similarity=-0.225  Sum_probs=21.1

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|+.+++.++..|.+|++.++.
T Consensus       177 g~vg~~~~~la~~~g~~v~~~~~~  200 (329)
T cd08298         177 GASAHLALQIARYQGAEVFAFTRS  200 (329)
T ss_pred             cHHHHHHHHHHHHCCCeEEEEcCC
Confidence            789999999999999999887653


No 436
>PF10686 DUF2493:  Protein of unknown function (DUF2493);  InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  Members of this family are mainly Proteobacteria. The function is not known. 
Probab=29.68  E-value=55  Score=18.60  Aligned_cols=31  Identities=16%  Similarity=0.243  Sum_probs=20.6

Q ss_pred             CCCceEEEecC-ccCCcccHHHHhhcCcEEEe
Q psy15800          6 GENLKVISTFS-VGHDHLHLDQIKSRGIRVGT   36 (109)
Q Consensus         6 ~p~Lk~i~~~~-~G~d~id~~~~~~~gi~v~n   36 (109)
                      .|.+-+|+--+ .|.|.+-...+.++||.+..
T Consensus        31 ~~~~~lvhGga~~GaD~iA~~wA~~~gv~~~~   62 (71)
T PF10686_consen   31 HPDMVLVHGGAPKGADRIAARWARERGVPVIR   62 (71)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCeeEE
Confidence            45666555555 57777777777777776654


No 437
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=29.67  E-value=44  Score=24.17  Aligned_cols=24  Identities=8%  Similarity=-0.188  Sum_probs=20.4

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.+|...++.++.+|.+ |++.++.
T Consensus       170 g~vG~~~~~~a~~~G~~~v~~~~~~  194 (347)
T PRK10309        170 GTIGLLAIQCAVALGAKSVTAIDIN  194 (347)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEECCC
Confidence            78999999999999997 6777653


No 438
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=29.65  E-value=55  Score=25.26  Aligned_cols=23  Identities=0%  Similarity=-0.038  Sum_probs=20.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|+-|+++++.|+. |.+|+.+|.
T Consensus        14 ~G~sG~a~~~~L~~-g~~v~v~D~   36 (454)
T PRK01368         14 LGKTGISVYEELQN-KYDVIVYDD   36 (454)
T ss_pred             ecHHHHHHHHHHhC-CCEEEEECC
Confidence            48899999999996 999999984


No 439
>PF12146 Hydrolase_4:  Putative lysophospholipase;  InterPro: IPR022742  This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. Many members are annotated as being lysophospholipases, and others as alpha-beta hydrolase fold-containing proteins. 
Probab=29.57  E-value=77  Score=18.15  Aligned_cols=20  Identities=0%  Similarity=-0.225  Sum_probs=16.7

Q ss_pred             HHHHHHHhhcCCEEEEEccc
Q psy15800         88 TNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        88 ~~va~~~~~fg~~V~~~~r~  107 (109)
                      ..+|+.|..-|..|.++|-.
T Consensus        33 ~~~a~~L~~~G~~V~~~D~r   52 (79)
T PF12146_consen   33 AHLAEFLAEQGYAVFAYDHR   52 (79)
T ss_pred             HHHHHHHHhCCCEEEEECCC
Confidence            35888999999999999853


No 440
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=29.56  E-value=72  Score=22.19  Aligned_cols=23  Identities=9%  Similarity=-0.097  Sum_probs=20.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++.+|++|+..++
T Consensus       155 ~~~g~~~~~~a~~~g~~v~~~~~  177 (326)
T cd08272         155 GGVGHVAVQLAKAAGARVYATAS  177 (326)
T ss_pred             CcHHHHHHHHHHHcCCEEEEEec
Confidence            67999999999999999987654


No 441
>cd05281 TDH Threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=29.35  E-value=51  Score=23.72  Aligned_cols=23  Identities=9%  Similarity=-0.188  Sum_probs=19.9

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r  106 (109)
                      |.+|+.++++++.+|+ +|++.++
T Consensus       173 g~vg~~~~~la~~~G~~~v~~~~~  196 (341)
T cd05281         173 GPIGLMAIAVAKAAGASLVIASDP  196 (341)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEECC
Confidence            7899999999999999 6877643


No 442
>PLN00203 glutamyl-tRNA reductase
Probab=29.33  E-value=43  Score=26.56  Aligned_cols=25  Identities=4%  Similarity=-0.059  Sum_probs=21.9

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~~  108 (109)
                      |.+|+.+++.|...|. +|+.++|+.
T Consensus       275 G~mG~~~a~~L~~~G~~~V~V~nRs~  300 (519)
T PLN00203        275 GKMGKLLVKHLVSKGCTKMVVVNRSE  300 (519)
T ss_pred             HHHHHHHHHHHHhCCCCeEEEEeCCH
Confidence            6799999999999997 699999864


No 443
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=29.26  E-value=67  Score=22.99  Aligned_cols=23  Identities=4%  Similarity=-0.176  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.++..|.+|++.+.
T Consensus       188 g~ig~~~~~~a~~~g~~vi~~~~  210 (350)
T cd08274         188 GGVGSALVQLAKRRGAIVIAVAG  210 (350)
T ss_pred             cHHHHHHHHHHHhcCCEEEEEeC
Confidence            78999999999999999887653


No 444
>PF13450 NAD_binding_8:  NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G ....
Probab=29.13  E-value=1.1e+02  Score=16.90  Aligned_cols=24  Identities=4%  Similarity=-0.195  Sum_probs=19.3

Q ss_pred             chHHHHHHHHhhcCCEEEEEcccc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      --|-..|..|+.-|.+|..+++..
T Consensus         6 ~sGl~aA~~L~~~g~~v~v~E~~~   29 (68)
T PF13450_consen    6 ISGLAAAYYLAKAGYRVTVFEKND   29 (68)
T ss_dssp             HHHHHHHHHHHHTTSEEEEEESSS
T ss_pred             HHHHHHHHHHHHCCCcEEEEecCc
Confidence            357778888888899999998754


