Query         psy15827
Match_columns 101
No_of_seqs    229 out of 1893
Neff          8.6 
Searched_HMMs 46136
Date          Fri Aug 16 22:20:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15827.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15827hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0197|consensus               98.8 1.6E-09 3.5E-14   80.3   0.5   60   41-100   166-230 (468)
  2 KOG0193|consensus               98.3 1.6E-07 3.5E-12   71.4   0.3   33   68-100   384-416 (678)
  3 KOG4278|consensus               98.2   1E-06 2.2E-11   68.2   2.7   62   40-101   226-292 (1157)
  4 KOG0194|consensus               98.2 1.4E-06   3E-11   65.2   3.4   32   67-98    148-179 (474)
  5 KOG1026|consensus               98.0 3.5E-06 7.6E-11   65.9   2.6   34    1-34    738-771 (774)
  6 KOG4278|consensus               98.0   4E-06 8.6E-11   65.0   2.3   28    1-28    499-526 (1157)
  7 KOG0200|consensus               97.9 6.8E-06 1.5E-10   63.2   2.8   35    1-36    555-589 (609)
  8 KOG0192|consensus               97.7 3.2E-05 6.9E-10   56.3   2.7   28    1-28    279-306 (362)
  9 cd05107 PTKc_PDGFR_beta Cataly  97.6 3.8E-05 8.1E-10   56.3   2.3   35   65-99     26-60  (401)
 10 KOG4257|consensus               97.6   4E-05 8.7E-10   59.5   2.3   27    1-27    625-651 (974)
 11 KOG1095|consensus               97.5 0.00012 2.7E-09   59.1   4.1   29    1-29    937-965 (1025)
 12 cd05104 PTKc_Kit Catalytic dom  97.5 8.1E-05 1.7E-09   53.7   2.5   40   59-99     19-58  (375)
 13 cd05105 PTKc_PDGFR_alpha Catal  97.5 0.00012 2.6E-09   53.6   3.4   34   66-99     27-60  (400)
 14 KOG2052|consensus               97.4 6.9E-05 1.5E-09   55.8   2.0   26   76-101   211-236 (513)
 15 KOG0196|consensus               97.3 9.1E-05   2E-09   58.5   1.5   29    1-29    867-895 (996)
 16 KOG0199|consensus               97.3  0.0001 2.2E-09   57.9   1.4   33   67-99    101-133 (1039)
 17 cd05111 PTK_HER3 Pseudokinase   97.3 0.00022 4.8E-09   49.0   2.7   33    1-33    244-276 (279)
 18 KOG0200|consensus               97.2 0.00022 4.8E-09   55.0   2.5   33   68-100   288-320 (609)
 19 KOG0192|consensus               97.1 0.00019   4E-09   52.4   0.9   34   68-101    33-66  (362)
 20 cd05089 PTKc_Tie1 Catalytic do  97.1 0.00034 7.5E-09   48.4   2.1   35    1-35    251-285 (297)
 21 cd05088 PTKc_Tie2 Catalytic do  97.1 0.00044 9.5E-09   48.2   2.5   43    1-43    256-298 (303)
 22 KOG4721|consensus               97.0 0.00032   7E-09   54.2   1.8   23    1-23    344-366 (904)
 23 KOG4257|consensus               97.0 0.00036 7.8E-09   54.4   1.6   31   68-98    381-411 (974)
 24 cd05093 PTKc_TrkB Catalytic do  97.0  0.0005 1.1E-08   47.4   2.2   32    1-32    255-286 (288)
 25 cd05098 PTKc_FGFR1 Catalytic d  96.9 0.00086 1.9E-08   46.7   3.1   32   68-99     10-41  (307)
 26 KOG1095|consensus               96.9 0.00066 1.4E-08   55.1   2.7   29   72-100   688-716 (1025)
 27 cd05094 PTKc_TrkC Catalytic do  96.8 0.00088 1.9E-08   46.2   2.2   32    1-32    258-289 (291)
 28 cd05106 PTKc_CSF-1R Catalytic   96.8 0.00081 1.8E-08   48.6   2.0   34   66-99     28-61  (374)
 29 KOG1026|consensus               96.8 0.00036 7.7E-09   55.0   0.1   32   69-100   479-510 (774)
 30 KOG4258|consensus               96.8 0.00021 4.7E-09   56.6  -1.1   43   56-99    973-1017(1025)
 31 cd05108 PTKc_EGFR Catalytic do  96.7   0.001 2.2E-08   46.5   2.1   32    1-32    244-275 (316)
 32 KOG0199|consensus               96.7 0.00077 1.7E-08   53.2   1.6   22    1-22    348-369 (1039)
 33 cd05100 PTKc_FGFR3 Catalytic d  96.6  0.0018 3.8E-08   45.7   2.6   32   68-99      4-35  (334)
 34 cd05109 PTKc_HER2 Catalytic do  96.6  0.0016 3.5E-08   44.5   2.3   31    1-31    244-274 (279)
 35 cd05110 PTKc_HER4 Catalytic do  96.5  0.0018 3.8E-08   45.1   2.2   32    1-32    244-275 (303)
 36 cd05057 PTKc_EGFR_like Catalyt  96.5   0.002 4.4E-08   44.0   2.4   31    1-31    244-274 (279)
 37 cd05053 PTKc_FGFR Catalytic do  96.4  0.0025 5.5E-08   43.8   2.5   32   68-99      4-35  (293)
 38 cd05099 PTKc_FGFR4 Catalytic d  96.3  0.0022 4.8E-08   44.8   1.9   31   68-98      4-34  (314)
 39 KOG1094|consensus               96.3  0.0035 7.6E-08   48.7   2.7   29   71-99    533-561 (807)
 40 PLN00113 leucine-rich repeat r  96.3  0.0026 5.6E-08   51.0   2.1   29    1-29    927-955 (968)
 41 PHA02882 putative serine/threo  96.2  0.0047   1E-07   42.9   3.0   27   73-99      9-35  (294)
 42 KOG4721|consensus               96.1  0.0011 2.4E-08   51.3  -0.5   32   68-99    116-147 (904)
 43 cd05101 PTKc_FGFR2 Catalytic d  96.1  0.0046   1E-07   42.9   2.4   31   68-98      7-37  (304)
 44 KOG1025|consensus               95.9  0.0056 1.2E-07   49.3   2.4   35    1-35    933-967 (1177)
 45 KOG0196|consensus               95.9  0.0035 7.5E-08   50.0   1.3   28   71-98    624-651 (996)
 46 cd05099 PTKc_FGFR4 Catalytic d  95.9  0.0067 1.4E-07   42.4   2.5   28    1-28    269-296 (314)
 47 KOG0194|consensus               95.9  0.0057 1.2E-07   46.2   2.2   29    1-29    396-424 (474)
 48 cd05100 PTKc_FGFR3 Catalytic d  95.8  0.0066 1.4E-07   42.8   2.2   28    1-28    269-296 (334)
 49 KOG0193|consensus               95.6  0.0077 1.7E-07   46.7   1.9   28    1-28    629-656 (678)
 50 PLN03224 probable serine/threo  95.3   0.018 3.9E-07   43.9   3.1   25   73-97    142-166 (507)
 51 cd05061 PTKc_InsR Catalytic do  95.3    0.01 2.2E-07   40.9   1.6   27    1-27    254-280 (288)
 52 cd05055 PTKc_PDGFR Catalytic d  95.2   0.013 2.9E-07   40.7   2.0   33   66-98     25-57  (302)
 53 KOG1023|consensus               95.2  0.0095 2.1E-07   45.1   1.3   28    1-28    200-227 (484)
 54 KOG0694|consensus               95.1   0.022 4.7E-07   44.6   3.0   29   73-101   365-393 (694)
 55 PLN03225 Serine/threonine-prot  95.0   0.025 5.4E-07   43.5   3.2   30   70-99    126-155 (566)
 56 KOG1025|consensus               95.0    0.01 2.2E-07   47.8   1.1   22   77-98    697-718 (1177)
 57 cd06650 PKc_MEK1 Catalytic dom  94.9   0.011 2.4E-07   41.9   0.9   21    1-21    279-299 (333)
 58 cd08216 PK_STRAD Pseudokinase   94.9    0.01 2.2E-07   41.2   0.7   21    1-21    275-295 (314)
 59 cd06649 PKc_MEK2 Catalytic dom  94.9   0.011 2.3E-07   41.8   0.8   21    1-21    281-301 (331)
 60 cd06640 STKc_MST4 Catalytic do  94.5   0.016 3.4E-07   39.6   0.9   21    1-21    233-253 (277)
 61 PTZ00426 cAMP-dependent protei  94.5   0.048   1E-06   38.9   3.4   29   71-99     25-53  (340)
 62 cd06616 PKc_MKK4 Catalytic dom  94.5   0.013 2.7E-07   40.2   0.3   21    1-21    247-267 (288)
 63 cd06621 PKc_MAPKK_Pek1_like Ca  94.2    0.02 4.3E-07   39.4   1.0   21    1-21    246-266 (287)
 64 cd06607 STKc_TAO Catalytic dom  94.1   0.021 4.5E-07   39.7   0.8   21    1-21    247-267 (307)
 65 cd06642 STKc_STK25-YSK1 Cataly  94.0   0.029 6.3E-07   38.2   1.4   21    1-21    233-253 (277)
 66 KOG1163|consensus               94.0   0.048   1E-06   38.5   2.5   26   73-98     12-37  (341)
 67 cd06618 PKc_MKK7 Catalytic dom  94.0   0.018 3.9E-07   39.7   0.4   21    1-21    253-273 (296)
 68 cd06618 PKc_MKK7 Catalytic dom  93.9   0.051 1.1E-06   37.5   2.5   31   68-98      7-37  (296)
 69 cd06643 STKc_SLK Catalytic dom  93.9   0.018   4E-07   39.3   0.3   20    1-20    242-261 (282)
 70 KOG0595|consensus               93.9   0.036 7.9E-07   41.1   1.8   19   80-98     14-32  (429)
 71 KOG0605|consensus               93.9   0.036 7.7E-07   42.4   1.8   27   73-99    138-164 (550)
 72 cd06634 STKc_TAO2 Catalytic do  93.7   0.029 6.3E-07   39.1   1.0   21    1-21    247-267 (308)
 73 cd06615 PKc_MEK Catalytic doma  93.6   0.024 5.2E-07   39.5   0.4   21    1-21    267-287 (308)
 74 PTZ00036 glycogen synthase kin  93.6   0.078 1.7E-06   39.3   3.1   26   73-98     63-88  (440)
 75 cd06644 STKc_STK10_LOK Catalyt  93.6   0.033 7.3E-07   38.3   1.1   20    1-20    249-268 (292)
 76 cd06647 STKc_PAK_I Catalytic d  93.5   0.025 5.5E-07   39.1   0.4   21    1-21    249-269 (293)
 77 KOG0580|consensus               93.4   0.043 9.4E-07   38.4   1.4   28   69-98     17-44  (281)
 78 cd06654 STKc_PAK1 Catalytic do  93.3    0.04 8.8E-07   38.2   1.2   20    1-20    250-269 (296)
 79 cd08226 PK_STRAD_beta Pseudoki  93.3   0.038 8.2E-07   38.9   1.0   21    1-21    288-308 (328)
 80 PTZ00263 protein kinase A cata  93.2     0.1 2.2E-06   36.9   3.1   29   69-99     13-41  (329)
 81 cd06655 STKc_PAK2 Catalytic do  93.2   0.031 6.6E-07   38.8   0.4   20    1-20    249-268 (296)
 82 cd08227 PK_STRAD_alpha Pseudok  93.2   0.029 6.2E-07   39.4   0.3   21    1-21    287-307 (327)
 83 cd06917 STKc_NAK1_like Catalyt  93.1   0.048   1E-06   37.0   1.3   20    1-20    235-254 (277)
 84 cd07841 STKc_CDK7 Catalytic do  93.0   0.048   1E-06   37.5   1.2   20    1-20    262-281 (298)
 85 cd06620 PKc_MAPKK_Byr1_like Ca  92.8   0.048   1E-06   37.4   1.0   21    1-21    246-266 (284)
 86 cd06641 STKc_MST3 Catalytic do  92.8   0.045 9.7E-07   37.4   0.8   20    2-21    234-253 (277)
 87 cd06635 STKc_TAO1 Catalytic do  92.8   0.047   1E-06   38.2   0.9   24    1-24    257-280 (317)
 88 KOG0658|consensus               92.8    0.11 2.3E-06   38.1   2.7   21   78-98     26-46  (364)
 89 cd06617 PKc_MKK3_6 Catalytic d  92.8   0.042 9.1E-07   37.4   0.6   20    1-20    241-260 (283)
 90 cd06611 STKc_SLK_like Catalyti  92.8   0.037 8.1E-07   37.7   0.4   21    1-21    242-262 (280)
 91 cd06622 PKc_MAPKK_PBS2_like Ca  92.7   0.055 1.2E-06   37.0   1.2   21    1-21    242-262 (286)
 92 PLN00034 mitogen-activated pro  92.7   0.039 8.5E-07   39.3   0.4   21    1-21    308-328 (353)
 93 cd07834 STKc_MAPK Catalytic do  92.6   0.049 1.1E-06   38.1   0.8   21    1-21    269-289 (330)
 94 cd05622 STKc_ROCK1 Catalytic d  92.6     0.1 2.3E-06   37.6   2.5   29   71-99     38-66  (371)
 95 PHA03210 serine/threonine kina  92.4    0.12 2.6E-06   39.0   2.7   22   77-98    149-170 (501)
 96 PRK09188 serine/threonine prot  92.4    0.13 2.8E-06   37.7   2.8   23   76-98     18-40  (365)
 97 cd06648 STKc_PAK_II Catalytic   92.3   0.043 9.2E-07   37.8   0.2   20    1-20    249-268 (285)
 98 cd06656 STKc_PAK3 Catalytic do  92.3   0.057 1.2E-06   37.4   0.8   20    1-20    249-268 (297)
 99 cd07849 STKc_ERK1_2_like Catal  92.2   0.046 9.9E-07   38.6   0.2   21    1-21    272-292 (336)
100 KOG0598|consensus               92.2    0.12 2.7E-06   37.7   2.4   26   73-98     22-47  (357)
101 PTZ00284 protein kinase; Provi  92.2    0.17 3.6E-06   37.6   3.2   24   75-98    128-151 (467)
102 cd06619 PKc_MKK5 Catalytic dom  92.0   0.051 1.1E-06   37.2   0.3   21    1-21    233-253 (279)
103 cd07859 STKc_TDY_MAPK_plant Ca  92.0   0.058 1.3E-06   37.8   0.6   20    1-20    270-289 (338)
104 PRK09605 bifunctional UGMP fam  92.0    0.11 2.4E-06   39.5   2.1   31   69-99    323-356 (535)
105 cd06609 STKc_MST3_like Catalyt  92.0   0.061 1.3E-06   36.5   0.6   20    1-20    231-250 (274)
106 cd06614 STKc_PAK Catalytic dom  91.9   0.073 1.6E-06   36.4   1.0   20    1-20    250-269 (286)
107 cd07858 STKc_TEY_MAPK_plant Ca  91.9   0.056 1.2E-06   38.2   0.4   21    1-21    271-291 (337)
108 cd05596 STKc_ROCK Catalytic do  91.5    0.14   3E-06   36.9   2.1   28   71-98     38-65  (370)
109 KOG1165|consensus               91.5   0.086 1.9E-06   38.8   1.0   21   76-96     28-48  (449)
110 cd07852 STKc_MAPK15 Catalytic   91.5   0.093   2E-06   37.0   1.1   21    1-21    275-295 (337)
111 cd07878 STKc_p38beta_MAPK11 Ca  91.5     0.1 2.2E-06   36.9   1.3   29   69-98      9-37  (343)
112 cd05621 STKc_ROCK2 Catalytic d  91.3    0.15 3.3E-06   36.8   2.1   27   73-99     40-66  (370)
113 cd05583 STKc_MSK_N N-terminal   91.2   0.072 1.6E-06   36.5   0.3   23    1-23    243-265 (288)
114 PHA03209 serine/threonine kina  91.1    0.22 4.7E-06   35.6   2.8   24   76-99     66-89  (357)
115 cd06646 STKc_MAP4K5 Catalytic   91.0    0.14 3.1E-06   34.5   1.7   24   75-98      8-31  (267)
116 KOG1164|consensus               91.0    0.18 3.8E-06   35.9   2.1   21   77-97     19-39  (322)
117 KOG0201|consensus               90.8    0.12 2.7E-06   38.7   1.3   17   82-98     19-35  (467)
118 cd06644 STKc_STK10_LOK Catalyt  90.8    0.13 2.9E-06   35.3   1.4   29   71-99      7-35  (292)
119 cd06658 STKc_PAK5 Catalytic do  90.8   0.086 1.9E-06   36.5   0.4   21    1-21    252-272 (292)
120 cd05609 STKc_MAST Catalytic do  90.6   0.084 1.8E-06   36.6   0.3   24    1-24    250-273 (305)
121 cd06633 STKc_TAO3 Catalytic do  90.5   0.087 1.9E-06   36.8   0.3   21    1-21    253-273 (313)
122 KOG3653|consensus               90.5   0.065 1.4E-06   40.7  -0.4   25   75-99    209-233 (534)
123 PTZ00283 serine/threonine prot  90.3    0.34 7.4E-06   36.6   3.3   24   75-98     31-54  (496)
124 cd07851 STKc_p38 Catalytic dom  90.3   0.096 2.1E-06   37.1   0.3   20    1-20    278-297 (343)
125 cd07855 STKc_ERK5 Catalytic do  90.2    0.11 2.4E-06   36.6   0.5   21    1-21    274-294 (334)
126 cd07879 STKc_p38delta_MAPK13 C  89.9    0.11 2.4E-06   36.8   0.4   21    1-21    277-297 (342)
127 cd06659 STKc_PAK6 Catalytic do  89.8    0.17 3.7E-06   35.1   1.3   21    1-21    251-271 (297)
128 cd07854 STKc_MAPK4_6 Catalytic  89.7    0.12 2.5E-06   36.7   0.3   20    1-20    280-299 (342)
129 PLN00034 mitogen-activated pro  89.7    0.14   3E-06   36.5   0.7   26   73-98     71-96  (353)
130 PTZ00283 serine/threonine prot  89.5    0.15 3.2E-06   38.6   0.8   21    1-21    277-297 (496)
131 cd06638 STKc_myosinIIIA Cataly  89.5    0.41 8.8E-06   32.6   2.9   26   73-98     15-40  (286)
132 cd07879 STKc_p38delta_MAPK13 C  89.4    0.44 9.6E-06   33.7   3.1   29   69-98      9-37  (342)
133 KOG0667|consensus               89.3    0.36 7.8E-06   37.6   2.7   21   79-99    189-209 (586)
134 cd07850 STKc_JNK Catalytic dom  89.2    0.13 2.9E-06   36.5   0.4   21    1-21    291-311 (353)
135 KOG1187|consensus               88.9    0.28   6E-06   35.8   1.8   19   81-99     80-98  (361)
136 PHA03207 serine/threonine kina  88.7     0.5 1.1E-05   34.3   3.0   26   74-99     90-115 (392)
137 KOG0591|consensus               88.4   0.065 1.4E-06   38.6  -1.6   22   75-96     18-39  (375)
138 cd07856 STKc_Sty1_Hog1 Catalyt  88.3    0.21 4.7E-06   35.2   0.9   20    1-20    268-287 (328)
139 cd07845 STKc_CDK10 Catalytic d  88.3    0.16 3.5E-06   35.2   0.3   20    1-20    270-289 (309)
140 cd07876 STKc_JNK2 Catalytic do  88.2     0.2 4.4E-06   35.7   0.7   21    1-21    295-315 (359)
141 PHA03212 serine/threonine kina  87.8    0.52 1.1E-05   34.4   2.6   26   73-98     89-114 (391)
142 cd07876 STKc_JNK2 Catalytic do  87.6    0.58 1.3E-05   33.3   2.8   21   78-98     23-43  (359)
143 cd07857 STKc_MPK1 Catalytic do  87.6    0.28 6.1E-06   34.5   1.2   20    1-20    272-291 (332)
144 cd06657 STKc_PAK4 Catalytic do  87.6    0.21 4.6E-06   34.6   0.5   20    1-20    250-269 (292)
145 cd07875 STKc_JNK1 Catalytic do  87.4    0.64 1.4E-05   33.2   2.9   22   77-98     25-46  (364)
146 cd07874 STKc_JNK3 Catalytic do  87.0    0.24 5.3E-06   35.1   0.5   21    1-21    291-311 (355)
147 PTZ00266 NIMA-related protein   86.9    0.83 1.8E-05   37.9   3.5   28   72-99      9-36  (1021)
148 cd05577 STKc_GRK Catalytic dom  86.6    0.19 4.1E-06   34.3  -0.2   17    1-17    229-245 (277)
149 KOG4236|consensus               86.5    0.33 7.2E-06   37.9   1.0   21   78-98    566-586 (888)
150 KOG1024|consensus               86.4    0.31 6.7E-06   36.7   0.8   30   69-98    277-306 (563)
151 KOG0696|consensus               86.4    0.56 1.2E-05   35.7   2.2   29   72-100   345-373 (683)
152 KOG0600|consensus               86.1    0.28 6.1E-06   37.6   0.5   21   77-97    118-138 (560)
153 cd07880 STKc_p38gamma_MAPK12 C  86.0    0.89 1.9E-05   32.2   3.0   28   70-98     10-37  (343)
154 PTZ00267 NIMA-related protein   86.0    0.36 7.7E-06   36.2   1.0   20    1-20    303-322 (478)
155 cd07874 STKc_JNK3 Catalytic do  86.0     0.8 1.7E-05   32.5   2.7   21   77-97     18-38  (355)
156 KOG0032|consensus               85.8    0.61 1.3E-05   34.4   2.2   23   77-99     36-58  (382)
157 cd07851 STKc_p38 Catalytic dom  85.8     1.1 2.3E-05   31.8   3.4   30   69-99      9-38  (343)
158 KOG0594|consensus               85.7    0.49 1.1E-05   34.3   1.6   25   75-99     10-34  (323)
159 cd05607 STKc_GRK7 Catalytic do  85.5    0.21 4.6E-06   34.1  -0.4   20    1-20    230-249 (277)
160 KOG0198|consensus               85.4    0.43 9.4E-06   34.4   1.2   23   76-98     17-39  (313)
161 PHA02988 hypothetical protein;  85.4    0.49 1.1E-05   32.6   1.4   30   70-99     12-43  (283)
162 PHA03211 serine/threonine kina  85.1    0.92   2E-05   34.1   2.8   23   77-99    170-192 (461)