No 445
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional
Probab=29.00  E-value=59  Score=24.28  Aligned_cols=23  Identities=4%  Similarity=-0.051  Sum_probs=19.6

Q ss_pred             hHHHHHHHHhhcCCEEEEEcccc
Q psy15800         86 SDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        86 IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      =|..+|..|..-|.+|++|||..
T Consensus        31 gG~~MA~~La~aG~~V~v~Dr~~   53 (342)
T PRK12557         31 GGSRMAIEFAEAGHDVVLAEPNR   53 (342)
T ss_pred             CHHHHHHHHHhCCCeEEEEECCH
Confidence            38889999988899999999864


No 446
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional
Probab=28.02  E-value=72  Score=24.50  Aligned_cols=25  Identities=0%  Similarity=-0.229  Sum_probs=22.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      ..+-+..+++.|..-|.+|.+|||+
T Consensus       332 R~Spa~~ii~~L~~~g~~V~~~DP~  356 (425)
T PRK15182        332 RNTRIIDVVKELGKYSCKVDIFDPW  356 (425)
T ss_pred             ccCcHHHHHHHHHhCCCEEEEECCC
Confidence            3467999999999999999999997


No 447
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Probab=27.76  E-value=86  Score=22.95  Aligned_cols=22  Identities=5%  Similarity=-0.102  Sum_probs=19.9

Q ss_pred             hHHHHHHHHhhcCCEEEEEccc
Q psy15800         86 SDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        86 IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      +|+.+|.+|...|++|+.+++.
T Consensus       170 VG~pla~lL~~~gatVtv~~s~  191 (286)
T PRK14175        170 VGQPVSKLLLQKNASVTILHSR  191 (286)
T ss_pred             hHHHHHHHHHHCCCeEEEEeCC
Confidence            8999999999999999988764


No 448
>PF05675 DUF817:  Protein of unknown function (DUF817);  InterPro: IPR008535 This family consists of several bacterial proteins of unknown function.
Probab=27.36  E-value=66  Score=22.89  Aligned_cols=22  Identities=0%  Similarity=-0.195  Sum_probs=19.4

Q ss_pred             chHHHHHHHHhhcCCEEEEEcc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .+|+-++|..+-|++++.-|-|
T Consensus       108 aVGSYi~rawR~fdlr~~~~P~  129 (235)
T PF05675_consen  108 AVGSYIARAWRLFDLRFTRYPP  129 (235)
T ss_pred             HHHHHHHHHHHHhheehhCCCc
Confidence            6999999999999999877654


No 449
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which  is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (
Probab=27.32  E-value=59  Score=23.36  Aligned_cols=23  Identities=0%  Similarity=-0.148  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcC-CEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASI-MQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg-~~V~~~~r  106 (109)
                      |.+|+.++++++.+| .+|+++++
T Consensus       176 g~~g~~~~~~a~~~G~~~v~~~~~  199 (345)
T cd08286         176 GPVGLAALLTAQLYSPSKIIMVDL  199 (345)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEcC
Confidence            789999999999999 68888765


No 450
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=27.31  E-value=66  Score=26.06  Aligned_cols=24  Identities=4%  Similarity=-0.050  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |+||+++++++..++. +|+.+|+.
T Consensus       260 GSiGsel~~qil~~~p~~i~l~~~~  284 (588)
T COG1086         260 GSIGSELCRQILKFNPKEIILFSRD  284 (588)
T ss_pred             CcHHHHHHHHHHhcCCCEEEEecCc
Confidence            7899999999999998 57777764


No 451
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional
Probab=27.29  E-value=60  Score=25.55  Aligned_cols=22  Identities=5%  Similarity=-0.049  Sum_probs=20.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      |+.|.++|+.+...|.+|+++.
T Consensus       282 GkmG~alA~aa~~~GA~VtlI~  303 (475)
T PRK13982        282 GKQGFAIAAAAAAAGAEVTLIS  303 (475)
T ss_pred             hHHHHHHHHHHHHCCCcEEEEe
Confidence            8999999999999999999875


No 452
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically  Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+.  ME has been found in all organisms, and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2.  This subfamily consists primarily of archaeal and bacterial ME.  Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydroph
Probab=27.21  E-value=63  Score=22.50  Aligned_cols=24  Identities=13%  Similarity=0.018  Sum_probs=21.7

Q ss_pred             cchHHHHHHHHhhcCCE---EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ---LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~---V~~~~r~  107 (109)
                      |..|+.++..+...|++   |..+||+
T Consensus        34 GgAg~aiA~~L~~~G~~~~~i~ivdr~   60 (226)
T cd05311          34 GAAGIAIARLLLAAGAKPENIVVVDSK   60 (226)
T ss_pred             hHHHHHHHHHHHHcCcCcceEEEEeCC
Confidence            78999999999999985   8899987


No 453
>COG3395 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.82  E-value=74  Score=24.64  Aligned_cols=28  Identities=7%  Similarity=-0.154  Sum_probs=23.7

Q ss_pred             hhhccchHHHHHHHHhhcCCEEEEEccc
Q psy15800         80 TELITQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        80 ~~l~G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .++.|+||.++--++.++|.++..+.|-
T Consensus        87 ST~~GNIG~~~dal~~alg~~~avv~PA  114 (413)
T COG3395          87 STLRGNIGPETDALLDALGFSIAVVVPA  114 (413)
T ss_pred             CCCCCCccHHHHHHHHhcCCCceEEecC
Confidence            4567999999999999999888777664


No 454
>COG0565 LasT rRNA methylase [Translation, ribosomal structure and biogenesis]
Probab=26.66  E-value=92  Score=22.33  Aligned_cols=27  Identities=4%  Similarity=-0.192  Sum_probs=20.3

Q ss_pred             hhccchHHHHHHHHhhcCC-EEEEEcccc
Q psy15800         81 ELITQSDTNHTQRCLASIM-QLVYSTCYN  108 (109)
Q Consensus        81 ~l~G~IG~~va~~~~~fg~-~V~~~~r~~  108 (109)
                      +..|+|| .+||.++-||. +...++|..
T Consensus        13 ~~~gNIG-~vARaMKNfGl~eL~LV~Pr~   40 (242)
T COG0565          13 SHPGNIG-SVARAMKNFGLSELRLVNPRA   40 (242)
T ss_pred             CCCccHH-HHHHHHHhCCcceEEEECCCC
Confidence            3458898 48999999998 566667653


No 455
>PLN02353 probable UDP-glucose 6-dehydrogenase
Probab=26.66  E-value=78  Score=24.80  Aligned_cols=26  Identities=8%  Similarity=-0.090  Sum_probs=22.9

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      ..+-...+++.|...|.+|.+|||+.
T Consensus       342 R~Spa~~li~~L~~~G~~V~~~DP~v  367 (473)
T PLN02353        342 RETPAIDVCKGLLGDKAKLSIYDPQV  367 (473)
T ss_pred             ccChHHHHHHHHHhCCCEEEEECCCC
Confidence            35678999999999999999999973


No 456
>PLN02827 Alcohol dehydrogenase-like
Probab=26.34  E-value=62  Score=24.02  Aligned_cols=23  Identities=4%  Similarity=-0.146  Sum_probs=19.8

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r  106 (109)
                      |.+|...++.++.+|++ |++.++
T Consensus       203 G~vG~~~iqlak~~G~~~vi~~~~  226 (378)
T PLN02827        203 GTVGLSVAQGAKLRGASQIIGVDI  226 (378)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEECC
Confidence            78999999999999995 777764


No 457
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.   These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typical
Probab=26.08  E-value=63  Score=23.11  Aligned_cols=23  Identities=0%  Similarity=-0.273  Sum_probs=19.9

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r  106 (109)
                      |.+|+.+++.++.+|+ +|++.++
T Consensus       177 g~vg~~~~~~a~~~g~~~v~~~~~  200 (344)
T cd08284         177 GPVGLCAVLSAQVLGAARVFAVDP  200 (344)
T ss_pred             cHHHHHHHHHHHHcCCceEEEEcC
Confidence            7899999999999997 7887653


No 458
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=25.97  E-value=85  Score=22.43  Aligned_cols=24  Identities=8%  Similarity=-0.161  Sum_probs=20.7

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|..+++.+++.|.+|+..++.
T Consensus       176 ~~vg~~~~~~a~~~g~~v~~~~~~  199 (341)
T cd08297         176 GGLGHLGVQYAKAMGLRVIAIDVG  199 (341)
T ss_pred             chHHHHHHHHHHHCCCeEEEEeCC
Confidence            469999999999999999887653


No 459
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family.  The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=25.88  E-value=56  Score=23.43  Aligned_cols=25  Identities=0%  Similarity=-0.270  Sum_probs=20.8

Q ss_pred             ccchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         83 ITQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      .|.+|+.+++++++.|.+ |+..++.
T Consensus       177 ~g~vg~~~~~lak~~G~~~v~~~~~~  202 (345)
T cd08287         177 DGAVGLCAVLAAKRLGAERIIAMSRH  202 (345)
T ss_pred             CCHHHHHHHHHHHHcCCCEEEEECCC
Confidence            378999999999999996 7777654


No 460
>KOG3553|consensus
Probab=25.64  E-value=52  Score=20.53  Aligned_cols=41  Identities=27%  Similarity=0.216  Sum_probs=30.2

Q ss_pred             CCceEEEecCccCCcccHH---HHhhcCcEEEecCCCCccchHH
Q psy15800          7 ENLKVISTFSVGHDHLHLD---QIKSRGIRVGTVGPVSSDAVAE   47 (109)
Q Consensus         7 p~Lk~i~~~~~G~d~id~~---~~~~~gi~v~n~~g~~~~~vAE   47 (109)
                      .+|++=...+.|+|+-...   ...+.||-|+|+...++..+|-
T Consensus        33 e~l~~GFkIGGGIDQDp~k~Pf~ytD~GiYvT~V~eGsPA~~AG   76 (124)
T KOG3553|consen   33 ENLILGFKIGGGIDQDPSKNPFSYTDKGIYVTRVSEGSPAEIAG   76 (124)
T ss_pred             EEEEEEEEeccccCCCcccCCCCcCCccEEEEEeccCChhhhhc
Confidence            4678888899999875322   2557899999987766766654


No 461
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed
Probab=25.13  E-value=85  Score=23.89  Aligned_cols=24  Identities=0%  Similarity=-0.125  Sum_probs=21.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|-++|..+..+|.+|..+++.
T Consensus       181 G~~g~E~A~~l~~~g~~Vtli~~~  204 (462)
T PRK06416        181 GYIGVEFASAYASLGAEVTIVEAL  204 (462)
T ss_pred             CHHHHHHHHHHHHcCCeEEEEEcC
Confidence            679999999999999999988764


No 462
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenase and has the catalytic and structural zinc-binding sites characteristic of this group. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanedi
Probab=24.71  E-value=69  Score=23.69  Aligned_cols=23  Identities=4%  Similarity=-0.163  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r  106 (109)
                      |.+|...++.++..|. +|++.++
T Consensus       213 g~vG~~ai~lA~~~G~~~vi~~~~  236 (384)
T cd08265         213 GPIGLAAIALAKAAGASKVIAFEI  236 (384)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEEcC
Confidence            7899999999999999 6888765


No 463
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional
Probab=24.14  E-value=91  Score=23.77  Aligned_cols=26  Identities=0%  Similarity=-0.289  Sum_probs=22.3