163 KOG0660|consensus               85.1    0.58 1.3E-05   34.3   1.7   31   68-99     15-45  (359)
164 cd05144 RIO2_C RIO kinase fami  84.7    0.51 1.1E-05   30.9   1.2   18   81-98     20-37  (198)
165 PTZ00024 cyclin-dependent prot  84.6    0.46   1E-05   33.3   1.0   19    2-20    294-312 (335)
166 cd07877 STKc_p38alpha_MAPK14 C  84.4     1.2 2.5E-05   31.7   3.0   26   71-97     13-38  (345)
167 KOG0616|consensus               84.3    0.64 1.4E-05   33.7   1.6   24   75-98     43-66  (355)
168 cd06645 STKc_MAP4K3 Catalytic   84.0    0.26 5.6E-06   33.2  -0.5   25   75-99      8-32  (267)
169 cd07853 STKc_NLK Catalytic dom  84.0    0.37   8E-06   34.5   0.3   21    1-21    268-288 (372)
170 PTZ00024 cyclin-dependent prot  83.9    0.72 1.6E-05   32.4   1.7   26   73-98      6-31  (335)
171 cd07873 STKc_PCTAIRE1 Catalyti  83.9     0.4 8.7E-06   33.1   0.4   20    1-20    266-285 (301)
172 cd06654 STKc_PAK1 Catalytic do  83.8     1.3 2.9E-05   30.6   3.0   22   77-98     21-42  (296)
173 KOG0612|consensus               83.8     0.3 6.6E-06   40.8  -0.2   29   72-100    71-99  (1317)
174 cd06636 STKc_MAP4K4_6 Catalyti  83.5    0.66 1.4E-05   31.5   1.4   22   77-98     17-38  (282)
175 KOG4250|consensus               83.2    0.56 1.2E-05   37.2   1.0   19   79-97     16-34  (732)
176 cd05605 STKc_GRK4_like Catalyt  82.8    0.29 6.3E-06   33.6  -0.6   16    1-16    236-251 (285)
177 KOG1006|consensus               82.6    0.21 4.5E-06   35.8  -1.4   28   68-95     56-83  (361)
178 cd07872 STKc_PCTAIRE2 Catalyti  82.6    0.47   1E-05   32.9   0.4   20    1-20    266-285 (309)
179 cd07865 STKc_CDK9 Catalytic do  82.4     1.5 3.3E-05   30.0   2.8   23   77-99     13-35  (310)
180 KOG1152|consensus               82.2     1.1 2.5E-05   35.3   2.3   32   68-99    550-584 (772)
181 PHA03207 serine/threonine kina  82.0    0.58 1.2E-05   34.0   0.7   20    2-21    356-375 (392)
182 PLN00181 protein SPA1-RELATED;  81.9    0.59 1.3E-05   37.3   0.7   19    2-20    246-264 (793)
183 KOG1166|consensus               81.7     1.2 2.6E-05   36.7   2.4   29   69-97    691-719 (974)
184 KOG0583|consensus               81.3     1.3 2.7E-05   32.6   2.2   24   75-98     16-39  (370)
185 smart00090 RIO RIO-like kinase  81.3    0.91   2E-05   31.1   1.4   18   79-96     31-48  (237)
186 COG2112 Predicted Ser/Thr prot  81.2    0.63 1.4E-05   31.4   0.6   29   72-100    18-46  (201)
187 KOG0198|consensus               81.0    0.72 1.6E-05   33.3   0.8   21    2-22    257-277 (313)
188 PTZ00036 glycogen synthase kin  80.9    0.52 1.1E-05   34.9   0.1   21    1-21    331-351 (440)
189 cd06639 STKc_myosinIIIB Cataly  80.9     2.1 4.6E-05   29.2   3.2   23   76-98     22-44  (291)
190 cd06656 STKc_PAK3 Catalytic do  80.7     1.7 3.7E-05   30.0   2.6   20   79-98     22-41  (297)
191 PHA03212 serine/threonine kina  80.6    0.63 1.4E-05   34.0   0.5   20    1-20    356-375 (391)
192 KOG1989|consensus               80.6     1.6 3.5E-05   35.0   2.7   33   67-99     28-60  (738)
193 KOG0986|consensus               80.6     1.6 3.4E-05   33.6   2.5   27   72-98    181-207 (591)
194 cd07869 STKc_PFTAIRE1 Catalyti  80.4    0.62 1.3E-05   32.2   0.3   19    2-20    269-287 (303)
195 KOG0596|consensus               80.3     0.6 1.3E-05   36.4   0.3   20    1-20    607-626 (677)
196 KOG0576|consensus               80.1    0.64 1.4E-05   37.0   0.4   25   74-98     13-37  (829)
197 cd06635 STKc_TAO1 Catalytic do  80.1    0.91   2E-05   31.7   1.1   21   78-98     27-47  (317)
198 cd06647 STKc_PAK_I Catalytic d  80.0     1.8 3.9E-05   29.8   2.6   21   77-97     20-40  (293)
199 PF08247 ENOD40:  ENOD40 protei  79.9    0.54 1.2E-05   17.3  -0.1    8    1-8       1-8   (12)
200 KOG0663|consensus               79.9    0.96 2.1E-05   33.4   1.1   20   80-99     80-99  (419)
201 cd07878 STKc_p38beta_MAPK11 Ca  79.8    0.66 1.4E-05   32.7   0.3   19    2-20    279-297 (343)
202 cd05585 STKc_YPK1_like Catalyt  79.4    0.48   1E-05   33.1  -0.5   22    1-22    224-245 (312)
203 KOG1035|consensus               79.1    0.98 2.1E-05   38.1   1.1   16   81-96    484-499 (1351)
204 KOG0201|consensus               78.8     1.1 2.4E-05   33.8   1.3   21    1-21    243-263 (467)
205 cd05630 STKc_GRK6 Catalytic do  78.8    0.51 1.1E-05   32.5  -0.5   15    1-15    236-250 (285)
206 cd05632 STKc_GRK5 Catalytic do  78.6     0.6 1.3E-05   32.0  -0.2   16    1-16    236-251 (285)
207 KOG2052|consensus               78.6     1.3 2.8E-05   33.7   1.6   28    1-28    479-506 (513)
208 PTZ00284 protein kinase; Provi  78.0    0.86 1.9E-05   33.9   0.5   20    1-20    418-437 (467)
209 PLN00113 leucine-rich repeat r  77.4     1.6 3.5E-05   35.3   1.9   19   80-98    694-712 (968)
210 KOG0581|consensus               77.2     1.2 2.5E-05   32.8   0.9   29   72-100    75-103 (364)
211 cd05570 STKc_PKC Catalytic dom  76.9    0.64 1.4E-05   32.6  -0.4   15    1-15    227-241 (318)
212 cd07875 STKc_JNK1 Catalytic do  76.8     1.1 2.3E-05   32.0   0.7   19    2-20    299-317 (364)
213 cd05631 STKc_GRK4 Catalytic do  76.7    0.63 1.4E-05   31.9  -0.5   15    1-15    236-250 (285)
214 KOG0661|consensus               76.7     1.2 2.6E-05   34.1   0.9   20   79-98     13-32  (538)
215 cd05574 STKc_phototropin_like   76.4    0.86 1.9E-05   31.6   0.1   20    1-20    265-284 (316)
216 KOG0615|consensus               75.9     2.8   6E-05   31.7   2.6   23   76-98    172-194 (475)
217 cd06655 STKc_PAK2 Catalytic do  75.9     3.5 7.6E-05   28.5   3.1   21   77-97     20-40  (296)
218 cd06607 STKc_TAO Catalytic dom  75.5     2.1 4.5E-05   29.7   1.8   21   78-98     17-37  (307)
219 KOG0577|consensus               74.6     1.6 3.4E-05   34.8   1.1   17   82-98     32-48  (948)
220 KOG0669|consensus               74.3     0.3 6.4E-06   34.9  -2.6   19   81-99     22-40  (376)
221 PF03109 ABC1:  ABC1 family;  I  74.2     1.3 2.8E-05   27.2   0.5   17   82-98     17-33  (119)
222 cd07850 STKc_JNK Catalytic dom  72.8     4.2 9.2E-05   28.8   2.9   21   78-98     18-38  (353)
223 PTZ00266 NIMA-related protein   72.5     1.5 3.3E-05   36.4   0.6   20    1-20    275-294 (1021)
224 cd06633 STKc_TAO3 Catalytic do  72.5     3.2 6.9E-05   28.9   2.2   18   81-98     26-43  (313)
225 cd05572 STKc_cGK_PKG Catalytic  72.4     1.2 2.6E-05   29.9  -0.0   26    1-28    227-252 (262)
226 cd06657 STKc_PAK4 Catalytic do  72.3     2.7 5.8E-05   29.0   1.7   19   81-99     25-43  (292)
227 cd05582 STKc_RSK_N N-terminal   72.1     1.1 2.4E-05   31.2  -0.2   17    1-17    229-245 (318)
228 KOG1187|consensus               71.4     4.1 8.8E-05   29.8   2.6   24    2-25    329-352 (361)
229 TIGR01982 UbiB 2-polyprenylphe  70.9     2.5 5.3E-05   31.7   1.4   17   82-98    123-139 (437)
230 cd07877 STKc_p38alpha_MAPK14 C  70.2     1.6 3.5E-05   30.9   0.3   21    1-21    280-300 (345)
231 cd06648 STKc_PAK_II Catalytic   70.0     3.1 6.8E-05   28.5   1.7   21   78-98     21-41  (285)
232 cd07880 STKc_p38gamma_MAPK12 C  69.9     1.7 3.7E-05   30.8   0.3   19    2-20    279-297 (343)
233 KOG0608|consensus               69.5     4.4 9.6E-05   32.7   2.5   25   73-97    626-650 (1034)
234 cd07856 STKc_Sty1_Hog1 Catalyt  69.3     5.9 0.00013   27.9   3.0   27   71-98      6-32  (328)
235 cd06634 STKc_TAO2 Catalytic do  69.2     3.6 7.7E-05   28.6   1.8   21   78-98     17-37  (308)
236 KOG0661|consensus               69.2     2.1 4.5E-05   32.9   0.7   21    1-21    271-291 (538)
237 KOG0984|consensus               69.1     1.1 2.4E-05   31.2  -0.7   27   68-94     38-64  (282)
238 KOG0581|consensus               68.5     2.2 4.7E-05   31.5   0.6   20    2-21    316-335 (364)
239 cd05610 STKc_MASTL Catalytic d  68.4     1.9 4.2E-05   33.9   0.4   20    2-21    615-634 (669)
240 cd05600 STKc_Sid2p_Dbf2p Catal  68.4     1.9 4.1E-05   30.3   0.3   21    1-21    237-257 (333)
241 cd06659 STKc_PAK6 Catalytic do  68.0       2 4.3E-05   29.7   0.4   18   81-98     26-43  (297)
242 KOG1989|consensus               67.6     4.5 9.8E-05   32.6   2.2   28    1-28    287-314 (738)
243 KOG0575|consensus               67.6     4.4 9.5E-05   31.8   2.1   20   78-97     20-39  (592)
244 KOG0593|consensus               67.0     2.3   5E-05   31.1   0.5   20    1-20    264-283 (396)
245 PHA03390 pk1 serine/threonine-  66.7     4.3 9.3E-05   27.5   1.8   15   84-98     24-38  (267)
246 KOG0585|consensus               66.6     3.2 6.9E-05   32.0   1.2   22   76-97     97-118 (576)
247 PTZ00263 protein kinase A cata  66.2     1.8 3.9E-05   30.5  -0.1   14    1-14    246-259 (329)
248 KOG0610|consensus               65.9     1.5 3.4E-05   33.0  -0.5   29   72-100    73-101 (459)
249 cd05608 STKc_GRK1 Catalytic do  65.4     1.9 4.1E-05   29.5  -0.2   17    1-17    232-248 (280)
250 cd05618 STKc_aPKC_iota Catalyt  65.3     1.9   4E-05   30.5  -0.2   15    1-15    236-250 (329)
251 cd06614 STKc_PAK Catalytic dom  65.3     4.1 8.8E-05   27.7   1.5   21   78-98     21-41  (286)
252 KOG0592|consensus               65.2     3.6 7.7E-05   32.1   1.2   24   75-98     72-95  (604)
253 cd06658 STKc_PAK5 Catalytic do  65.1     2.6 5.6E-05   29.1   0.5   18   81-98     27-44  (292)
254 cd05601 STKc_CRIK Catalytic do  64.9     2.2 4.7E-05   29.9   0.0   18    2-20    245-262 (330)
255 cd05633 STKc_GRK3 Catalytic do  64.9     1.9 4.1E-05   29.5  -0.3   20    1-20    230-254 (279)
256 KOG3653|consensus               64.8     3.3 7.1E-05   31.8   1.0   27    1-27    479-505 (534)
257 cd05614 STKc_MSK2_N N-terminal  64.5     2.1 4.6E-05   30.0  -0.1   15    1-15    242-256 (332)
258 cd05571 STKc_PKB Catalytic dom  63.8     2.2 4.7E-05   29.9  -0.1   20    1-20    226-250 (323)
259 KOG0666|consensus               63.4     5.1 0.00011   29.6   1.7   17   81-97     29-45  (438)
260 cd05612 STKc_PRKX_like Catalyt  62.9     2.2 4.7E-05   29.4  -0.2   19    1-19    229-252 (291)
261 KOG0695|consensus               62.6     4.2   9E-05   30.4   1.1   33   68-100   242-274 (593)
262 KOG0582|consensus               61.9     3.8 8.1E-05   31.4   0.8   20    2-21    274-293 (516)
263 PTZ00267 NIMA-related protein   61.6     7.3 0.00016   29.2   2.3   22   77-98     68-89  (478)
264 cd05619 STKc_nPKC_theta Cataly  60.6     2.4 5.2E-05   29.7  -0.4   17    2-18    228-245 (316)
265 PF13095 FTA2:  Kinetochore Sim  60.2      21 0.00045   24.4   4.1   25   76-100    37-62  (207)
266 cd05620 STKc_nPKC_delta Cataly  59.2     2.5 5.3E-05   29.6  -0.5   16    1-16    227-242 (316)
267 KOG0584|consensus               59.1     4.5 9.6E-05   31.9   0.8   20   77-96     41-60  (632)
268 cd05580 STKc_PKA Catalytic dom  59.1     2.9 6.3E-05   28.6  -0.2   13    2-14    230-242 (290)
269 cd05573 STKc_ROCK_NDR_like Cat  58.8     3.3 7.1E-05   29.1   0.1   19    2-21    266-285 (350)
270 cd05592 STKc_nPKC_theta_delta   58.7     3.4 7.3E-05   28.9   0.1   16    1-16    227-242 (316)
271 KOG0614|consensus               58.4     3.9 8.5E-05   32.0   0.4   26   73-98    417-442 (732)
272 KOG0579|consensus               58.0    0.91   2E-05   36.4  -3.0   17   82-98     38-54  (1187)
273 cd05589 STKc_PKN Catalytic dom  57.8     3.5 7.7E-05   28.8   0.1   16    1-16    232-247 (324)
274 KOG0664|consensus               57.5     4.1 8.9E-05   29.6   0.4   19   76-94     53-71  (449)
275 PLN03225 Serine/threonine-prot  56.2     4.6 9.9E-05   31.3   0.5   20    2-21    431-450 (566)
276 cd05588 STKc_aPKC Catalytic do  54.4     3.8 8.1E-05   28.9  -0.2   15    1-15    236-250 (329)
277 KOG2345|consensus               53.9      14 0.00031   26.4   2.6   28   69-96     14-41  (302)
278 cd05595 STKc_PKB_beta Catalyti  53.7     2.9 6.3E-05   29.4  -0.9   20    1-20    226-250 (323)
279 PHA03210 serine/threonine kina  53.5     6.3 0.00014   29.8   0.8   19    2-20    435-453 (501)
280 cd05584 STKc_p70S6K Catalytic   53.5     4.4 9.6E-05   28.4   0.0   20    1-20    231-255 (323)
281 KOG0195|consensus               53.0     3.7   8E-05   29.8  -0.4   29   73-101   187-215 (448)
282 PRK04750 ubiB putative ubiquin  52.6     8.8 0.00019   29.8   1.5   17   82-98    125-141 (537)
283 cd05594 STKc_PKB_alpha Catalyt  52.0     3.8 8.2E-05   28.7  -0.5   21    1-21    227-252 (325)
284 PRK13184 pknD serine/threonine  51.7     9.4  0.0002   31.7   1.6   27    2-28    266-293 (932)
285 cd05586 STKc_Sck1_like Catalyt  51.3       5 0.00011   28.1  -0.0   16    1-16    229-244 (330)
286 cd05613 STKc_MSK1_N N-terminal  51.1     5.5 0.00012   27.1   0.2   15    1-15    243-257 (290)
287 cd05593 STKc_PKB_gamma Catalyt  50.4     4.6  0.0001   28.4  -0.3   21    1-21    226-251 (328)
288 KOG0671|consensus               49.4     7.5 0.00016   29.1   0.7   17   81-97     94-110 (415)
289 cd05590 STKc_nPKC_eta Catalyti  48.4     4.6  0.0001   28.3  -0.5   17    1-17    227-243 (320)
290 KOG0690|consensus               47.8     7.9 0.00017   28.9   0.6   26   73-98    165-190 (516)
291 KOG0574|consensus               47.3     1.6 3.5E-05   32.0  -3.0   20   78-97     35-54  (502)
292 KOG1345|consensus               46.4     5.9 0.00013   28.8  -0.2   23   78-100    26-48  (378)
293 cd05591 STKc_nPKC_epsilon Cata  45.3     6.5 0.00014   27.4  -0.2   16    1-16    227-242 (321)
294 cd05617 STKc_aPKC_zeta Catalyt  45.0     6.3 0.00014   27.7  -0.3   16    1-16    234-249 (327)
295 cd05587 STKc_cPKC Catalytic do  42.6       6 0.00013   27.7  -0.7   16    1-16    232-247 (324)
296 KOG1290|consensus               39.7      28  0.0006   27.2   2.4   24   73-96     75-98  (590)
297 PRK10359 lipopolysaccharide co  39.1      34 0.00073   23.7   2.6   23   75-97     30-52  (232)
298 KOG0983|consensus               38.5      11 0.00024   27.5   0.1   29   71-99     87-115 (391)
299 KOG1167|consensus               38.3     5.7 0.00012   29.9  -1.4   21   77-97     37-57  (418)
300 KOG4279|consensus               38.1      22 0.00049   29.3   1.7   15   83-97    582-596 (1226)
301 KOG4279|consensus               37.9      15 0.00032   30.3   0.7   25    1-27    812-836 (1226)
302 PF14531 Kinase-like:  Kinase-l  37.5      37 0.00081   24.3   2.7   23   77-99     13-35  (288)
303 KOG0586|consensus               37.4      26 0.00057   27.7   2.0   20   79-98     59-78  (596)
304 cd05606 STKc_beta_ARK Catalyti  37.1      14  0.0003   25.1   0.4   19    2-20    231-254 (278)
305 cd05575 STKc_SGK Catalytic dom  36.4     8.7 0.00019   26.9  -0.7   16    1-16    227-242 (323)
306 KOG0582|consensus               36.0      36 0.00079   26.3   2.5   31   68-98     18-48  (516)
307 KOG0578|consensus               34.5      18 0.00039   28.3   0.7   20    2-21    504-523 (550)
308 PF13220 DUF4028:  Protein of u  33.8      23  0.0005   19.0   0.9   14    9-22     38-51  (65)
309 PF08403 AA_permease_N:  Amino   33.3      42 0.00091   19.1   1.9   19    6-24     34-52  (74)
310 KOG0589|consensus               32.2      24 0.00052   26.8   1.0   21    1-21    238-258 (426)
311 cd05602 STKc_SGK1 Catalytic do  31.9      11 0.00024   26.3  -0.7   18    2-19    228-245 (325)
312 cd08313 Death_TNFR1 Death doma  30.9      32 0.00069   19.8   1.2   25    1-25     45-70  (80)
313 KOG1151|consensus               30.4     4.1   9E-05   31.5  -3.2   16   81-96    468-483 (775)
314 cd05604 STKc_SGK3 Catalytic do  29.4      13 0.00029   25.9  -0.7   18    1-18    227-244 (325)
315 PF04468 PSP1:  PSP1 C-terminal  28.3      66  0.0014   18.6   2.3   20    8-27     61-80  (88)
316 KOG0579|consensus               25.5      41 0.00088   27.6   1.3   20    2-21    270-289 (1187)
317 KOG0587|consensus               24.0      74  0.0016   26.6   2.5   18   80-97     23-40  (953)
318 smart00707 RPEL Repeat in Dros  23.9      51  0.0011   14.8   1.0   13    9-21      7-19  (26)
319 cd08784 Death_DRs Death Domain  23.1      55  0.0012   18.5   1.3   25    1-25     45-69  (79)
320 KOG0667|consensus               22.9      31 0.00068   27.2   0.3   21    1-21    482-502 (586)
321 KOG4645|consensus               22.7      45 0.00097   29.2   1.1   16   81-96   1240-1255(1509)
322 PF02173 pKID:  pKID domain;  I  21.7      73  0.0016   16.0   1.4   14   10-23     17-30  (41)
323 PF02755 RPEL:  RPEL repeat;  I  20.9      54  0.0012   14.7   0.7   11   10-20      8-18  (26)
324 cd05603 STKc_SGK2 Catalytic do  20.8      27 0.00058   24.3  -0.4   16    1-16    227-242 (321)
325 PF09039 HTH_Tnp_Mu_2:  Mu DNA   20.8   1E+02  0.0022   18.7   2.1   20    9-28     45-64  (108)
326 PF00531 Death:  Death domain;   20.3      29 0.00062   19.1  -0.3   26    1-26     46-71  (83)
327 PF09465 LBR_tudor:  Lamin-B re  20.2      79  0.0017   16.9   1.4   11   89-99      8-18  (55)