Q ss_pred             ccchHHHHHHHHhhcC-CEEEEEcccc
Q psy15800         83 ITQSDTNHTQRCLASI-MQLVYSTCYN  108 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg-~~V~~~~r~~  108 (109)
                      ..+-...+++.|...| .+|.+|||..
T Consensus       338 r~Sp~~~l~~~L~~~gg~~v~~~DP~~  364 (415)
T PRK11064        338 RESPAMEIAELIAQWHSGETLVVEPNI  364 (415)
T ss_pred             hhChHHHHHHHHHhcCCcEEEEECCCC
Confidence            3467899999999996 9999999973


No 464
>cd05284 arabinose_DH_like D-arabinose dehydrogenase. This group contains arabinose dehydrogenase (AraDH) and related alcohol dehydrogenases. AraDH is a member of the medium chain dehydrogenase/reductase family and catalyzes the NAD(P)-dependent oxidation of D-arabinose and other pentoses, the initial step in the metabolism of d-arabinose into 2-oxoglutarate. Like the alcohol dehydrogenases, AraDH binds a zinc in the catalytic cleft as well as a distal structural zinc. AraDH forms homotetramers as a dimer of dimers. AraDH replaces a conserved catalytic His with replace with Arg, compared to the canonical ADH site. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol d
Probab=23.96  E-value=71  Score=22.78  Aligned_cols=24  Identities=8%  Similarity=-0.202  Sum_probs=20.4

Q ss_pred             cchHHHHHHHHhhcC-CEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASI-MQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg-~~V~~~~r~  107 (109)
                      |.+|+.+++.++..| .+|+..++.
T Consensus       177 ~~vg~~~~~~a~~~g~~~v~~~~~~  201 (340)
T cd05284         177 GGLGHIAVQILRALTPATVIAVDRS  201 (340)
T ss_pred             cHHHHHHHHHHHHhCCCcEEEEeCC
Confidence            569999999999999 899877653


No 465
>cd00853 NifX NifX belongs to a family of iron-molybdenum cluster-binding proteins that includes NifB,  and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme.  The protein is part of the nitrogen fixation gene cluster in nitrogen-fixing bacteria and has sequence similarity to other members of the cluster.
Probab=23.75  E-value=73  Score=18.95  Aligned_cols=23  Identities=4%  Similarity=-0.031  Sum_probs=20.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|+||.....+|+..|.+|+...
T Consensus        67 ~~~iG~~a~~~L~~~GI~v~~~~   89 (102)
T cd00853          67 CAAIGGPAAARLVRAGIHPIKVP   89 (102)
T ss_pred             EhhcChhHHHHHHHcCCEEEEcC
Confidence            48999999999999999998543


No 466
>PF06057 VirJ:  Bacterial virulence protein (VirJ);  InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins. VirJ is thought to be involved in the type IV secretion system. It is thought that the substrate proteins localised to the periplasm may associate with the pilus in a manner that is mediated by VirJ, and suggest a two-step process for type IV secretion in Agrobacterium [].
Probab=23.73  E-value=99  Score=21.35  Aligned_cols=22  Identities=9%  Similarity=-0.026  Sum_probs=19.6

Q ss_pred             chHHHHHHHHhhcCCEEEEEcc
Q psy15800         85 QSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        85 ~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .+.+.+|+.|+.-|..|+++|-
T Consensus        16 ~~d~~~a~~l~~~G~~VvGvds   37 (192)
T PF06057_consen   16 DLDKQIAEALAKQGVPVVGVDS   37 (192)
T ss_pred             hhhHHHHHHHHHCCCeEEEech
Confidence            4778999999999999999984


No 467
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol.  ADH is a me
Probab=23.66  E-value=72  Score=23.29  Aligned_cols=23  Identities=9%  Similarity=-0.099  Sum_probs=20.0

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r  106 (109)
                      |.+|+.++++++.+|.+ |++.++
T Consensus       192 g~vG~a~i~lak~~G~~~Vi~~~~  215 (363)
T cd08279         192 GGVGLNAIQGARIAGASRIIAVDP  215 (363)
T ss_pred             CHHHHHHHHHHHHcCCCcEEEEcC
Confidence            78999999999999997 877654


No 468
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions  near  the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates.  Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononu
Probab=23.60  E-value=76  Score=23.23  Aligned_cols=24  Identities=0%  Similarity=-0.169  Sum_probs=20.5

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|...++.++++|. .|++.++.
T Consensus       196 g~vG~~~~~la~~~G~~~v~~~~~~  220 (365)
T cd08278         196 GAVGLAAVMAAKIAGCTTIIAVDIV  220 (365)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEeCC
Confidence            7899999999999999 48877653


No 469
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated
Probab=23.31  E-value=95  Score=23.11  Aligned_cols=24  Identities=4%  Similarity=-0.064  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|..+|+.|...|. +|..+|+-
T Consensus        33 GglGs~va~~La~aGvg~i~lvD~D   57 (339)
T PRK07688         33 GALGTANAEMLVRAGVGKVTIVDRD   57 (339)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEeCC
Confidence            7899999999999998 88888863


No 470
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Probab=23.14  E-value=1.1e+02  Score=22.35  Aligned_cols=21  Identities=5%  Similarity=-0.099  Sum_probs=18.8

Q ss_pred             hHHHHHHHHhhcCCEEEEEcc
Q psy15800         86 SDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        86 IG~~va~~~~~fg~~V~~~~r  106 (109)
                      +|+-++.+|...|++|+.+..
T Consensus       170 VGkPla~lL~~~~atVt~~hs  190 (285)
T PRK14189        170 VGKPMAMLLLQAGATVTICHS  190 (285)
T ss_pred             cHHHHHHHHHHCCCEEEEecC
Confidence            599999999999999988754


No 471
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts et
Probab=23.09  E-value=1.1e+02  Score=21.08  Aligned_cols=23  Identities=9%  Similarity=-0.042  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|..++..++..|.+|+..++
T Consensus       155 g~~g~~~~~~a~~~g~~v~~~~~  177 (309)
T cd05289         155 GGVGSFAVQLAKARGARVIATAS  177 (309)
T ss_pred             chHHHHHHHHHHHcCCEEEEEec
Confidence            67999999999999999887654


No 472
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. This group is predominated by atypical alcohol dehydrogenases; they exist as tetramers and exhibit specificity for NADP(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  Like other zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric ADHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains; however, they do not have and a structural zinc in a lobe of the catalytic domain.  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=23.08  E-value=79  Score=22.83  Aligned_cols=24  Identities=0%  Similarity=-0.234  Sum_probs=20.3

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r~  107 (109)
                      |.+|+.+++.++..|.+ |+..++.
T Consensus       176 g~iG~~~~~lak~~G~~~v~~~~~~  200 (351)
T cd08285         176 GPVGLMAVAGARLRGAGRIIAVGSR  200 (351)
T ss_pred             CHHHHHHHHHHHHcCCCeEEEEeCC
Confidence            78999999999999995 7777653


No 473
>cd01980 Chlide_reductase_Y Chlide_reductase_Y : Y subunit of chlorophyllide (chlide) reductase (BchY).  Chlide reductase participates in photosynthetic pigment synthesis playing a role in the conversion of chlorophylls(Chl) into bacteriochlorophylls (BChl). Chlide reductase catalyzes the reduction of the B-ring of the tetrapyrolle. Chlide reductase is a three subunit enzyme (subunits are designated BchX, BchY and BchZ). The similarity between these three subunits and the subunits for nitrogenase suggests that BchX serves as an electron donor for the BchY-BchY catalytic subunits.
Probab=23.08  E-value=2.5e+02  Score=21.42  Aligned_cols=81  Identities=14%  Similarity=0.180  Sum_probs=41.4

Q ss_pred             HHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHH--HHcCCCCcccchhhhhccc--------hHHHHHHH
Q psy15800         24 LDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNC--IASGTEKSQQHAITELITQ--------SDTNHTQR   93 (109)
Q Consensus        24 ~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~--~~~g~w~~~~~~~~~l~G~--------IG~~va~~   93 (109)
                      .+.+.++||++.....+-...+.++.-.+.=.+-+..+...+.  .+...+...-.....+.|+        .--.+++.
T Consensus       219 a~~Le~~GvP~~~~~piG~~~td~~l~~la~~~g~~~~~~e~~~~~e~~~~~~~ld~~~~l~gkv~v~g~~~~~~~la~~  298 (416)
T cd01980         219 IRELEEAGRPIVSGAPVGADGTAAWLEAVGEALGLDMDQVRKVANEEKAAAKGAIRAFSPIKGRVLVSGYEGNELLVARL  298 (416)
T ss_pred             HHHHHHcCCceecCCCcCchHHHHHHHHHHHHhCcCchhHHHHHHHHHHHHHHHHhhHHhhCceEEEECCCchhHHHHHH
Confidence            4456677999875444445566666655554555555522222  2222221100000011121        12448999


Q ss_pred             HhhcCCEEEEE
Q psy15800         94 CLASIMQLVYS  104 (109)
Q Consensus        94 ~~~fg~~V~~~  104 (109)
                      |..+||+|.+.
T Consensus       299 L~elGmevv~~  309 (416)
T cd01980         299 LIESGAEVPYV  309 (416)
T ss_pred             HHHcCCEEEEE
Confidence            99999998874


No 474
>PRK07846 mycothione reductase; Reviewed
Probab=22.87  E-value=1e+02  Score=23.62  Aligned_cols=24  Identities=4%  Similarity=-0.171  Sum_probs=21.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|-++|..+..+|.+|..+++.
T Consensus       175 G~iG~E~A~~l~~~G~~Vtli~~~  198 (451)
T PRK07846        175 GFIAAEFAHVFSALGVRVTVVNRS  198 (451)
T ss_pred             CHHHHHHHHHHHHcCCeEEEEEcC
Confidence            679999999999999999998764


No 475
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family. This group has the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, 
Probab=22.80  E-value=70  Score=23.08  Aligned_cols=23  Identities=4%  Similarity=-0.168  Sum_probs=19.2

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r  106 (109)
                      |.+|+..++.+++.|++ |++.++
T Consensus       184 g~vG~~~~~~a~~~G~~~v~~~~~  207 (350)
T cd08256         184 GPLGLGMIGAARLKNPKKLIVLDL  207 (350)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEEcC
Confidence            78999999999999986 556554


No 476
>TIGR03452 mycothione_red mycothione reductase. Mycothiol, a glutathione analog in Mycobacterium tuberculosis and related species, can form a disulfide-linked dimer called mycothione. This enzyme can reduce mycothione to regenerate two mycothiol molecules. The enzyme shows some sequence similarity to glutathione-disulfide reductase, trypanothione-disulfide reductase, and dihydrolipoamide dehydrogenase. The characterized protein from M. tuberculosis, a homodimer, has FAD as a cofactor, one per monomer, and uses NADPH as a substrate.
Probab=22.75  E-value=94  Score=23.79  Aligned_cols=24  Identities=4%  Similarity=-0.183  Sum_probs=21.8

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||-++|..+..+|.+|..+++.
T Consensus       178 G~ig~E~A~~l~~~G~~Vtli~~~  201 (452)
T TIGR03452       178 GYIAAEFAHVFSALGTRVTIVNRS  201 (452)
T ss_pred             CHHHHHHHHHHHhCCCcEEEEEcc
Confidence            679999999999999999998764