No 1  
>KOG0197|consensus
Probab=98.76  E-value=1.6e-09  Score=80.27  Aligned_cols=60  Identities=28%  Similarity=0.525  Sum_probs=48.6

Q ss_pred             ccccccccccccccccccC-----CCccCCCCCCCceeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         41 HSYYNMVSLSGEKLSNIMN-----DPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        41 ~~Y~~~~~~~~~~l~~~~~-----~p~~~~~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      .+|....++.+.++..++.     .|.......+.|+|+++++++.+.||+|+||+||+|.|+|.
T Consensus       166 ~~~~~~~~gl~~~l~~p~~~~~~~~p~~~~~~~d~wei~r~~l~l~~~LG~G~FG~V~~g~~~~~  230 (468)
T KOG0197|consen  166 NYYSKNADGLCTRLRDPCSKQGHTKPQTPDLARDPWEIPREELKLIRELGSGQFGEVWLGKWNGS  230 (468)
T ss_pred             hhhhccCcchhhcccCchhccCCCCCCCCccccCCeeecHHHHHHHHHhcCCccceEEEEEEcCC
Confidence            3555566778888877763     35544455899999999999999999999999999999986


No 2  
>KOG0193|consensus
Probab=98.29  E-value=1.6e-07  Score=71.42  Aligned_cols=33  Identities=27%  Similarity=0.640  Sum_probs=30.9

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      -..|+|+.+++.+++.||+|.||.||+|+|+|.
T Consensus       384 ~~~WeIp~~ev~l~~rIGsGsFGtV~Rg~whGd  416 (678)
T KOG0193|consen  384 LEEWEIPPEEVLLGERIGSGSFGTVYRGRWHGD  416 (678)
T ss_pred             ccccccCHHHhhccceeccccccceeecccccc
Confidence            377999999999999999999999999999983


No 3  
>KOG4278|consensus
Probab=98.19  E-value=1e-06  Score=68.18  Aligned_cols=62  Identities=24%  Similarity=0.313  Sum_probs=47.5

Q ss_pred             Cccccccccccccccccc---cCCCccCC--CCCCCceeeCCCeeEeceeccccCceEEEeEEecCC
Q psy15827         40 DHSYYNMVSLSGEKLSNI---MNDPVLNQ--KSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID  101 (101)
Q Consensus        40 ~~~Y~~~~~~~~~~l~~~---~~~p~~~~--~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~~  101 (101)
                      ++|....++++...|-.|   +++|.+-+  +..++||+.|.+|++...||-|+||+||.|.|+..+
T Consensus       226 VHHHStvADGLittLhYPApK~nKptvygvSPn~DkWEmeRtdItMkhKLGGGQYGeVYeGvWKkys  292 (1157)
T KOG4278|consen  226 VHHHSTVADGLITTLHYPAPKKNKPTVYGVSPNADKWEMERTDITMKHKLGGGQYGEVYEGVWKKYS  292 (1157)
T ss_pred             HhhccccccceeEeeeccCccCCCCceeeecCCcchhhccchheeeeeccCCCcccceeeeeeeccc
Confidence            345555667766666655   36676533  335899999999999999999999999999998653


No 4  
>KOG0194|consensus
Probab=98.19  E-value=1.4e-06  Score=65.21  Aligned_cols=32  Identities=38%  Similarity=0.712  Sum_probs=29.9

Q ss_pred             CCCCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         67 SDDKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        67 ~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      .++.|++.+++|++.+.||+|+||+||+|+++
T Consensus       148 ~r~~Wel~H~~v~l~kkLGeGaFGeV~~G~l~  179 (474)
T KOG0194|consen  148 PRQKWELSHSDIELGKKLGEGAFGEVFKGKLK  179 (474)
T ss_pred             cccccEEeccCccccceeecccccEEEEEEEE
Confidence            46779999999999999999999999999976


No 5  
>KOG1026|consensus
Probab=98.01  E-value=3.5e-06  Score=65.88  Aligned_cols=34  Identities=29%  Similarity=0.712  Sum_probs=30.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhccccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIE   34 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~~~   34 (101)
                      |..||+.+|.+||+|++|...|++..+....|.+
T Consensus       738 M~~CW~~~P~~RPsF~eI~~~L~~~~~~s~~~~~  771 (774)
T KOG1026|consen  738 MLECWNENPKRRPSFKEIHSRLQAWAQASPKYSS  771 (774)
T ss_pred             HHHHhhcCcccCCCHHHHHHHHHHHHhcCccccc
Confidence            8899999999999999999999999887655543


No 6  
>KOG4278|consensus
Probab=97.97  E-value=4e-06  Score=64.98  Aligned_cols=28  Identities=32%  Similarity=0.845  Sum_probs=26.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      |+.||++.|.+||+|++|+..|+.++..
T Consensus       499 MraCW~WsPsDRPsFaeiHqafEtmf~~  526 (1157)
T KOG4278|consen  499 MRACWNWSPSDRPSFAEIHQAFETMFSS  526 (1157)
T ss_pred             HHHHhcCCcccCccHHHHHHHHHHHhcc
Confidence            8899999999999999999999999874


No 7  
>KOG0200|consensus
Probab=97.92  E-value=6.8e-06  Score=63.24  Aligned_cols=35  Identities=37%  Similarity=0.913  Sum_probs=28.9

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhccccccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIELE   36 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~~~~~   36 (101)
                      |+.||+.+|.+||+|+++++.|+.++.. ..|.++.
T Consensus       555 M~~CW~~~p~~RP~F~~~~~~~~~~l~~-~~~~~~~  589 (609)
T KOG0200|consen  555 MKSCWNADPEDRPTFSECVEFFEKHLQD-ELYLDVE  589 (609)
T ss_pred             HHHHhCCCcccCCCHHHHHHHHHHHHHH-hhhhhhh
Confidence            8999999999999999999999997654 3444443


No 8  
>KOG0192|consensus
Probab=97.66  E-value=3.2e-05  Score=56.33  Aligned_cols=28  Identities=36%  Similarity=0.802  Sum_probs=25.9

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      |.+||+.||..||+|.+|+..|+.+...
T Consensus       279 ~~~CW~~dp~~RP~f~ei~~~l~~~~~~  306 (362)
T KOG0192|consen  279 MERCWLVDPSRRPSFLEIVSRLESIMSH  306 (362)
T ss_pred             HHHhCCCCCCcCCCHHHHHHHHHHHHHh
Confidence            6789999999999999999999988775


No 9  
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=97.60  E-value=3.8e-05  Score=56.31  Aligned_cols=35  Identities=37%  Similarity=0.703  Sum_probs=31.1

Q ss_pred             CCCCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         65 QKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        65 ~~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...+..|+++++++.+++.||+|+||.||+|++.|
T Consensus        26 ~~~~~~~~~~~~~~~~~~~lG~G~fG~Vy~~~~~~   60 (401)
T cd05107          26 LPYDSAWEMPRDNLVLGRTLGSGAFGRVVEATAHG   60 (401)
T ss_pred             CCCCCcceecHHHeehhhhccCCCceeEEEEEEcC
Confidence            34567799999999999999999999999999765


No 10 
>KOG4257|consensus
Probab=97.58  E-value=4e-05  Score=59.46  Aligned_cols=27  Identities=44%  Similarity=0.913  Sum_probs=25.7

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHh
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLL   27 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~   27 (101)
                      |.+||.++|.+||.|.+|...|..+++
T Consensus       625 mskcWayeP~kRPrftei~~~lsdv~q  651 (974)
T KOG4257|consen  625 MSKCWAYEPSKRPRFTEIKAILSDVLQ  651 (974)
T ss_pred             HHHHhccCcccCCcHHHHHHHHHHHHH
Confidence            789999999999999999999999887


No 11 
>KOG1095|consensus
Probab=97.50  E-value=0.00012  Score=59.09  Aligned_cols=29  Identities=24%  Similarity=0.685  Sum_probs=26.7