No 477
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional
Probab=22.45  E-value=1e+02  Score=23.28  Aligned_cols=24  Identities=0%  Similarity=-0.256  Sum_probs=21.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|-++|..+..+|.+|..+++.
T Consensus       166 G~~g~e~A~~l~~~g~~Vtli~~~  189 (438)
T PRK07251        166 GNIGLEFAGLYNKLGSKVTVLDAA  189 (438)
T ss_pred             CHHHHHHHHHHHHcCCeEEEEecC
Confidence            679999999999999999998764


No 478
>TIGR01139 cysK cysteine synthase A. This model distinguishes cysteine synthase A (CysK) from cysteine synthase B (CysM). CysM differs in having a broader specificity that also allows the use of thiosulfate to produce cysteine thiosulfonate.
Probab=22.44  E-value=1.1e+02  Score=21.91  Aligned_cols=24  Identities=8%  Similarity=-0.034  Sum_probs=18.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|+-|+.+|-.++.+|++++.+=|
T Consensus        65 sGN~g~alA~~a~~~Gl~~~i~vp   88 (298)
T TIGR01139        65 SGNTGIALAMVAAARGYKLILTMP   88 (298)
T ss_pred             CChhHHHHHHHHHHcCCeEEEEeC
Confidence            378888888888888888776644


No 479
>cd00562 NifX_NifB This CD represents a family of iron-molybdenum cluster-binding proteins that includes NifB, NifX, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme.  This domain is a predicted small-molecule-binding domain (SMBD) with an alpha/beta fold that is present either as a stand-alone domain (e.g. NifX and NifY) or fused to another conserved domain (e.g. NifB) however, its function is still undetermined.The SCOP database suggests that this domain is most similar to structures within the ribonuclease H superfamily.  This conserved domain is represented in two of the three major divisions of life (bacteria and archaea).
Probab=22.34  E-value=62  Score=18.83  Aligned_cols=23  Identities=4%  Similarity=-0.016  Sum_probs=20.2

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYST  105 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~  105 (109)
                      .|+||.....+|+..|++|+..+
T Consensus        67 ~~~iG~~a~~~l~~~gI~v~~~~   89 (102)
T cd00562          67 VGGIGGPAAAKLEAAGIKPIKAA   89 (102)
T ss_pred             EcccCccHHHHHHHcCCEEEEcC
Confidence            38899999999999999998654


No 480
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional
Probab=22.22  E-value=92  Score=22.20  Aligned_cols=24  Identities=4%  Similarity=-0.209  Sum_probs=20.6

Q ss_pred             cchHHHHHHHHhh-cCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLA-SIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~-fg~~V~~~~r~  107 (109)
                      |.+|..+++.++. +|.+|++.++.
T Consensus       172 g~vG~~~~~la~~~~g~~v~~~~~~  196 (338)
T PRK09422        172 GGLGNLALQYAKNVFNAKVIAVDIN  196 (338)
T ss_pred             cHHHHHHHHHHHHhCCCeEEEEeCC
Confidence            7899999999998 59999988654


No 481
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase. 6-hydroxyhexanoate dehydrogenase, an enzyme of the zinc-dependent alcohol dehydrogenase-like family of medium chain dehydrogenases/reductases catalyzes the conversion of 6-hydroxyhexanoate and NAD(+) to 6-oxohexanoate + NADH and H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzy
Probab=22.14  E-value=83  Score=22.67  Aligned_cols=23  Identities=4%  Similarity=-0.270  Sum_probs=19.6

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r  106 (109)
                      |.+|..+++.++++|+ +|++.++
T Consensus       185 g~vg~~~~~~a~~~G~~~v~~~~~  208 (350)
T cd08240         185 GGLGLMALALLKALGPANIIVVDI  208 (350)
T ss_pred             cHHHHHHHHHHHHcCCCeEEEEeC
Confidence            7899999999999999 6766654


No 482
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Probab=22.08  E-value=1.1e+02  Score=22.16  Aligned_cols=22  Identities=5%  Similarity=-0.106  Sum_probs=19.8

Q ss_pred             hHHHHHHHHhhcCCEEEEEccc
Q psy15800         86 SDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        86 IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      .|+.++.+|...|++|..+++.
T Consensus       171 vGkpia~~L~~~gatVtv~~~~  192 (283)
T PRK14192        171 LGKPMAMMLLNANATVTICHSR  192 (283)
T ss_pred             HHHHHHHHHHhCCCEEEEEeCC
Confidence            8999999999999999988764


No 483
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed
Probab=22.07  E-value=77  Score=26.11  Aligned_cols=25  Identities=0%  Similarity=-0.088  Sum_probs=22.5

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      |.+|..+|..+..-|.+|..+|+..
T Consensus       322 G~mG~gIA~~~a~~G~~V~l~d~~~  346 (715)
T PRK11730        322 GIMGGGIAYQSASKGVPVIMKDINQ  346 (715)
T ss_pred             chhHHHHHHHHHhCCCeEEEEeCCH
Confidence            6799999999999999999999753


No 484
>PRK06116 glutathione reductase; Validated
Probab=22.02  E-value=1.1e+02  Score=23.25  Aligned_cols=24  Identities=0%  Similarity=-0.400  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|-++|..+..+|.+|..+++.
T Consensus       176 G~~g~E~A~~l~~~g~~Vtlv~~~  199 (450)
T PRK06116        176 GYIAVEFAGVLNGLGSETHLFVRG  199 (450)
T ss_pred             CHHHHHHHHHHHHcCCeEEEEecC
Confidence            679999999999999999988764


No 485
>PRK13512 coenzyme A disulfide reductase; Provisional
Probab=22.02  E-value=97  Score=23.56  Aligned_cols=24  Identities=0%  Similarity=-0.226  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.+|-++|..+..+|.+|..+++.
T Consensus       157 G~ig~E~A~~l~~~g~~Vtli~~~  180 (438)
T PRK13512        157 GYISLEVLENLYERGLHPTLIHRS  180 (438)
T ss_pred             CHHHHHHHHHHHhCCCcEEEEecc
Confidence            679999999999999999988764