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNE   29 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~   29 (101)
                      |++||+.+|.+||+|..|++.+..+....
T Consensus       937 M~~CW~~~pe~RP~F~~i~~q~~~i~~~~  965 (1025)
T KOG1095|consen  937 MLQCWKHDPEDRPSFRTIVEQDPAISNAA  965 (1025)
T ss_pred             HHHHccCChhhCccHHHHHhhhhhhhhhh
Confidence            89999999999999999999998888754


No 12 
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=97.47  E-value=8.1e-05  Score=53.73  Aligned_cols=40  Identities=40%  Similarity=0.732  Sum_probs=33.4

Q ss_pred             CCCccCCCCCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         59 NDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        59 ~~p~~~~~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .+|. ..+.+..|+++++++.+.+.||+|+||.||++++.+
T Consensus        19 ~~~~-~~~~~~~~~~~~~~~~~~~~LG~G~fG~V~~~~~~~   58 (375)
T cd05104          19 IDPT-QLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYG   58 (375)
T ss_pred             ecCC-CCCCccccccchHHeehhheecCCccceEEEEEEec
Confidence            4454 445678899999999999999999999999998653


No 13 
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=97.46  E-value=0.00012  Score=53.62  Aligned_cols=34  Identities=41%  Similarity=0.769  Sum_probs=30.2

Q ss_pred             CCCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         66 KSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        66 ~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +....|+++++.+++++.||+|+||.||+|++.+
T Consensus        27 ~~~~~~~~~~~~~~~~~~LG~G~fG~Vy~~~~~~   60 (400)
T cd05105          27 PYDSRWEFPRDGLVLGRILGSGAFGKVVEGTAYG   60 (400)
T ss_pred             CCCCceeccccceehhheecCCCCceEEEEEEcc
Confidence            3467899999999999999999999999998653


No 14 
>KOG2052|consensus
Probab=97.45  E-value=6.9e-05  Score=55.78  Aligned_cols=26  Identities=38%  Similarity=0.804  Sum_probs=23.6

Q ss_pred             CCeeEeceeccccCceEEEeEEecCC
Q psy15827         76 QHIKVFDILGEGCFGQVWKCEALGID  101 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~~~g~~  101 (101)
                      ..|++.+.||+|.||+||+|.|.|-+
T Consensus       211 rqI~L~e~IGkGRyGEVwrG~wrGe~  236 (513)
T KOG2052|consen  211 RQIVLQEIIGKGRFGEVWRGRWRGED  236 (513)
T ss_pred             heeEEEEEecCccccceeeccccCCc
Confidence            47999999999999999999999853


No 15 
>KOG0196|consensus
Probab=97.34  E-value=9.1e-05  Score=58.48  Aligned_cols=29  Identities=41%  Similarity=0.913  Sum_probs=27.5

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNE   29 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~   29 (101)
                      |+.||+.|...||.|.+|+..|++++.+.
T Consensus       867 MldCWqkdR~~RP~F~qiV~~lDklIrnP  895 (996)
T KOG0196|consen  867 MLDCWQKDRNRRPKFAQIVSTLDKLIRNP  895 (996)
T ss_pred             HHHHHHHHhhcCCCHHHHHHHHHHHhcCc
Confidence            89999999999999999999999999874


No 16 
>KOG0199|consensus
Probab=97.30  E-value=0.0001  Score=57.89  Aligned_cols=33  Identities=36%  Similarity=0.602  Sum_probs=29.1

Q ss_pred             CCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         67 SDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        67 ~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .+..--|+.+.|++.+.||+|+||.|++|.|..
T Consensus       101 ~~lkclIpee~i~l~e~LG~GsFgvV~rg~Wt~  133 (1039)
T KOG0199|consen  101 IDLKCLIPEEQIKLYELLGEGSFGVVKRGTWTQ  133 (1039)
T ss_pred             CCcceeccHHHHHHHHHhcCcceeeEeeccccC
Confidence            345567999999999999999999999999974


No 17 
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=97.27  E-value=0.00022  Score=49.00  Aligned_cols=33  Identities=30%  Similarity=0.700  Sum_probs=28.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYI   33 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~~   33 (101)
                      +.+||..+|..|||+.++...|..+..+...|.
T Consensus       244 i~~c~~~~p~~Rps~~el~~~l~~~~~~~~~~~  276 (279)
T cd05111         244 MVKCWMIDENVRPTFKELANEFTRMARDPPRYL  276 (279)
T ss_pred             HHHHcCCCcccCcCHHHHHHHHHHHHhCCccee
Confidence            358999999999999999999999888765554


No 18 
>KOG0200|consensus
Probab=97.22  E-value=0.00022  Score=54.99  Aligned_cols=33  Identities=52%  Similarity=0.961  Sum_probs=30.2

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      +..|||+++.+.+.+.||+|+||.|++|..+|+
T Consensus       288 ~~~~e~~~~~l~~~~~lg~g~fG~v~~~~~~~~  320 (609)
T KOG0200|consen  288 DPKWEIPRENLKLGKYLGEGAFGQVVKALLFGL  320 (609)
T ss_pred             CCceeechhhccccceeecccccceEeEEEeec
Confidence            448999999999999999999999999998875


No 19 
>KOG0192|consensus
Probab=97.09  E-value=0.00019  Score=52.36  Aligned_cols=34  Identities=29%  Similarity=0.508  Sum_probs=30.9

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEecCC
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID  101 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~~  101 (101)
                      ...|+|+..++.+.+.||+|+||.||+|.|.|..
T Consensus        33 ~~~~~i~~~~l~~~~~iG~G~~g~V~~~~~~g~~   66 (362)
T KOG0192|consen   33 LPEEEIDPDELPIEEVLGSGSFGTVYKGKWRGTD   66 (362)
T ss_pred             ccceecChHHhhhhhhcccCCceeEEEEEeCCce
Confidence            4669999999999999999999999999999863


No 20 
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=97.07  E-value=0.00034  Score=48.45  Aligned_cols=35  Identities=31%  Similarity=0.775  Sum_probs=30.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcccccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIEL   35 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~~~~   35 (101)
                      +.+||+.+|.+||++.+|++.|..++.....++..
T Consensus       251 i~~~l~~~p~~Rp~~~~i~~~l~~~~~~~~~~~~~  285 (297)
T cd05089         251 MRQCWRDRPYERPPFAQISVQLSRMLEARKAYVNM  285 (297)
T ss_pred             HHHHcCCChhhCcCHHHHHHHHHHHHHhhcccccc
Confidence            46899999999999999999999999876665543


No 21 
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=97.06  E-value=0.00044  Score=48.17  Aligned_cols=43  Identities=28%  Similarity=0.719  Sum_probs=33.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcccccccccCCCCccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIELERFPDHSY   43 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~~~~~~~~~~~Y   43 (101)
                      +.+||+.+|.+||++.+++..|..+++....|......+...|
T Consensus       256 i~~~l~~~p~~Rp~~~~il~~l~~~~~~~~~~~~~~~~~~~~~  298 (303)
T cd05088         256 MRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTY  298 (303)
T ss_pred             HHHHcCCChhhCcCHHHHHHHHHHHHHhhhhhhhhhhhccCcc
Confidence            4689999999999999999999999887666655443333333


No 22 
>KOG4721|consensus
Probab=97.03  E-value=0.00032  Score=54.16  Aligned_cols=23  Identities=30%  Similarity=0.881  Sum_probs=21.6

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLE   23 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~   23 (101)
                      |++||+..|+.||+|++|+.+|+
T Consensus       344 ~Kqcw~sKpRNRPSFrqil~Hld  366 (904)
T KOG4721|consen  344 LKQCWNSKPRNRPSFRQILLHLD  366 (904)
T ss_pred             HHHHHhcCCCCCccHHHHHHHHh
Confidence            58999999999999999999986


No 23 
>KOG4257|consensus
Probab=96.98  E-value=0.00036  Score=54.39  Aligned_cols=31  Identities=32%  Similarity=0.547  Sum_probs=28.5

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      -.+.+|.|+.|++.+.||.|.||+||+|.+.
T Consensus       381 ~rnyel~Re~Itl~r~iG~GqFGdVy~gvYt  411 (974)
T KOG4257|consen  381 VRNYELRRELITLKRLIGEGQFGDVYKGVYT  411 (974)
T ss_pred             CCcceeehhhccHHHhhcCCcccceeeeEec
Confidence            3578999999999999999999999999975


No 24 
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=96.98  E-value=0.0005  Score=47.37  Aligned_cols=32  Identities=38%  Similarity=0.719  Sum_probs=27.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDY   32 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~   32 (101)
                      +.+||+.+|.+|||+.++...|+++......|
T Consensus       255 i~~~l~~~p~~Rpt~~~v~~~l~~~~~~~~~~  286 (288)
T cd05093         255 MLGCWQREPHMRLNIKEIHSLLQNLAKASPVY  286 (288)
T ss_pred             HHHHccCChhhCCCHHHHHHHHHHHHHhcccc
Confidence            36899999999999999999999888765444


No 25 
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=96.93  E-value=0.00086  Score=46.66  Aligned_cols=32  Identities=56%  Similarity=1.053  Sum_probs=28.6

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...|+++.+..++.+.||+|+||.||++++.+
T Consensus        10 ~~~~~~~~~~~~i~~~lg~G~~g~V~~~~~~~   41 (307)
T cd05098          10 DPRWEVPRDRLVLGKPLGEGCFGQVVMAEAIG   41 (307)
T ss_pred             CCcceeehHHeEEeeeeccCCCeeEEEeEEec
Confidence            45799999999999999999999999988654


No 26 
>KOG1095|consensus
Probab=96.92  E-value=0.00066  Score=55.06  Aligned_cols=29  Identities=34%  Similarity=0.822  Sum_probs=26.4

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      ++++..|++.+.||+|+||+||+|.+.+.
T Consensus       688 ~v~~~~v~l~~~lG~G~FG~VY~g~~~~~  716 (1025)
T KOG1095|consen  688 EVPRKNVTLLRVLGKGAFGEVYEGTYSDV  716 (1025)
T ss_pred             cCChhheEeeeeeccccccceEEEEEecC
Confidence            47899999999999999999999998764


No 27 
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=96.79  E-value=0.00088  Score=46.20  Aligned_cols=32  Identities=34%  Similarity=0.676  Sum_probs=27.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDY   32 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~   32 (101)
                      +.+||+.+|.+||++.++.+.|.++......|
T Consensus       258 i~~~l~~~P~~Rpt~~~v~~~l~~~~~~~~~~  289 (291)
T cd05094         258 MLGCWQREPQQRLNIKEIYKILHALGKATPIY  289 (291)
T ss_pred             HHHHcccChhhCcCHHHHHHHHHHHHhhcCcc
Confidence            36899999999999999999999887765444


No 28 
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=96.78  E-value=0.00081  Score=48.57  Aligned_cols=34  Identities=38%  Similarity=0.815  Sum_probs=29.9

Q ss_pred             CCCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         66 KSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        66 ~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +..+.|.++.++..+.+.||+|+||.||++++.+
T Consensus        28 ~~~~~~~~~~~~~~~~~~LG~G~fg~V~~~~~~~   61 (374)
T cd05106          28 PYNEKWEFPRDNLQFGKTLGAGAFGKVVEATAFG   61 (374)
T ss_pred             cccccccccHHHceehheecCCCcccEEEEEEec
Confidence            4467899999999999999999999999988643


No 29 
>KOG1026|consensus
Probab=96.76  E-value=0.00036  Score=54.99  Aligned_cols=32  Identities=44%  Similarity=0.771  Sum_probs=29.1

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      ...+|++.+|.+.+.||+|+||+||+|+..|.
T Consensus       479 ~~~~i~r~~i~~~~eLGegaFGkVf~a~~~~l  510 (774)
T KOG1026|consen  479 KVLEIPRSDIVFKEELGEGAFGKVFLAEAYGL  510 (774)
T ss_pred             ceeEechhheeehhhhcCchhhhhhhhhccCC
Confidence            44789999999999999999999999998765


No 30 
>KOG4258|consensus
Probab=96.76  E-value=0.00021  Score=56.61  Aligned_cols=43  Identities=33%  Similarity=0.556  Sum_probs=34.0

Q ss_pred             cccCCCcc--CCCCCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         56 NIMNDPVL--NQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        56 ~~~~~p~~--~~~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +..|+.+.  +.+..++||+.++ +++++.||+|+||.||.|..++
T Consensus       973 as~npey~~~~~yv~deWe~~r~-it~~relg~gsfg~Vy~g~~nn 1017 (1025)
T KOG4258|consen  973 ASVNPEYFSASDYVPDEWEVSRE-ITLGRELGQGSFGMVYEGNANN 1017 (1025)
T ss_pred             eecChHHhhcCCCChhHHHHHHH-HhhhhhhccCccceEEEecCCc
Confidence            33455543  2355799999999 9999999999999999998654


No 31 
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=96.72  E-value=0.001  Score=46.54  Aligned_cols=32  Identities=31%  Similarity=0.635  Sum_probs=27.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDY   32 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~   32 (101)
                      |.+||..+|.+||+|.+|...|..+..+...|
T Consensus       244 i~~cl~~~p~~Rps~~~l~~~l~~~~~~~~~~  275 (316)
T cd05108         244 MVKCWMIDADSRPKFRELIIEFSKMARDPQRY  275 (316)
T ss_pred             HHHHccCChhhCcCHHHHHHHHHHHHcCCchh
Confidence            46899999999999999999998887764433


No 32 
>KOG0199|consensus
Probab=96.71  E-value=0.00077  Score=53.16  Aligned_cols=22  Identities=36%  Similarity=0.943  Sum_probs=20.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLL   22 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l   22 (101)
                      |++||..+|.+||+|.+|++.+
T Consensus       348 mk~cWah~paDRptFsair~~~  369 (1039)
T KOG0199|consen  348 MKNCWAHNPADRPTFSAIREDL  369 (1039)
T ss_pred             HHHhccCCccccccHHHHHHhH
Confidence            7899999999999999998654


No 33 
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=96.57  E-value=0.0018  Score=45.72  Aligned_cols=32  Identities=53%  Similarity=0.976  Sum_probs=28.2

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ..+|++.....++.+.||+|+||.||++++.+
T Consensus         4 ~~~~~~~~~~~~i~~~ig~G~~g~v~~~~~~~   35 (334)
T cd05100           4 DPKWELSRTRLTLGKPLGEGCFGQVVMAEAIG   35 (334)
T ss_pred             CcccccCHhHeeecceeccccCCcEEEEEEec
Confidence            46799999999999999999999999987643


No 34 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=96.56  E-value=0.0016  Score=44.48  Aligned_cols=31  Identities=29%  Similarity=0.633  Sum_probs=26.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETD   31 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~   31 (101)
                      +.+||..||..||++.++...|..+..+...
T Consensus       244 i~~~l~~dp~~Rp~~~~l~~~l~~~~~~~~~  274 (279)
T cd05109         244 MVKCWMIDSECRPRFRELVDEFSRMARDPSR  274 (279)
T ss_pred             HHHHcCCChhhCcCHHHHHHHHHHhhcCCcC
Confidence            3589999999999999999998887665433


No 35 
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=96.51  E-value=0.0018  Score=45.06  Aligned_cols=32  Identities=28%  Similarity=0.686  Sum_probs=27.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDY   32 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~   32 (101)
                      |.+||..+|.+||++.+++..|..+.+....|
T Consensus       244 i~~c~~~~p~~Rp~~~~l~~~l~~~~~~~~~~  275 (303)
T cd05110         244 MVKCWMIDADSRPKFKELAAEFSRMARDPQRY  275 (303)
T ss_pred             HHHHcCCChhhCcCHHHHHHHHHHHHhchhhh
Confidence            46899999999999999999999887764433


No 36 
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=96.50  E-value=0.002  Score=44.01  Aligned_cols=31  Identities=26%  Similarity=0.606  Sum_probs=26.8

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETD   31 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~   31 (101)
                      +.+||..+|.+||++.++...|..+..+...
T Consensus       244 ~~~~l~~~p~~Rp~~~~l~~~l~~~~~~~~~  274 (279)
T cd05057         244 LVKCWMIDAESRPTFKELINEFSKMARDPQR  274 (279)
T ss_pred             HHHHcCCChhhCCCHHHHHHHHHHHHhCCcc
Confidence            3689999999999999999999998776433


No 37 
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=96.43  E-value=0.0025  Score=43.78  Aligned_cols=32  Identities=53%  Similarity=0.963  Sum_probs=28.8

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +..|++++++..+.+.||+|.||.||++.+.+
T Consensus         4 ~~~~~~~~~~~~~~~~ig~g~~g~v~~~~~~~   35 (293)
T cd05053           4 DPEWELPRDRLTLGKPLGEGAFGQVVKAEAVG   35 (293)
T ss_pred             CcccccCHhHeEEeeEecccccccEEEEEEec
Confidence            45699999999999999999999999998764


No 38 
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=96.35  E-value=0.0022  Score=44.78  Aligned_cols=31  Identities=55%  Similarity=1.000  Sum_probs=27.9

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +..|.++.+.+++.+.||+|.||.||+++..
T Consensus         4 ~~~~~~~~~~~~~~~~lg~G~~g~vy~~~~~   34 (314)
T cd05099           4 DPKWEFPRDRLVLGKPLGEGCFGQVVRAEAY   34 (314)
T ss_pred             cccccccHHHeeeeeeecCCCcccEEEeeec
Confidence            5679999999999999999999999998753


No 39 
>KOG1094|consensus
Probab=96.28  E-value=0.0035  Score=48.66  Aligned_cols=29  Identities=41%  Similarity=0.794  Sum_probs=26.9

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      -|+||+.+++.+.||+|.||+|.+++..|
T Consensus       533 ~EfPRs~L~~~ekiGeGqFGEVhLCeveg  561 (807)
T KOG1094|consen  533 VEFPRSRLRFKEKIGEGQFGEVHLCEVEG  561 (807)
T ss_pred             hhcchhheehhhhhcCcccceeEEEEecC
Confidence            48999999999999999999999998765


No 40 
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=96.27  E-value=0.0026  Score=51.02  Aligned_cols=29  Identities=21%  Similarity=0.345  Sum_probs=25.6

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNE   29 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~   29 (101)
                      |.+||+.+|.+||++.++++.|+.+....
T Consensus       927 ~~~Cl~~~P~~RPt~~evl~~L~~~~~~~  955 (968)
T PLN00113        927 ALHCTATDPTARPCANDVLKTLESASRSS  955 (968)
T ss_pred             HHhhCcCCchhCcCHHHHHHHHHHhhccc
Confidence            35899999999999999999999887753


No 41 
>PHA02882 putative serine/threonine kinase; Provisional
Probab=96.21  E-value=0.0047  Score=42.86  Aligned_cols=27  Identities=22%  Similarity=0.485  Sum_probs=21.7

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEec
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +......+.+.||+|+||.||+|.+.+
T Consensus         9 i~~~~y~i~~~LG~G~fG~Vy~~~~~~   35 (294)
T PHA02882          9 ITGKEWKIDKLIGCGGFGCVYETQCAS   35 (294)
T ss_pred             cCCCceEEeeEEecCCCceEEEEEEcC
Confidence            344566678899999999999998764


No 42 
>KOG4721|consensus
Probab=96.15  E-value=0.0011  Score=51.32  Aligned_cols=32  Identities=28%  Similarity=0.606  Sum_probs=29.8

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .+-||||++.|.-.+.||+|+-|.||.|++++
T Consensus       116 ~e~WeiPFe~IsELeWlGSGaQGAVF~Grl~n  147 (904)
T KOG4721|consen  116 EELWEIPFEEISELEWLGSGAQGAVFLGRLHN  147 (904)
T ss_pred             hhhccCCHHHhhhhhhhccCcccceeeeeccC
Confidence            46699999999999999999999999999876


No 43 
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=96.08  E-value=0.0046  Score=42.88  Aligned_cols=31  Identities=52%  Similarity=0.936  Sum_probs=27.2

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...|++..++..+.+.||+|+||.||++++.
T Consensus         7 ~~~~~~~~~~~~~~~~lg~G~~g~Vy~~~~~   37 (304)
T cd05101           7 DPRWEFSRDKLTLGKPLGEGCFGQVVMAEAL   37 (304)
T ss_pred             CCcccccHHHeeecceeeccCCceEEEEEEe
Confidence            3458899999999999999999999998764


No 44 
>KOG1025|consensus
Probab=95.93  E-value=0.0056  Score=49.26  Aligned_cols=35  Identities=26%  Similarity=0.688  Sum_probs=30.5

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcccccccc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIEL   35 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~~~~~~~   35 (101)
                      |.+||..|+..||+|+++...+.++.++..-|+..
T Consensus       933 mvkCwmid~~~rp~fkel~~~fs~~ardpqryl~i  967 (1177)
T KOG1025|consen  933 MVKCWMIDADSRPTFKELAEEFSRMARDPQRYLVI  967 (1177)
T ss_pred             HHHHhccCcccCccHHHHHHHHHHHhcCcceEeee
Confidence            67999999999999999999999999876665544


No 45 
>KOG0196|consensus
Probab=95.92  E-value=0.0035  Score=49.96  Aligned_cols=28  Identities=25%  Similarity=0.424  Sum_probs=26.0

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      -||+...|.+.+.||+|.||+|++|+++
T Consensus       624 kEId~s~i~Ie~VIGaGEFGEVc~GrLk  651 (996)
T KOG0196|consen  624 KEIDPSCVKIEKVIGAGEFGEVCSGRLK  651 (996)
T ss_pred             hhcChhheEEEEEEecccccceeccccc
Confidence            4799999999999999999999999875


No 46 
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.89  E-value=0.0067  Score=42.38  Aligned_cols=28  Identities=39%  Similarity=0.889  Sum_probs=25.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      +.+||+.+|.+||++.++...|..+...
T Consensus       269 i~~cl~~~p~~Rps~~~ll~~l~~~~~~  296 (314)
T cd05099         269 MRECWHAVPTQRPTFKQLVEALDKVLAA  296 (314)
T ss_pred             HHHHcCCCcccCcCHHHHHHHHHHHHHH
Confidence            3689999999999999999999988764


No 47 
>KOG0194|consensus
Probab=95.86  E-value=0.0057  Score=46.20  Aligned_cols=29  Identities=34%  Similarity=0.762  Sum_probs=26.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhcc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLNE   29 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~~   29 (101)
                      |.+||..+|.+||+|.++.+.|+.+....
T Consensus       396 ~~~c~~~~p~~R~tm~~i~~~l~~~~~~~  424 (474)
T KOG0194|consen  396 MKQCWKKDPEDRPTMSTIKKKLEALEKKK  424 (474)
T ss_pred             HHHhccCChhhccCHHHHHHHHHHHHhcc
Confidence            57899999999999999999999887753


No 48 
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.80  E-value=0.0066  Score=42.81  Aligned_cols=28  Identities=36%  Similarity=0.831  Sum_probs=25.2

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      +.+||+.+|.+||++.+|+..|..+...
T Consensus       269 i~~cl~~~p~~Rps~~ell~~l~~~~~~  296 (334)
T cd05100         269 MRECWHAVPSQRPTFKQLVEDLDRVLTV  296 (334)
T ss_pred             HHHHcccChhhCcCHHHHHHHHHHHhhh
Confidence            4689999999999999999999988754


No 49 
>KOG0193|consensus
Probab=95.57  E-value=0.0077  Score=46.65  Aligned_cols=28  Identities=39%  Similarity=0.734  Sum_probs=25.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      +..||..++++||.|.+|...|..++..
T Consensus       629 l~~C~~~~~~eRP~F~~il~~l~~l~~~  656 (678)
T KOG0193|consen  629 LSDCWKFDREERPLFPQLLSKLEELLPS  656 (678)
T ss_pred             HHHHHhcCcccCccHHHHHHHHHHhhhc
Confidence            3579999999999999999999888774


No 50 
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=95.29  E-value=0.018  Score=43.89  Aligned_cols=25  Identities=24%  Similarity=0.379  Sum_probs=22.1

Q ss_pred             eeCCCeeEeceeccccCceEEEeEE
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      +..++..+.+.||+|+||.||+|..
T Consensus       142 ~~~d~F~i~~~LG~GgFG~VYkG~~  166 (507)
T PLN03224        142 WSSDDFQLRDKLGGGNFGITFEGLR  166 (507)
T ss_pred             ccccCceEeeEeecCCCeEEEEEEe
Confidence            4577888899999999999999975


No 51 
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=95.28  E-value=0.01  Score=40.86  Aligned_cols=27  Identities=41%  Similarity=0.837  Sum_probs=23.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHh
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLL   27 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~   27 (101)
                      +.+||+.+|.+|||+.++++.|.+.+.
T Consensus       254 i~~~l~~~p~~Rps~~~ll~~l~~~~~  280 (288)
T cd05061         254 MRMCWQFNPKMRPTFLEIVNLLKDDLH  280 (288)
T ss_pred             HHHHcCCChhHCcCHHHHHHHHHhhcC
Confidence            468999999999999999998876654


No 52 
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=95.19  E-value=0.013  Score=40.75  Aligned_cols=33  Identities=39%  Similarity=0.695  Sum_probs=28.3

Q ss_pred             CCCCCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         66 KSDDKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        66 ~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..+.+|++..++..+.+.||+|+||.||++...
T Consensus        25 ~~~~~~~~~~~~~~~~~~ig~G~~g~V~~~~~~   57 (302)
T cd05055          25 PYDLKWEFPRNNLSFGKTLGAGAFGKVVEATAY   57 (302)
T ss_pred             cccccccccHHHeEEcceeeccCCeeEEEEEEe
Confidence            334568899999999999999999999998753


No 53 
>KOG1023|consensus
Probab=95.18  E-value=0.0095  Score=45.13  Aligned_cols=28  Identities=21%  Similarity=0.577  Sum_probs=25.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      |.+||..+|.+||+|..|...+..+...
T Consensus       200 ~~~cw~e~P~~rPs~~~i~~~~~~~~~~  227 (484)
T KOG1023|consen  200 VARCWEEIPEKRPSIEQIRSKLLTINKG  227 (484)
T ss_pred             HHHhcccChhhCccHHHHHhhhhhhccc
Confidence            5789999999999999999998877764


No 54 
>KOG0694|consensus
Probab=95.08  E-value=0.022  Score=44.61  Aligned_cols=29  Identities=28%  Similarity=0.618  Sum_probs=25.3

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEecCC
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEALGID  101 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~g~~  101 (101)
                      +.-++.++.+.||.|+||.|+.+..+|++
T Consensus       365 ~~l~~F~~l~vLGkGsFGkV~lae~k~~~  393 (694)
T KOG0694|consen  365 LTLDDFRLLAVLGRGSFGKVLLAELKGTN  393 (694)
T ss_pred             ccccceEEEEEeccCcCceEEEEEEcCCC
Confidence            55578899999999999999999998764


No 55 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=95.03  E-value=0.025  Score=43.54  Aligned_cols=30  Identities=27%  Similarity=0.462  Sum_probs=24.8

Q ss_pred             CceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         70 KWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        70 ~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .+.+..++..+.+.||+|+||.||+|+...
T Consensus       126 ~~~~~~~~y~l~~~LG~G~FG~VYka~~~~  155 (566)
T PLN03225        126 RPSFKKDDFVLGKKLGEGAFGVVYKASLVN  155 (566)
T ss_pred             CCCCccCCeEEeEEEeeCCCeEEEEEEEcC
Confidence            344566788889999999999999998753


No 56 
>KOG1025|consensus
Probab=95.01  E-value=0.01  Score=47.84  Aligned_cols=22  Identities=36%  Similarity=0.614  Sum_probs=18.8

Q ss_pred             CeeEeceeccccCceEEEeEEe
Q psy15827         77 HIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ++...+.||+|+||.||+|.|.
T Consensus       697 elkk~kvLGsgAfGtV~kGiw~  718 (1177)
T KOG1025|consen  697 ELKKDKVLGSGAFGTVYKGIWI  718 (1177)
T ss_pred             hhhhhceeccccceeEEeeeEe
Confidence            4555689999999999999985


No 57 
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=94.89  E-value=0.011  Score=41.87  Aligned_cols=21  Identities=29%  Similarity=0.468  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.||.+|||+.+|..+
T Consensus       279 i~~~L~~~P~~Rpt~~ell~h  299 (333)
T cd06650         279 VNKCLIKNPAERADLKQLMVH  299 (333)
T ss_pred             HHHhccCCcccCcCHHHHhhC
Confidence            468999999999999999653


No 58 
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=94.89  E-value=0.01  Score=41.23  Aligned_cols=21  Identities=24%  Similarity=0.661  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..+|.+|||+.+++++
T Consensus       275 i~~~l~~~P~~Rpt~~~ll~~  295 (314)
T cd08216         275 VELCLQRDPESRPSASQLLNH  295 (314)
T ss_pred             HHHHhhcCCCcCcCHHHHhcC
Confidence            467999999999999988764


No 59 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=94.88  E-value=0.011  Score=41.84  Aligned_cols=21  Identities=29%  Similarity=0.490  Sum_probs=18.8

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..||++|||+.+|+.+
T Consensus       281 i~~~L~~~P~~Rpt~~ell~h  301 (331)
T cd06649         281 VNKCLIKNPAERADLKMLMNH  301 (331)
T ss_pred             HHHHccCCcccCCCHHHHhcC
Confidence            468999999999999999775


No 60 
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=94.50  E-value=0.016  Score=39.64  Aligned_cols=21  Identities=33%  Similarity=0.577  Sum_probs=18.5

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.+++..
T Consensus       233 i~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06640         233 IDACLNKDPSFRPTAKELLKH  253 (277)
T ss_pred             HHHHcccCcccCcCHHHHHhC
Confidence            368999999999999999765


No 61 
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=94.48  E-value=0.048  Score=38.90  Aligned_cols=29  Identities=21%  Similarity=0.337  Sum_probs=24.1

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +.+..++..+.+.||+|+||.||++.+.+
T Consensus        25 ~~~~~~~y~~~~~ig~G~~g~Vy~a~~~~   53 (340)
T PTZ00426         25 NKMKYEDFNFIRTLGTGSFGRVILATYKN   53 (340)
T ss_pred             CCCChhhcEEEEEEeecCCeEEEEEEEEC
Confidence            45666778888999999999999998654


No 62 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=94.46  E-value=0.013  Score=40.20  Aligned_cols=21  Identities=29%  Similarity=0.648  Sum_probs=18.6

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.+|.+|||+.+|+.+
T Consensus       247 i~~~l~~~p~~Rpt~~~i~~~  267 (288)
T cd06616         247 INLCLIKDESKRPKYKELLEH  267 (288)
T ss_pred             HHHHccCChhhCcCHHHHhcC
Confidence            468999999999999998764


No 63 
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=94.25  E-value=0.02  Score=39.39  Aligned_cols=21  Identities=24%  Similarity=0.586  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||..+|.+|||+.+|+++
T Consensus       246 i~~~l~~~p~~Rpt~~eil~~  266 (287)
T cd06621         246 IKQCLEKDPTRRPTPWDMLEH  266 (287)
T ss_pred             HHHHcCCCcccCCCHHHHHhC
Confidence            468999999999999998763


No 64 
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=94.11  E-value=0.021  Score=39.72  Aligned_cols=21  Identities=33%  Similarity=0.558  Sum_probs=18.6

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.+|+..
T Consensus       247 i~~~l~~~p~~Rp~~~~il~~  267 (307)
T cd06607         247 VDSCLQKIPQDRPSSEELLKH  267 (307)
T ss_pred             HHHHhcCChhhCcCHHHHhcC
Confidence            468999999999999999764


No 65 
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=94.03  E-value=0.029  Score=38.23  Aligned_cols=21  Identities=33%  Similarity=0.555  Sum_probs=18.6

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.+++.+
T Consensus       233 i~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06642         233 VEACLNKDPRFRPTAKELLKH  253 (277)
T ss_pred             HHHHccCCcccCcCHHHHHHh
Confidence            357999999999999999874


No 66 
>KOG1163|consensus
Probab=94.03  E-value=0.048  Score=38.55  Aligned_cols=26  Identities=19%  Similarity=0.475  Sum_probs=21.1

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      |--....+.+.||+|+||++|.|...
T Consensus        12 iv~gky~lvrkiGsGSFGdIy~~~~i   37 (341)
T KOG1163|consen   12 IVGGKYKLVRKIGSGSFGDIYLGISI   37 (341)
T ss_pred             eeccceEEEEeecCCchhheeeeeec
Confidence            44456778899999999999998753


No 67 
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=94.01  E-value=0.018  Score=39.74  Aligned_cols=21  Identities=29%  Similarity=0.619  Sum_probs=18.6

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.+|.+||++.+|+.+
T Consensus       253 i~~~l~~~p~~Rp~~~~il~~  273 (296)
T cd06618         253 VDLCLTKDHRKRPKYRELLQH  273 (296)
T ss_pred             HHHHccCChhhCCCHHHHhcC
Confidence            468999999999999999765


No 68 
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=93.92  E-value=0.051  Score=37.47  Aligned_cols=31  Identities=23%  Similarity=0.402  Sum_probs=26.9

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...|.+..+++.+.+.||+|+||.||++.+.
T Consensus         7 ~~~~~~~~~~~~~~~~lg~g~~~~v~~~~~~   37 (296)
T cd06618           7 GQKYPADLNDLENLGEIGSGTCGQVYKMRFK   37 (296)
T ss_pred             ceeccCCcchheeeeEeeccCCeEEEEEEEC
Confidence            3457788888999999999999999999986


No 69 
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=93.92  E-value=0.018  Score=39.31  Aligned_cols=20  Identities=25%  Similarity=0.371  Sum_probs=17.4

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||+.+|.+||++.+++.
T Consensus       242 i~~~l~~~p~~Rp~~~~il~  261 (282)
T cd06643         242 LKKCLEKNVDARWTTTQLLQ  261 (282)
T ss_pred             HHHHccCChhhCcCHHHHhc
Confidence            46899999999999988754


No 70 
>KOG0595|consensus
Probab=93.89  E-value=0.036  Score=41.13  Aligned_cols=19  Identities=26%  Similarity=0.431  Sum_probs=16.2

Q ss_pred             EeceeccccCceEEEeEEe
Q psy15827         80 VFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        80 ~~~~lG~G~fg~v~~g~~~   98 (101)
                      +.+.||+|+||.||+|+.+
T Consensus        14 ~~~~iG~GsfavVykg~h~   32 (429)
T KOG0595|consen   14 LSREIGSGSFAVVYKGRHK   32 (429)
T ss_pred             ehhhccCcceEEEEEeEec
Confidence            3555999999999999976


No 71 
>KOG0605|consensus
Probab=93.88  E-value=0.036  Score=42.38  Aligned_cols=27  Identities=19%  Similarity=0.521  Sum_probs=22.3