No 486
>cd05285 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=22.01  E-value=75  Score=22.86  Aligned_cols=23  Identities=9%  Similarity=-0.169  Sum_probs=19.8

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r  106 (109)
                      |.+|..++++++.+|.+ |+..++
T Consensus       172 g~vG~~a~~lak~~G~~~v~~~~~  195 (343)
T cd05285         172 GPIGLLTAAVAKAFGATKVVVTDI  195 (343)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEECC
Confidence            67999999999999998 777654


No 487
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional
Probab=21.99  E-value=1.1e+02  Score=22.85  Aligned_cols=24  Identities=4%  Similarity=-0.003  Sum_probs=21.3

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~  107 (109)
                      |.+|..+|+.|...|. ++..+|+.
T Consensus        33 GglGs~va~~La~aGvg~i~lvD~D   57 (338)
T PRK12475         33 GALGAANAEALVRAGIGKLTIADRD   57 (338)
T ss_pred             CHHHHHHHHHHHHcCCCEEEEEcCC
Confidence            7899999999999998 78888864


No 488
>KOG1203|consensus
Probab=21.98  E-value=93  Score=24.09  Aligned_cols=24  Identities=4%  Similarity=-0.189  Sum_probs=20.9

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |++|+.+.+.|+..|..|.+.=|.
T Consensus        89 G~vG~~iv~~llkrgf~vra~VRd  112 (411)
T KOG1203|consen   89 GKVGRRIVKILLKRGFSVRALVRD  112 (411)
T ss_pred             CchhHHHHHHHHHCCCeeeeeccC
Confidence            899999999999999988876554


No 489
>cd00852 NifB NifB belongs to a family of iron-molybdenum cluster-binding proteins that includes NifX, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme as part of nitrogen fixation in bacteria. This domain is sometimes found fused to a N-terminal domain (the Radical SAM domain) in nifB-like proteins.
Probab=21.91  E-value=82  Score=18.84  Aligned_cols=24  Identities=0%  Similarity=0.030  Sum_probs=20.6

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|+||....++|+.-|++|+..+.
T Consensus        71 ~~~iG~~a~~~L~~~GI~v~~~~~   94 (106)
T cd00852          71 CAKIGDEPKEKLEEAGIEVIEAYA   94 (106)
T ss_pred             ehhhCccHHHHHHHCCCEEEEecC
Confidence            389999999999999999985543


No 490
>cd05195 enoyl_red enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase
Probab=21.86  E-value=1.2e+02  Score=20.50  Aligned_cols=24  Identities=4%  Similarity=-0.181  Sum_probs=20.7

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.+|...++.++..|.+|+..++
T Consensus       118 ~g~~g~~~~~~a~~~g~~v~~~~~  141 (293)
T cd05195         118 AGGVGQAAIQLAQHLGAEVFATVG  141 (293)
T ss_pred             CCHHHHHHHHHHHHcCCEEEEEeC
Confidence            378999999999999999887754


No 491
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial. The tripeptide glutathione is an important reductant, e.g., for maintaining the cellular thiol/disulfide status and for protecting against reactive oxygen species such as hydrogen peroxide. Glutathione-disulfide reductase regenerates reduced glutathione from oxidized glutathione (glutathione disulfide) + NADPH. This model represents one of two closely related subfamilies of glutathione-disulfide reductase. Both are closely related to trypanothione reductase, and separate models are built so each of the three can describe proteins with conserved function. This model describes glutathione-disulfide reductases of animals, yeast, and a number of animal-resident bacteria.
Probab=21.79  E-value=1e+02  Score=23.61  Aligned_cols=24  Identities=0%  Similarity=-0.368  Sum_probs=21.4

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |.||-++|..+..+|.+|..+.+.
T Consensus       175 G~iG~E~A~~l~~~g~~Vtli~~~  198 (450)
T TIGR01421       175 GYIAVELAGVLHGLGSETHLVIRH  198 (450)
T ss_pred             CHHHHHHHHHHHHcCCcEEEEecC
Confidence            679999999999999999988764


No 492
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type. This model represents a clade of shikimate-5-dehydrogenases found in Corynebacterium, Mycobacteria and fungi. The fungal sequences are pentafunctional proteins known as AroM which contain the central five seven steps in the chorismate biosynthesis pathway. The Corynebacterium and Mycobacterial sequences represent the sole shikimate-5-dehydrogenases in species which otherwise have every enzyme of the chorismate biosynthesis pathway.
Probab=21.78  E-value=86  Score=22.52  Aligned_cols=25  Identities=0%  Similarity=-0.177  Sum_probs=21.8

Q ss_pred             cchHHHHHHHHhhcCC-EEEEEcccc
Q psy15800         84 TQSDTNHTQRCLASIM-QLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~~fg~-~V~~~~r~~  108 (109)
                      |..|+.++..|...|+ +|..++|..
T Consensus       134 GGaarai~~aL~~~G~~~i~I~nRt~  159 (282)
T TIGR01809       134 GGTSRAAVYALASLGVTDITVINRNP  159 (282)
T ss_pred             cHHHHHHHHHHHHcCCCeEEEEeCCH
Confidence            6789999999999998 699999863


No 493
>PRK05225 ketol-acid reductoisomerase; Validated
Probab=21.77  E-value=45  Score=26.33  Aligned_cols=19  Identities=5%  Similarity=-0.319  Sum_probs=13.6

Q ss_pred             cchHHHHHHHHhhcCCEEEEEccc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTCY  107 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r~  107 (109)
                      |+||+     +++|+|++.++++.
T Consensus        45 GSqG~-----AqAlNLrdSGvnVv   63 (487)
T PRK05225         45 GAQGL-----NQGLNMRDSGLDIS   63 (487)
T ss_pred             CHHHH-----HHhCCCccccceeE
Confidence            78888     67777777766654