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEec
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +.-++..+.+.||+|+||+||.++-+.
T Consensus       138 ~~~~DFe~Lk~IgkGAfGeVrLarKk~  164 (550)
T KOG0605|consen  138 LSLDDFELLKVIGKGAFGEVRLARKKD  164 (550)
T ss_pred             CCcccchhheeeccccceeEEEEEEcc
Confidence            455677788899999999999988654


No 72 
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=93.73  E-value=0.029  Score=39.11  Aligned_cols=21  Identities=29%  Similarity=0.464  Sum_probs=18.5

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.+|.+||++.+++..
T Consensus       247 i~~cl~~~P~~Rp~~~~ll~~  267 (308)
T cd06634         247 VDSCLQKIPQDRPTSEVLLKH  267 (308)
T ss_pred             HHHHhhCCcccCCCHHHHhhC
Confidence            468999999999999998765


No 73 
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=93.59  E-value=0.024  Score=39.53  Aligned_cols=21  Identities=33%  Similarity=0.621  Sum_probs=18.5

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..+|.+||++.+|...
T Consensus       267 i~~~l~~~P~~Rpt~~~ll~~  287 (308)
T cd06615         267 VDKCLKKNPKERADLKELTKH  287 (308)
T ss_pred             HHHHccCChhhCcCHHHHhcC
Confidence            468999999999999998765


No 74 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=93.57  E-value=0.078  Score=39.29  Aligned_cols=26  Identities=31%  Similarity=0.672  Sum_probs=21.6

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      .+.....+.+.||+|+||.||+|...
T Consensus        63 ~~~~~y~~~~~LG~G~fg~Vy~~~~~   88 (440)
T PTZ00036         63 SPNKSYKLGNIIGNGSFGVVYEAICI   88 (440)
T ss_pred             CcCCeEEEeEEEEeCCCEEEEEEEEC
Confidence            44556778899999999999999864


No 75 
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=93.57  E-value=0.033  Score=38.27  Aligned_cols=20  Identities=30%  Similarity=0.562  Sum_probs=17.7

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||+.+|.+||++.++++
T Consensus       249 i~~~l~~~p~~Rp~~~~il~  268 (292)
T cd06644         249 LKTALDKHPETRPSAAQLLE  268 (292)
T ss_pred             HHHHhcCCcccCcCHHHHhc
Confidence            46899999999999998865


No 76 
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=93.50  E-value=0.025  Score=39.13  Aligned_cols=21  Identities=19%  Similarity=0.344  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..+|.+||+|.+|+.+
T Consensus       249 i~~~l~~~p~~Rp~~~~il~h  269 (293)
T cd06647         249 LNRCLEMDVEKRGSAKELLQH  269 (293)
T ss_pred             HHHHccCChhhCcCHHHHhcC
Confidence            468999999999999999764


No 77 
>KOG0580|consensus
Probab=93.39  E-value=0.043  Score=38.42  Aligned_cols=28  Identities=25%  Similarity=0.566  Sum_probs=22.0

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..|.|.  +..+++.||.|.||.||.|+.+
T Consensus        17 ~~~~l~--dfeigr~LgkgkFG~vYlarek   44 (281)
T KOG0580|consen   17 KTWTLD--DFEIGRPLGKGKFGNVYLAREK   44 (281)
T ss_pred             cccchh--hccccccccCCccccEeEeeec
Confidence            446554  5566899999999999999865


No 78 
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=93.30  E-value=0.04  Score=38.16  Aligned_cols=20  Identities=25%  Similarity=0.426  Sum_probs=18.1

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||..+|.+||++.+|+.
T Consensus       250 i~~~l~~~p~~Rpt~~eil~  269 (296)
T cd06654         250 LNRCLDMDVEKRGSAKELLQ  269 (296)
T ss_pred             HHHHCcCCcccCcCHHHHhh
Confidence            46899999999999999976


No 79 
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=93.26  E-value=0.038  Score=38.87  Aligned_cols=21  Identities=24%  Similarity=0.607  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..||.+|||+.+++++
T Consensus       288 i~~~l~~dP~~Rpta~e~l~~  308 (328)
T cd08226         288 VELCLQQDPEKRPSASSLLSH  308 (328)
T ss_pred             HHHHccCCcccCCCHHHHhhC
Confidence            468999999999999999653


No 80 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=93.23  E-value=0.1  Score=36.86  Aligned_cols=29  Identities=28%  Similarity=0.650  Sum_probs=22.7

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ..|.+  ++..+.+.||+|+||.||+++..+
T Consensus        13 ~~~~~--~~y~~~~~lg~G~~g~V~~~~~~~   41 (329)
T PTZ00263         13 SSWKL--SDFEMGETLGTGSFGRVRIAKHKG   41 (329)
T ss_pred             CCCCc--hheEEEEEEEecCCeEEEEEEECC
Confidence            34544  466778899999999999998764


No 81 
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=93.21  E-value=0.031  Score=38.82  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=17.9

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||..+|.+||++.+|+.
T Consensus       249 i~~~l~~dp~~Rpt~~~il~  268 (296)
T cd06655         249 LNRCLEMDVEKRGSAKELLQ  268 (296)
T ss_pred             HHHHhhcChhhCCCHHHHhh
Confidence            46899999999999999875


No 82 
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=93.17  E-value=0.029  Score=39.45  Aligned_cols=21  Identities=24%  Similarity=0.594  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.||.+|||+.+++.+
T Consensus       287 i~~~l~~dP~~Rpt~~ell~~  307 (327)
T cd08227         287 VEQCLQRNPDARPSASTLLNH  307 (327)
T ss_pred             HHHHHhhCchhcCCHHHHhcC
Confidence            368999999999999998763


No 83 
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=93.10  E-value=0.048  Score=37.04  Aligned_cols=20  Identities=40%  Similarity=0.617  Sum_probs=18.1

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||+.+|.+||++.++..
T Consensus       235 i~~~l~~~p~~R~~~~~il~  254 (277)
T cd06917         235 VAACLDEEPKERLSAEELLK  254 (277)
T ss_pred             HHHHcCCCcccCcCHHHHhh
Confidence            47899999999999999976


No 84 
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=93.01  E-value=0.048  Score=37.50  Aligned_cols=20  Identities=15%  Similarity=0.174  Sum_probs=17.9

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||+.+|.+|||+.+++.
T Consensus       262 i~~~l~~~P~~R~s~~e~l~  281 (298)
T cd07841         262 LQRLLTLNPNKRITARQALE  281 (298)
T ss_pred             HHHHhcCCcccCcCHHHHhh
Confidence            36899999999999999976


No 85 
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=92.85  E-value=0.048  Score=37.36  Aligned_cols=21  Identities=38%  Similarity=0.789  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.++...
T Consensus       246 i~~~l~~dp~~Rpt~~e~~~~  266 (284)
T cd06620         246 VDACLLKDPTERPTPQQLCAM  266 (284)
T ss_pred             HHHHhcCCcccCcCHHHHhcC
Confidence            368999999999999998765


No 86 
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=92.82  E-value=0.045  Score=37.36  Aligned_cols=20  Identities=40%  Similarity=0.581  Sum_probs=18.3

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      .+||+.+|.+||++.+++.+
T Consensus       234 ~~~l~~~p~~Rp~~~~~l~~  253 (277)
T cd06641         234 EACLNKEPSFRPTAKELLKH  253 (277)
T ss_pred             HHHccCChhhCcCHHHHHhC
Confidence            57999999999999999884


No 87 
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=92.81  E-value=0.047  Score=38.19  Aligned_cols=24  Identities=29%  Similarity=0.444  Sum_probs=20.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEK   24 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~   24 (101)
                      |.+||+.+|.+||++.+|..++-.
T Consensus       257 i~~~l~~~p~~Rpt~~~il~~~~~  280 (317)
T cd06635         257 VDSCLQKIPQDRPTSEELLKHMFV  280 (317)
T ss_pred             HHHHccCCcccCcCHHHHHhChhh
Confidence            367999999999999999886543


No 88 
>KOG0658|consensus
Probab=92.80  E-value=0.11  Score=38.10  Aligned_cols=21  Identities=24%  Similarity=0.618  Sum_probs=17.1

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +.-.+.+|+|+||.||+|...
T Consensus        26 ~~~~~liG~GsFg~Vyq~~~~   46 (364)
T KOG0658|consen   26 YEAVRLIGSGSFGVVYQAKLR   46 (364)
T ss_pred             EEeeEEEeecccceEEEEEEc
Confidence            334568899999999999865


No 89 
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=92.78  E-value=0.042  Score=37.37  Aligned_cols=20  Identities=40%  Similarity=0.718  Sum_probs=17.8

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||..+|.+||++.+|..
T Consensus       241 i~~~l~~~p~~Rp~~~~il~  260 (283)
T cd06617         241 VNKCLKKNYKERPNYPELLQ  260 (283)
T ss_pred             HHHHccCChhhCcCHHHHhc
Confidence            46899999999999999876


No 90 
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=92.78  E-value=0.037  Score=37.68  Aligned_cols=21  Identities=33%  Similarity=0.649  Sum_probs=18.2

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.+|.+||++.+++.+
T Consensus       242 i~~~l~~~p~~Rps~~~il~~  262 (280)
T cd06611         242 LKSCLVKDPDDRPTAAELLKH  262 (280)
T ss_pred             HHHHhccChhhCcCHHHHhcC
Confidence            468999999999999988663


No 91 
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=92.73  E-value=0.055  Score=36.96  Aligned_cols=21  Identities=33%  Similarity=0.732  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..+|.+||++.+|...
T Consensus       242 i~~~l~~~p~~Rp~~~~l~~~  262 (286)
T cd06622         242 VAKCLNKIPNRRPTYAQLLEH  262 (286)
T ss_pred             HHHHcccCcccCCCHHHHhcC
Confidence            468999999999999988763


No 92 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=92.73  E-value=0.039  Score=39.28  Aligned_cols=21  Identities=24%  Similarity=0.438  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..+|.+||++.+|+.+
T Consensus       308 i~~~l~~~P~~Rpt~~ell~h  328 (353)
T PLN00034        308 ISCCLQREPAKRWSAMQLLQH  328 (353)
T ss_pred             HHHHccCChhhCcCHHHHhcC
Confidence            468999999999999998763


No 93 
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=92.57  E-value=0.049  Score=38.10  Aligned_cols=21  Identities=14%  Similarity=0.026  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.+++.+
T Consensus       269 i~~~l~~~P~~Rpt~~~ll~~  289 (330)
T cd07834         269 LEKMLVFDPKKRITADEALAH  289 (330)
T ss_pred             HHHHccCChhhCCCHHHHHhC
Confidence            468999999999999998764


No 94 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=92.55  E-value=0.1  Score=37.62  Aligned_cols=29  Identities=21%  Similarity=0.444  Sum_probs=23.7

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +++..+..++.+.||+|+||.||+++...
T Consensus        38 ~~~~~~~y~i~~~lG~G~fg~Vy~~~~~~   66 (371)
T cd05622          38 LRMKAEDYEVVKVIGRGAFGEVQLVRHKS   66 (371)
T ss_pred             cCcchhhcEEEEEEeecCCeEEEEEEECC
Confidence            44556778888999999999999988653


No 95 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=92.42  E-value=0.12  Score=39.04  Aligned_cols=22  Identities=36%  Similarity=0.792  Sum_probs=18.1

Q ss_pred             CeeEeceeccccCceEEEeEEe
Q psy15827         77 HIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...+.+.||+|+||.||++.++
T Consensus       149 ~Y~ii~~LG~G~fG~Vyl~~~~  170 (501)
T PHA03210        149 HFRVIDDLPAGAFGKIFICALR  170 (501)
T ss_pred             ccEEEeEecCCCCcceEEEEEe
Confidence            4566789999999999988754


No 96 
>PRK09188 serine/threonine protein kinase; Provisional
Probab=92.37  E-value=0.13  Score=37.70  Aligned_cols=23  Identities=13%  Similarity=0.043  Sum_probs=19.2

Q ss_pred             CCeeEeceeccccCceEEEeEEe
Q psy15827         76 QHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +...+.+.||+|+||.||+|+..
T Consensus        18 ~~Y~~~~~IG~G~fg~Vy~a~~~   40 (365)
T PRK09188         18 ARFVETAVLKRDVFSTVERGYFA   40 (365)
T ss_pred             CCceEccEEeecCcEEEEEEEEc
Confidence            34566889999999999999864


No 97 
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=92.35  E-value=0.043  Score=37.78  Aligned_cols=20  Identities=20%  Similarity=0.338  Sum_probs=17.8

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||+.+|.+||++.+|+.
T Consensus       249 i~~~l~~~p~~Rpt~~~il~  268 (285)
T cd06648         249 LDRMLVRDPAQRATAAELLN  268 (285)
T ss_pred             HHHHcccChhhCcCHHHHcc
Confidence            46899999999999998875


No 98 
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=92.28  E-value=0.057  Score=37.41  Aligned_cols=20  Identities=20%  Similarity=0.401  Sum_probs=17.9

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||..+|.+||++.+|+.
T Consensus       249 i~~~l~~~p~~Rps~~~il~  268 (297)
T cd06656         249 LNRCLEMDVDRRGSAKELLQ  268 (297)
T ss_pred             HHHHccCChhhCcCHHHHhc
Confidence            36899999999999999876


No 99 
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=92.21  E-value=0.046  Score=38.57  Aligned_cols=21  Identities=14%  Similarity=0.085  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.+|.+||++.+++.+
T Consensus       272 i~~~l~~dP~~Rpt~~e~l~h  292 (336)
T cd07849         272 LDKMLTFNPHKRITVEEALAH  292 (336)
T ss_pred             HHHHcCCChhhCcCHHHHhcC
Confidence            468999999999999988764


No 100
>KOG0598|consensus
Probab=92.17  E-value=0.12  Score=37.69  Aligned_cols=26  Identities=23%  Similarity=0.666  Sum_probs=21.9

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +..++..+.+.||.|+||+|+.-+-+
T Consensus        22 ~~~~dF~~lkviGkG~fGkV~~Vrk~   47 (357)
T KOG0598|consen   22 VGPDDFEILKVIGKGSFGKVFQVRKK   47 (357)
T ss_pred             CChhheeeeeeeeccCCceEEEEEEc
Confidence            55678888999999999999987654


No 101
>PTZ00284 protein kinase; Provisional
Probab=92.17  E-value=0.17  Score=37.63  Aligned_cols=24  Identities=38%  Similarity=0.650  Sum_probs=19.6

Q ss_pred             CCCeeEeceeccccCceEEEeEEe
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      .....+.+.||+|+||.||++...
T Consensus       128 ~~~y~i~~~lG~G~fg~V~~a~~~  151 (467)
T PTZ00284        128 TQRFKILSLLGEGTFGKVVEAWDR  151 (467)
T ss_pred             CCcEEEEEEEEeccCEEEEEEEEc
Confidence            345667789999999999999754


No 102
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=92.05  E-value=0.051  Score=37.18  Aligned_cols=21  Identities=38%  Similarity=0.649  Sum_probs=18.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.+|.+||++.+++.+
T Consensus       233 i~~~l~~~P~~Rp~~~eil~~  253 (279)
T cd06619         233 ITQCMRKQPKERPAPENLMDH  253 (279)
T ss_pred             HHHHhhCChhhCCCHHHHhcC
Confidence            468999999999999988654


No 103
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=92.05  E-value=0.058  Score=37.75  Aligned_cols=20  Identities=20%  Similarity=0.290  Sum_probs=17.7

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||+.+|.+|||+.+++.
T Consensus       270 i~~~l~~~P~~Rpt~~e~l~  289 (338)
T cd07859         270 LERLLAFDPKDRPTAEEALA  289 (338)
T ss_pred             HHHHcCcCcccCCCHHHHhc
Confidence            46899999999999998875


No 104
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=92.02  E-value=0.11  Score=39.54  Aligned_cols=31  Identities=23%  Similarity=0.344  Sum_probs=23.8

Q ss_pred             CCceeeCCCeeE---eceeccccCceEEEeEEec
Q psy15827         69 DKWEVPRQHIKV---FDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        69 ~~w~i~~~~~~~---~~~lG~G~fg~v~~g~~~g   99 (101)
                      ..|+..+.....   .+.||+|+||.||+|.+.+
T Consensus       323 ~~~~~~~~~~~~~~~~~~iG~G~~g~Vy~~~~~~  356 (535)
T PRK09605        323 VTWIKEEEVKRRKIPDHLIGKGAEADIKKGEYLG  356 (535)
T ss_pred             eeeccccccccccCccceeccCCcEEEEEEeecC
Confidence            447666665544   6789999999999988765


No 105
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=91.97  E-value=0.061  Score=36.53  Aligned_cols=20  Identities=40%  Similarity=0.803  Sum_probs=17.7

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||..+|.+||++.+++.
T Consensus       231 l~~~l~~~p~~Rpt~~~il~  250 (274)
T cd06609         231 VSLCLNKDPKERPSAKELLK  250 (274)
T ss_pred             HHHHhhCChhhCcCHHHHhh
Confidence            36899999999999999966


No 106
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=91.91  E-value=0.073  Score=36.40  Aligned_cols=20  Identities=35%  Similarity=0.677  Sum_probs=17.9

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||+.+|.+||++.+|++
T Consensus       250 i~~~l~~~p~~Rpt~~~il~  269 (286)
T cd06614         250 LNKCLVKDPEKRPSAEELLQ  269 (286)
T ss_pred             HHHHhccChhhCcCHHHHhh
Confidence            46899999999999999976


No 107
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=91.86  E-value=0.056  Score=38.19  Aligned_cols=21  Identities=14%  Similarity=0.064  Sum_probs=18.6

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+|||+.+++.+
T Consensus       271 i~~~l~~~P~~Rps~~ell~h  291 (337)
T cd07858         271 LEKMLVFDPSKRITVEEALAH  291 (337)
T ss_pred             HHHHhcCChhhccCHHHHHcC
Confidence            468999999999999998775


No 108
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=91.55  E-value=0.14  Score=36.93  Aligned_cols=28  Identities=21%  Similarity=0.477  Sum_probs=22.6

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +.+..++..+.+.||+|+||.||+++..
T Consensus        38 ~~~~~~~y~~~~~lg~G~~g~Vy~~~~~   65 (370)
T cd05596          38 LRMKAEDFDVIKVIGRGAFGEVQLVRHK   65 (370)
T ss_pred             CCCCHHHcEEEEEEeeCCCEEEEEEEEC
Confidence            3455667778899999999999998764


No 109
>KOG1165|consensus
Probab=91.49  E-value=0.086  Score=38.76  Aligned_cols=21  Identities=33%  Similarity=0.615  Sum_probs=18.3

Q ss_pred             CCeeEeceeccccCceEEEeE
Q psy15827         76 QHIKVFDILGEGCFGQVWKCE   96 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~   96 (101)
                      -+-.+++.||+|+||+.+.|+
T Consensus        28 ~hyrVGkKIGeGsFG~lf~G~   48 (449)
T KOG1165|consen   28 PHYRVGKKIGEGSFGVLFLGK   48 (449)
T ss_pred             ccceeccccccCcceeeeccc
Confidence            356779999999999999986


No 110
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=91.48  E-value=0.093  Score=36.97  Aligned_cols=21  Identities=19%  Similarity=0.096  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+|||+.+++..
T Consensus       275 i~~~l~~~P~~Rps~~~il~~  295 (337)
T cd07852         275 LKKLLVFNPNKRLTAEEALEH  295 (337)
T ss_pred             HHHhccCCcccccCHHHHhhC
Confidence            367999999999999999764


No 111
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=91.48  E-value=0.1  Score=36.85  Aligned_cols=29  Identities=28%  Similarity=0.613  Sum_probs=21.9

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..|+++.. -.+.+.||+|+||.||++...
T Consensus         9 ~~~~~~~~-y~~~~~lg~G~~g~V~~~~~~   37 (343)
T cd07878           9 TVWEVPER-YQNLTPVGSGAYGSVCSAYDT   37 (343)
T ss_pred             HHhhhhhh-hhhheecccCCCeEEEEEEEC
Confidence            45777654 344678999999999998754


No 112
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=91.26  E-value=0.15  Score=36.81  Aligned_cols=27  Identities=22%  Similarity=0.471  Sum_probs=21.8

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEec
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      +..+..++.+.||+|+||.||+++...
T Consensus        40 ~~~~~y~~~~~lG~G~fg~Vy~~~~~~   66 (370)
T cd05621          40 MKAEDYDVVKVIGRGAFGEVQLVRHKS   66 (370)
T ss_pred             CCHHHCeEEEEEEecCCeEEEEEEECC
Confidence            445567778899999999999988653


No 113
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=91.21  E-value=0.072  Score=36.49  Aligned_cols=23  Identities=13%  Similarity=0.216  Sum_probs=19.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLE   23 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~   23 (101)
                      +.+||+.+|.+|||+.++.+.|.
T Consensus       243 i~~~l~~~p~~R~t~~~~~~~l~  265 (288)
T cd05583         243 IQKLLEKDPKKRLGANGADEIKN  265 (288)
T ss_pred             HHHHhcCCHhhccCcchHHHHhc
Confidence            36899999999999998876554


No 114
>PHA03209 serine/threonine kinase US3; Provisional
Probab=91.15  E-value=0.22  Score=35.65  Aligned_cols=24  Identities=25%  Similarity=0.329  Sum_probs=20.1

Q ss_pred             CCeeEeceeccccCceEEEeEEec
Q psy15827         76 QHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ....+.+.||+|+||.||+|+..+
T Consensus        66 ~~y~~~~~lg~G~~g~Vy~~~~~~   89 (357)
T PHA03209         66 LGYTVIKTLTPGSEGRVFVATKPG   89 (357)
T ss_pred             cCcEEEEEecCCCCeEEEEEEECC
Confidence            356677899999999999998764


No 115
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=91.03  E-value=0.14  Score=34.52  Aligned_cols=24  Identities=25%  Similarity=0.660  Sum_probs=19.7

Q ss_pred             CCCeeEeceeccccCceEEEeEEe
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..+.++.+.||+|+||.||+|+..
T Consensus         8 ~~~y~~~~~lg~g~~g~vy~~~~~   31 (267)
T cd06646           8 QHDYELIQRVGSGTYGDVYKARNL   31 (267)
T ss_pred             hhhcchhheeecCCCeEEEEEEEC
Confidence            345666789999999999999864


No 116
>KOG1164|consensus
Probab=90.96  E-value=0.18  Score=35.87  Aligned_cols=21  Identities=33%  Similarity=0.547  Sum_probs=17.5

Q ss_pred             CeeEeceeccccCceEEEeEE
Q psy15827         77 HIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      .-.+.+.||+|.||.||.+.-
T Consensus        19 ~~~i~~~iG~G~fG~V~~v~~   39 (322)
T KOG1164|consen   19 RYKLGKKIGEGGFGAVYLVSD   39 (322)
T ss_pred             ceEEeeeccccCCceEEEEEe
Confidence            445678999999999998873


No 117
>KOG0201|consensus
Probab=90.84  E-value=0.12  Score=38.73  Aligned_cols=17  Identities=35%  Similarity=0.833  Sum_probs=15.1

Q ss_pred             ceeccccCceEEEeEEe
Q psy15827         82 DILGEGCFGQVWKCEAL   98 (101)
Q Consensus        82 ~~lG~G~fg~v~~g~~~   98 (101)
                      +.||.|+||+||+|.-.
T Consensus        19 ~~IgrGsfG~Vyk~~d~   35 (467)
T KOG0201|consen   19 ELIGRGSFGEVYKAIDN   35 (467)
T ss_pred             hhccccccceeeeeeec
Confidence            78999999999999743


No 118
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=90.81  E-value=0.13  Score=35.28  Aligned_cols=29  Identities=28%  Similarity=0.487  Sum_probs=22.8

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      |-.+.+.-++.+.||+|.||.||+|+...
T Consensus         7 ~~~~~~~y~i~~~lg~g~~g~vy~~~~~~   35 (292)
T cd06644           7 DLDPNEVWEIIGELGDGAFGKVYKAKNKE   35 (292)
T ss_pred             ccCcchhhhhhheecCCCCeEEEEEEECC
Confidence            44555666778889999999999998654


No 119
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=90.76  E-value=0.086  Score=36.49  Aligned_cols=21  Identities=24%  Similarity=0.324  Sum_probs=18.2

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +..||..+|.+|||+.+++.+
T Consensus       252 i~~~l~~~P~~Rpt~~~il~~  272 (292)
T cd06658         252 LDLMLVREPSQRATAQELLQH  272 (292)
T ss_pred             HHHHccCChhHCcCHHHHhhC
Confidence            367999999999999998763


No 120
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=90.64  E-value=0.084  Score=36.61  Aligned_cols=24  Identities=13%  Similarity=0.117  Sum_probs=19.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEK   24 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~   24 (101)
                      |.+||+.+|.+||++..+.+.|+.
T Consensus       250 i~~~l~~~P~~R~~~~~~~~ll~~  273 (305)
T cd05609         250 ISRLLRQNPLERLGTGGAFEVKQH  273 (305)
T ss_pred             HHHHhccChhhccCccCHHHHHhC
Confidence            478999999999998777665543


No 121
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=90.52  E-value=0.087  Score=36.82  Aligned_cols=21  Identities=43%  Similarity=0.705  Sum_probs=18.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||+.+|.+||++.++...
T Consensus       253 i~~~l~~~P~~Rp~~~~~l~~  273 (313)
T cd06633         253 VDYCLQKIPQERPASAELLRH  273 (313)
T ss_pred             HHHHccCChhhCcCHHHHhcC
Confidence            467999999999999988753


No 122
>KOG3653|consensus
Probab=90.51  E-value=0.065  Score=40.67  Aligned_cols=25  Identities=28%  Similarity=0.731  Sum_probs=21.4

Q ss_pred             CCCeeEeceeccccCceEEEeEEec
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...|.+.+.||+|.||.||+|.+.+
T Consensus       209 l~pl~l~eli~~Grfg~V~KaqL~~  233 (534)
T KOG3653|consen  209 LDPLQLLELIGRGRFGCVWKAQLDN  233 (534)
T ss_pred             CCchhhHHHhhcCccceeehhhccC
Confidence            4577888899999999999998765


No 123
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=90.34  E-value=0.34  Score=36.60  Aligned_cols=24  Identities=21%  Similarity=0.356  Sum_probs=19.6

Q ss_pred             CCCeeEeceeccccCceEEEeEEe
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...-.+.+.||+|+||.||+++..
T Consensus        31 ~~rY~i~~~LG~G~fG~Vy~a~~~   54 (496)
T PTZ00283         31 AKKYWISRVLGSGATGTVLCAKRV   54 (496)
T ss_pred             CCCEEEEEEEecCCCEEEEEEEEc
Confidence            346667889999999999998764


No 124
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=90.27  E-value=0.096  Score=37.15  Aligned_cols=20  Identities=15%  Similarity=0.112  Sum_probs=17.5

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+|++.+|.+|||+.+|+.
T Consensus       278 i~~~l~~~P~~Rpt~~ell~  297 (343)
T cd07851         278 LEKMLVLDPDKRITAAEALA  297 (343)
T ss_pred             HHHhCCCChhhCCCHHHHhc
Confidence            36799999999999998865


No 125
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=90.20  E-value=0.11  Score=36.63  Aligned_cols=21  Identities=14%  Similarity=0.170  Sum_probs=18.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.+++.+
T Consensus       274 i~~~l~~~P~~Rpt~~~~l~~  294 (334)
T cd07855         274 LSQMLQFDPEERITVEQALQH  294 (334)
T ss_pred             HHHHccCChhhCcCHHHHHhC
Confidence            368999999999999988663


No 126
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=89.87  E-value=0.11  Score=36.79  Aligned_cols=21  Identities=14%  Similarity=0.099  Sum_probs=18.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.+++.+
T Consensus       277 i~~~l~~dP~~R~~~~e~l~h  297 (342)
T cd07879         277 LEKMLELDVDKRLTATEALEH  297 (342)
T ss_pred             HHHHcCCChhhCcCHHHHhcC
Confidence            367999999999999998653


No 127
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=89.83  E-value=0.17  Score=35.07  Aligned_cols=21  Identities=33%  Similarity=0.430  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+||..+|.+||++.+|+..
T Consensus       251 i~~~l~~~P~~Rps~~~ll~~  271 (297)
T cd06659         251 LERMLTREPQERATAQELLDH  271 (297)
T ss_pred             HHHHhcCCcccCcCHHHHhhC
Confidence            468999999999999998764


No 128
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=89.68  E-value=0.12  Score=36.70  Aligned_cols=20  Identities=15%  Similarity=0.014  Sum_probs=17.5

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||..+|.+|||+.+++.
T Consensus       280 i~~~L~~dP~~R~t~~ell~  299 (342)
T cd07854         280 LEQILTFNPMDRLTAEEALM  299 (342)
T ss_pred             HHHHhCCCchhccCHHHHhC
Confidence            46899999999999998865


No 129
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=89.67  E-value=0.14  Score=36.49  Aligned_cols=26  Identities=19%  Similarity=0.285  Sum_probs=21.3

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...+++.+.+.||+|.||.||+++..
T Consensus        71 ~~~~~~~~~~~lg~G~~g~V~~~~~~   96 (353)
T PLN00034         71 KSLSELERVNRIGSGAGGTVYKVIHR   96 (353)
T ss_pred             CCHHHHhhhhhccCCCCeEEEEEEEC
Confidence            34556777889999999999999865


No 130
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=89.54  E-value=0.15  Score=38.56  Aligned_cols=21  Identities=19%  Similarity=0.445  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||+.+|.+||++.+++.+
T Consensus       277 i~~~L~~dP~~RPs~~ell~~  297 (496)
T PTZ00283        277 VTALLSSDPKRRPSSSKLLNM  297 (496)
T ss_pred             HHHHcccChhhCcCHHHHHhC
Confidence            468999999999999998764


No 131
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=89.48  E-value=0.41  Score=32.59  Aligned_cols=26  Identities=23%  Similarity=0.585  Sum_probs=20.2

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...++..+.+.||+|.||.||+++..
T Consensus        15 ~~~~~~~~~~~lg~g~~~~vy~~~~~   40 (286)
T cd06638          15 DPSDTWEIIETIGKGTYGKVFKVLNK   40 (286)
T ss_pred             CcccceeeeeeeccCCCcEEEEEEEC
Confidence            34455566788999999999998754


No 132
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=89.39  E-value=0.44  Score=33.73  Aligned_cols=29  Identities=24%  Similarity=0.597  Sum_probs=22.7

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..|++... -...+.||+|+||.||+|...
T Consensus         9 ~~~~~~~~-y~~~~~ig~g~~g~v~~~~~~   37 (342)
T cd07879           9 TVWELPER-YTSLKQVGSGAYGSVCSAIDK   37 (342)
T ss_pred             hhhccccc-eEEEEEeeecCCeEEEEEEeC
Confidence            45777654 455789999999999999865


No 133
>KOG0667|consensus
Probab=89.27  E-value=0.36  Score=37.57  Aligned_cols=21  Identities=43%  Similarity=0.726  Sum_probs=17.3

Q ss_pred             eEeceeccccCceEEEeEEec
Q psy15827         79 KVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        79 ~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .+.+.||+|+||+|.++.-.+
T Consensus       189 ~V~e~LGkGtFGQVvk~~d~~  209 (586)
T KOG0667|consen  189 EVLEVLGKGSFGQVVKAYDHK  209 (586)
T ss_pred             EEEEEecccccceeEEEEecC
Confidence            447899999999999987544


No 134
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=89.17  E-value=0.13  Score=36.48  Aligned_cols=21  Identities=10%  Similarity=0.109  Sum_probs=18.2

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+|++.||.+|||+.+++.+
T Consensus       291 i~~~L~~dP~~R~t~~eiL~~  311 (353)
T cd07850         291 LSKMLVIDPEKRISVDDALQH  311 (353)
T ss_pred             HHHHcCCChhhCcCHHHHhcC
Confidence            468999999999999998753


No 135
>KOG1187|consensus
Probab=88.85  E-value=0.28  Score=35.83  Aligned_cols=19  Identities=37%  Similarity=0.650  Sum_probs=16.6

Q ss_pred             eceeccccCceEEEeEEec
Q psy15827         81 FDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~~g   99 (101)
                      .+.||+|.||.||+|...+
T Consensus        80 ~~~ig~Ggfg~VYkG~l~~   98 (361)
T KOG1187|consen   80 SNLIGEGGFGTVYKGVLSD   98 (361)
T ss_pred             hcceecCCCeEEEEEEECC
Confidence            3589999999999999865


No 136
>PHA03207 serine/threonine kinase US3; Provisional
Probab=88.73  E-value=0.5  Score=34.29  Aligned_cols=26  Identities=27%  Similarity=0.533  Sum_probs=20.5

Q ss_pred             eCCCeeEeceeccccCceEEEeEEec
Q psy15827         74 PRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        74 ~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      -.....+.+.||+|+||.||++...+
T Consensus        90 ~~~~y~i~~~Lg~G~~g~Vy~~~~~~  115 (392)
T PHA03207         90 VRMQYNILSSLTPGSEGEVFVCTKHG  115 (392)
T ss_pred             ccCceEEEEeecCCCCeEEEEEEEcC
Confidence            34456778899999999999987544


No 137
>KOG0591|consensus
Probab=88.43  E-value=0.065  Score=38.58  Aligned_cols=22  Identities=27%  Similarity=0.705  Sum_probs=17.9

Q ss_pred             CCCeeEeceeccccCceEEEeE
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCE   96 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~   96 (101)
                      ..+-.+.++||.|+||+||+..
T Consensus        18 l~~y~Il~~IG~GsFg~vykv~   39 (375)
T KOG0591|consen   18 LADYQILKKIGRGSFGEVYKVQ   39 (375)
T ss_pred             HHHHHHHHHHcCCcchheEEee
Confidence            3455667899999999999876


No 138
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=88.31  E-value=0.21  Score=35.22  Aligned_cols=20  Identities=15%  Similarity=0.074  Sum_probs=17.3

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||+.+|.+||++.+++.
T Consensus       268 i~~~l~~~P~~R~t~~ell~  287 (328)
T cd07856         268 LEKMLVFDPQKRISAAEALA  287 (328)
T ss_pred             HHHHcCCChhhCCCHHHHhc
Confidence            46899999999999988754


No 139
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=88.28  E-value=0.16  Score=35.17  Aligned_cols=20  Identities=15%  Similarity=0.305  Sum_probs=17.6

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+|++.||++|||..+++.
T Consensus       270 i~~ml~~dp~~R~t~~~il~  289 (309)
T cd07845         270 LNFLLMYDPKKRATAEEALE  289 (309)
T ss_pred             HHHHhcCChhhCcCHHHHhc
Confidence            46799999999999998875