No 494
>cd08290 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann f
Probab=21.63  E-value=1e+02  Score=21.94  Aligned_cols=23  Identities=4%  Similarity=-0.145  Sum_probs=20.2

Q ss_pred             cchHHHHHHHHhhcCCEEEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      |.+|+.+++.+++.|.+|+....
T Consensus       157 g~vg~~~~~~a~~~g~~v~~~~~  179 (341)
T cd08290         157 SAVGQAVIQLAKLLGIKTINVVR  179 (341)
T ss_pred             hHHHHHHHHHHHHcCCeEEEEEc
Confidence            78999999999999999887654


No 495
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=21.52  E-value=1.1e+02  Score=21.51  Aligned_cols=24  Identities=4%  Similarity=-0.122  Sum_probs=20.5

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|.+|+..++.+++.|.+|+..++
T Consensus       149 ~g~ig~~~~~~a~~~g~~v~~~~~  172 (331)
T cd08273         149 SGGVGQALLELALLAGAEVYGTAS  172 (331)
T ss_pred             CcHHHHHHHHHHHHcCCEEEEEeC
Confidence            378999999999999999887653


No 496
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional
Probab=21.39  E-value=1.1e+02  Score=23.33  Aligned_cols=24  Identities=8%  Similarity=-0.125  Sum_probs=18.1

Q ss_pred             hccchHHHHHHHHhhc-----CCEEEEEc
Q psy15800         82 LITQSDTNHTQRCLAS-----IMQLVYST  105 (109)
Q Consensus        82 l~G~IG~~va~~~~~f-----g~~V~~~~  105 (109)
                      -+|+|||.+.|.+..-     +++|.+.+
T Consensus        10 GFGRIGR~v~R~~~~~~~~~~~ievVAIN   38 (361)
T PTZ00434         10 GFGRIGRMVFQAICDQGLIGTEIDVVAVV   38 (361)
T ss_pred             CcChHHHHHHHHHHHcccCCCCeEEEEEe
Confidence            3699999999986542     57887764


No 497
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.   A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology to GroES.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subu
Probab=21.39  E-value=79  Score=23.05  Aligned_cols=23  Identities=9%  Similarity=-0.081  Sum_probs=19.8

Q ss_pred             cchHHHHHHHHhhcCCE-EEEEcc
Q psy15800         84 TQSDTNHTQRCLASIMQ-LVYSTC  106 (109)
Q Consensus        84 G~IG~~va~~~~~fg~~-V~~~~r  106 (109)
                      |.+|+.++++++.+|++ |++.++
T Consensus       197 g~vG~~~~~lak~~G~~~vi~~~~  220 (367)
T cd08263         197 GGVGSSAIQLAKAFGASPIIAVDV  220 (367)
T ss_pred             cHHHHHHHHHHHHcCCCeEEEEeC
Confidence            67999999999999998 776654


No 498
>COG1992 Uncharacterized conserved protein [Function unknown]
Probab=21.33  E-value=1.2e+02  Score=20.79  Aligned_cols=51  Identities=4%  Similarity=-0.106  Sum_probs=35.4

Q ss_pred             cchHHHHHHHHHHHhcCchHhHHHHHcCCCCcccchhhhhccchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         43 DAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        43 ~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~~~~~~l~G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      --.+.|+.-++|++.|.-+.....+               .=+-..++.+.|+..|..|..|||..
T Consensus        69 fGaS~H~Ar~lL~~~~~~p~iraa~---------------NIrY~~~~v~~~~~~G~~v~~~dR~~  119 (181)
T COG1992          69 FGASSHTARVLLTVMKHDPDIRAAI---------------NIRYSEEVVEALKDLGLAVSSFDRSK  119 (181)
T ss_pred             CCchHHHHHHHHHHHhhCCCceEEe---------------eecccHHHHHHHHhcCceEEEeCccc
Confidence            3467888888888777544332211               01236678999999999999999954


No 499
>TIGR01138 cysM cysteine synthase B. Alternate name: O-acetylserine (thiol)-lyase
Probab=21.32  E-value=1.2e+02  Score=21.87  Aligned_cols=24  Identities=0%  Similarity=-0.218  Sum_probs=19.1

Q ss_pred             ccchHHHHHHHHhhcCCEEEEEcc
Q psy15800         83 ITQSDTNHTQRCLASIMQLVYSTC  106 (109)
Q Consensus        83 ~G~IG~~va~~~~~fg~~V~~~~r  106 (109)
                      .|+-|+.+|-.++.+|++++.+=|
T Consensus        67 sGN~g~alA~~a~~~G~~~~i~~p   90 (290)
T TIGR01138        67 SGNTGIALAMIAALKGYRMKLLMP   90 (290)
T ss_pred             CChHHHHHHHHHHHcCCeEEEEEC
Confidence            388899999888888888776644


No 500
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ. Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Plays a minor role in aerobic beta-oxidation of fatty acids. FadJI complex is necessary for anaerobic growth on short-chain acids with nitrate as an electron acceptor. Activities include: enoyl-CoA hydratase (EC 4.2.1.17),3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadJ (aka YfcX). This model excludes the FadB of TIGR02437 equivalog.
Probab=21.28  E-value=83  Score=25.86  Aligned_cols=25  Identities=0%  Similarity=-0.203  Sum_probs=21.6

Q ss_pred             cchHHHHHHHHh-hcCCEEEEEcccc
Q psy15800         84 TQSDTNHTQRCL-ASIMQLVYSTCYN  108 (109)
Q Consensus        84 G~IG~~va~~~~-~fg~~V~~~~r~~  108 (109)
                      |.+|..+|..+. .-|++|..+|+..
T Consensus       313 G~mG~~iA~~~a~~~G~~V~l~d~~~  338 (699)
T TIGR02440       313 GLMGGGIASVTATKAGIPVRIKDINP  338 (699)
T ss_pred             cHHHHHHHHHHHHHcCCeEEEEeCCH
Confidence            679999999987 4799999999764


Done!