No 140
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=88.19  E-value=0.2  Score=35.67  Aligned_cols=21  Identities=14%  Similarity=0.124  Sum_probs=18.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+|+..||.+|||+.+++.+
T Consensus       295 i~~mL~~dP~~R~t~~e~l~h  315 (359)
T cd07876         295 LSKMLVIDPDKRISVDEALRH  315 (359)
T ss_pred             HHHHhccCcccCCCHHHHhcC
Confidence            368999999999999988653


No 141
>PHA03212 serine/threonine kinase US3; Provisional
Probab=87.78  E-value=0.52  Score=34.41  Aligned_cols=26  Identities=12%  Similarity=0.365  Sum_probs=20.7

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +.+..-.+.+.||+|+||.||+++-.
T Consensus        89 ~~~~~y~~~~~lg~G~~g~V~~~~d~  114 (391)
T PHA03212         89 IEKAGFSILETFTPGAEGFAFACIDN  114 (391)
T ss_pred             cccCCcEEEEEEcCCCCeEEEEEEEC
Confidence            44556677889999999999998743


No 142
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=87.64  E-value=0.58  Score=33.31  Aligned_cols=21  Identities=19%  Similarity=0.240  Sum_probs=17.2

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      -.+.+.||+|+||.||+++..
T Consensus        23 y~~~~~lg~G~~g~V~~~~~~   43 (359)
T cd07876          23 YQQLKPIGSGAQGIVCAAFDT   43 (359)
T ss_pred             eEEEEEeecCCCEEEEEEEEc
Confidence            345789999999999998753


No 143
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=87.61  E-value=0.28  Score=34.48  Aligned_cols=20  Identities=15%  Similarity=0.182  Sum_probs=17.3

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+|++.+|.+|||+.+++.
T Consensus       272 i~~~l~~~P~~R~t~~~ll~  291 (332)
T cd07857         272 LEKLLAFDPTKRISVEEALE  291 (332)
T ss_pred             HHHHccCCcccCCCHHHHhc
Confidence            36899999999999998854


No 144
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=87.61  E-value=0.21  Score=34.55  Aligned_cols=20  Identities=20%  Similarity=0.300  Sum_probs=17.8

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||+.+|.+||++.++..
T Consensus       250 i~~~l~~~P~~R~~~~~ll~  269 (292)
T cd06657         250 LDRLLVRDPAQRATAAELLK  269 (292)
T ss_pred             HHHHHhCCcccCcCHHHHhc
Confidence            46899999999999999876


No 145
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=87.40  E-value=0.64  Score=33.16  Aligned_cols=22  Identities=18%  Similarity=0.247  Sum_probs=17.7

Q ss_pred             CeeEeceeccccCceEEEeEEe
Q psy15827         77 HIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...+.+.||+|+||.||++...
T Consensus        25 ~y~~~~~lg~G~~g~V~~~~~~   46 (364)
T cd07875          25 RYQNLKPIGSGAQGIVCAAYDA   46 (364)
T ss_pred             ceeEEEEeecCCCeEEEEEEEC
Confidence            4455789999999999998743


No 146
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=86.97  E-value=0.24  Score=35.15  Aligned_cols=21  Identities=14%  Similarity=0.104  Sum_probs=18.0

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+|+..||.+|||..+++.+
T Consensus       291 i~~mL~~dP~~Rps~~ell~h  311 (355)
T cd07874         291 LSKMLVIDPAKRISVDEALQH  311 (355)
T ss_pred             HHHHhcCCchhcCCHHHHhcC
Confidence            357999999999999998764


No 147
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=86.87  E-value=0.83  Score=37.88  Aligned_cols=28  Identities=25%  Similarity=0.431  Sum_probs=22.2

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ++.....++.+.||+|+||.||+++...
T Consensus         9 e~~l~~YeIl~kLG~GgFGtVYLAkdk~   36 (1021)
T PTZ00266          9 ESRLNEYEVIKKIGNGRFGEVFLVKHKR   36 (1021)
T ss_pred             ccccCCEEEEEEEecCCCeEEEEEEECC
Confidence            3445577778999999999999987643


No 148
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=86.59  E-value=0.19  Score=34.25  Aligned_cols=17  Identities=18%  Similarity=0.188  Sum_probs=14.7

Q ss_pred             ChhhcccCCCCCCCHHH
Q psy15827          1 MYYCWDKEPNERPNFTE   17 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~   17 (101)
                      +.+||+.+|.+||+|.+
T Consensus       229 i~~~l~~~p~~R~~~~~  245 (277)
T cd05577         229 CEALLQKDPEKRLGCRG  245 (277)
T ss_pred             HHHHccCChhHccCCCc
Confidence            46899999999997776


No 149
>KOG4236|consensus
Probab=86.47  E-value=0.33  Score=37.94  Aligned_cols=21  Identities=33%  Similarity=0.529  Sum_probs=16.8

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      |--.+.||+|+||.||.|+..
T Consensus       566 if~devLGSGQFG~VYgg~hR  586 (888)
T KOG4236|consen  566 IFADEVLGSGQFGTVYGGKHR  586 (888)
T ss_pred             hhhHhhccCCcceeeecceec
Confidence            334578999999999998764


No 150
>KOG1024|consensus
Probab=86.41  E-value=0.31  Score=36.72  Aligned_cols=30  Identities=23%  Similarity=0.434  Sum_probs=25.1

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ....+.+..+++...+-+|.||+||.|.|.
T Consensus       277 ~~l~v~r~Rv~l~~llqEGtFGri~~gI~~  306 (563)
T KOG1024|consen  277 QELTVQRCRVRLSCLLQEGTFGRIYRGIWR  306 (563)
T ss_pred             HhhhhhhhheechhhhhcCchhheeeeeec
Confidence            334577788888888999999999999886


No 151
>KOG0696|consensus
Probab=86.39  E-value=0.56  Score=35.70  Aligned_cols=29  Identities=28%  Similarity=0.556  Sum_probs=25.0

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      .|.-.+..+...||.|+||.|..++-+|+
T Consensus       345 ~i~~tDFnFl~VlGKGSFGKVlLaerkgt  373 (683)
T KOG0696|consen  345 RIKATDFNFLMVLGKGSFGKVLLAERKGT  373 (683)
T ss_pred             ceeecccceEEEeccCccceeeeecccCc
Confidence            56677888889999999999999988775


No 152
>KOG0600|consensus
Probab=86.14  E-value=0.28  Score=37.62  Aligned_cols=21  Identities=33%  Similarity=0.741  Sum_probs=16.8

Q ss_pred             CeeEeceeccccCceEEEeEE
Q psy15827         77 HIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      .-...+.||+|.||.||+++-
T Consensus       118 ~feki~kIGeGTyg~VYkAr~  138 (560)
T KOG0600|consen  118 SFEKIEKIGEGTYGQVYKARD  138 (560)
T ss_pred             HHHHHHHhcCcchhheeEeee
Confidence            344457899999999999873


No 153
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=86.04  E-value=0.89  Score=32.24  Aligned_cols=28  Identities=29%  Similarity=0.628  Sum_probs=20.9

Q ss_pred             CceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         70 KWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        70 ~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      .|+++.. -.+.+.||+|.||.||++...
T Consensus        10 ~~~~~~~-y~~~~~lg~G~~g~V~~~~~~   37 (343)
T cd07880          10 IWEVPDR-YRDLKQVGSGAYGTVCSALDR   37 (343)
T ss_pred             hhccccc-eEEEEEeeecCCeEEEEEEEC
Confidence            3666544 345678999999999998754


No 154
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=85.96  E-value=0.36  Score=36.17  Aligned_cols=20  Identities=25%  Similarity=0.318  Sum_probs=17.7

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||..+|.+||++.+++.
T Consensus       303 i~~~L~~dP~~Rps~~~~l~  322 (478)
T PTZ00267        303 LDPLLSKNPALRPTTQQLLH  322 (478)
T ss_pred             HHHHhccChhhCcCHHHHHh
Confidence            46899999999999999864


No 155
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=85.95  E-value=0.8  Score=32.50  Aligned_cols=21  Identities=19%  Similarity=0.278  Sum_probs=17.1

Q ss_pred             CeeEeceeccccCceEEEeEE
Q psy15827         77 HIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      .-.+.+.||+|+||.||++.-
T Consensus        18 ~y~~~~~lg~G~~g~V~~~~~   38 (355)
T cd07874          18 RYQNLKPIGSGAQGIVCAAYD   38 (355)
T ss_pred             ceeEEEEeeecCCEEEEEEEe
Confidence            445578899999999998864


No 156
>KOG0032|consensus
Probab=85.85  E-value=0.61  Score=34.41  Aligned_cols=23  Identities=30%  Similarity=0.546  Sum_probs=18.8

Q ss_pred             CeeEeceeccccCceEEEeEEec
Q psy15827         77 HIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...+++.||.|+||.|++++-+.
T Consensus        36 ~Y~l~~~lG~G~Fg~v~~~~~~~   58 (382)
T KOG0032|consen   36 KYELGRELGRGQFGVVYLCREKS   58 (382)
T ss_pred             cEEehhhhCCCCceEEEEEEecC
Confidence            45556899999999999988654


No 157
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=85.83  E-value=1.1  Score=31.75  Aligned_cols=30  Identities=30%  Similarity=0.593  Sum_probs=23.4

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ..|++..+ -.+.+.||+|.||.||+|+..+
T Consensus         9 ~~~~~~~~-y~~~~~ig~g~~g~vy~~~~~~   38 (343)
T cd07851           9 TVWEVPDR-YQNLSPVGSGAYGQVCSAFDTK   38 (343)
T ss_pred             ceecccCc-eEEEEEeccCCceEEEEEEECC
Confidence            45777665 4567899999999999998753


No 158
>KOG0594|consensus
Probab=85.73  E-value=0.49  Score=34.27  Aligned_cols=25  Identities=28%  Similarity=0.477  Sum_probs=19.1

Q ss_pred             CCCeeEeceeccccCceEEEeEEec
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .......+.||+|+||.||+|+-+.
T Consensus        10 ~~~~~~~eklGeGtyg~Vykar~~~   34 (323)
T KOG0594|consen   10 MFDYEKVEKLGEGTYGVVYKARSKR   34 (323)
T ss_pred             HHHHHHHHHhCCCCceEEEEEEEec
Confidence            3344556679999999999998653


No 159
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=85.51  E-value=0.21  Score=34.15  Aligned_cols=20  Identities=25%  Similarity=0.257  Sum_probs=17.1

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |.+||+.+|.+||+++++.+
T Consensus       230 i~~~L~~~P~~R~~~~~~~~  249 (277)
T cd05607         230 CRLFLAKKPEDRLGSREKND  249 (277)
T ss_pred             HHHHhccCHhhCCCCccchh
Confidence            46899999999999987754


No 160
>KOG0198|consensus
Probab=85.41  E-value=0.43  Score=34.38  Aligned_cols=23  Identities=26%  Similarity=0.450  Sum_probs=19.2

Q ss_pred             CCeeEeceeccccCceEEEeEEe
Q psy15827         76 QHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      .+...++.||+|+||.||++...
T Consensus        17 ~~~~~~~~lG~Gs~G~V~l~~~~   39 (313)
T KOG0198|consen   17 SNWSKGKLLGRGSFGSVYLATNK   39 (313)
T ss_pred             chhhhhccccCccceEEEEEEec
Confidence            34567889999999999998865


No 161
>PHA02988 hypothetical protein; Provisional
Probab=85.39  E-value=0.49  Score=32.63  Aligned_cols=30  Identities=10%  Similarity=0.049  Sum_probs=23.1

Q ss_pred             CceeeCCCeeEe--ceeccccCceEEEeEEec
Q psy15827         70 KWEVPRQHIKVF--DILGEGCFGQVWKCEALG   99 (101)
Q Consensus        70 ~w~i~~~~~~~~--~~lG~G~fg~v~~g~~~g   99 (101)
                      .+.|+.++|...  ..||+|.+|.||+|.+.|
T Consensus        12 ~~~i~~~~i~~~~~~~i~~g~~~~v~~~~~~~   43 (283)
T PHA02988         12 IKCIESDDIDKYTSVLIKENDQNSIYKGIFNN   43 (283)
T ss_pred             ceecCHHHcCCCCCeEEeeCCceEEEEEEECC
Confidence            345666666665  578999999999999876


No 162
>PHA03211 serine/threonine kinase US3; Provisional
Probab=85.07  E-value=0.92  Score=34.14  Aligned_cols=23  Identities=17%  Similarity=0.234  Sum_probs=18.9

Q ss_pred             CeeEeceeccccCceEEEeEEec
Q psy15827         77 HIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...+.+.||+|+||.||++....
T Consensus       170 gy~i~~~Lg~G~~G~Vy~a~~~~  192 (461)
T PHA03211        170 GFAIHRALTPGSEGCVFESSHPD  192 (461)
T ss_pred             CeEEEEEEccCCCeEEEEEEECC
Confidence            35567789999999999998754


No 163
>KOG0660|consensus
Probab=85.06  E-value=0.58  Score=34.30  Aligned_cols=31  Identities=23%  Similarity=0.532  Sum_probs=24.5

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...|+++...+. .+.||.|+||.|+.+.-..
T Consensus        15 ~~~~~i~~~y~~-~~~iG~GAyGvVcsA~~~~   45 (359)
T KOG0660|consen   15 GELFEIPRYYVL-IEPIGRGAYGVVCSAKDKR   45 (359)
T ss_pred             eeEEeccceecc-cccccCcceeeEEEEEEcC
Confidence            355788887776 6789999999999887543


No 164
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=84.69  E-value=0.51  Score=30.94  Aligned_cols=18  Identities=17%  Similarity=0.082  Sum_probs=15.7

Q ss_pred             eceeccccCceEEEeEEe
Q psy15827         81 FDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~~   98 (101)
                      .+.||+|+||.||++...
T Consensus        20 ~~~i~~G~~g~Vy~~~~~   37 (198)
T cd05144          20 GNQIGVGKESDVYLALDP   37 (198)
T ss_pred             CCccccCcceEEEEEEcC
Confidence            578999999999999764


No 165
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=84.60  E-value=0.46  Score=33.34  Aligned_cols=19  Identities=21%  Similarity=0.071  Sum_probs=17.1

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      .+||+.+|.+||++.+++.
T Consensus       294 ~~~l~~~P~~R~s~~~~l~  312 (335)
T PTZ00024        294 QSLLKLNPLERISAKEALK  312 (335)
T ss_pred             HHHcCCCchhccCHHHHhc
Confidence            5899999999999998875


No 166
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=84.35  E-value=1.2  Score=31.67  Aligned_cols=26  Identities=31%  Similarity=0.706  Sum_probs=20.2

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEE
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      |+++.. -.+.+.||+|+||.||++..
T Consensus        13 ~~~~~~-y~~~~~lg~G~~g~v~~~~~   38 (345)
T cd07877          13 WEVPER-YQNLSPVGSGAYGSVCAAFD   38 (345)
T ss_pred             hhccCc-eEEEEEeeecCCeEEEEEEE
Confidence            666544 45678999999999999864


No 167
>KOG0616|consensus
Probab=84.33  E-value=0.64  Score=33.69  Aligned_cols=24  Identities=29%  Similarity=0.475  Sum_probs=18.4

Q ss_pred             CCCeeEeceeccccCceEEEeEEe
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      -++....+.||.|+||.|..-+-+
T Consensus        43 l~dfe~~~tlGtGSFGrV~LVr~k   66 (355)
T KOG0616|consen   43 LQDFERLKTLGTGSFGRVHLVREK   66 (355)
T ss_pred             hhhhhheeeeccCccceEEEEEEc
Confidence            345566789999999999976643


No 168
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=84.03  E-value=0.26  Score=33.23  Aligned_cols=25  Identities=20%  Similarity=0.652  Sum_probs=19.4

Q ss_pred             CCCeeEeceeccccCceEEEeEEec
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .++..+.+.||+|.||.||+++..+
T Consensus         8 ~~~~~~~~~lg~g~~~~v~~~~~~~   32 (267)
T cd06645           8 QEDFELIQRIGSGTYGDVYKARNVN   32 (267)
T ss_pred             HHHHHHHHHhCCCCCeEEEEEEEcC
Confidence            3455567889999999999987643


No 169
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=83.97  E-value=0.37  Score=34.53  Aligned_cols=21  Identities=10%  Similarity=0.089  Sum_probs=17.9

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+|++.||.+|||+.+++.+
T Consensus       268 i~~mL~~dP~~R~t~~e~l~h  288 (372)
T cd07853         268 LCRMLVFDPDKRISAADALAH  288 (372)
T ss_pred             HHHhCCCChhhCcCHHHHhcC
Confidence            357999999999999988653


No 170
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=83.93  E-value=0.72  Score=32.37  Aligned_cols=26  Identities=31%  Similarity=0.403  Sum_probs=20.4

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +....+++.+.||+|.||.||++...
T Consensus         6 ~~~ry~~~~~~ig~G~~g~vy~~~~~   31 (335)
T PTZ00024          6 ISERYIQKGAHLGEGTYGKVEKAYDT   31 (335)
T ss_pred             cccchhhhhhcccCCCceeEEEEEEC
Confidence            44455666788999999999999754


No 171
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=83.87  E-value=0.4  Score=33.09  Aligned_cols=20  Identities=15%  Similarity=0.007  Sum_probs=17.2

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+|+..||.+|||..++..
T Consensus       266 i~~ml~~dp~~R~t~~eil~  285 (301)
T cd07873         266 LSKLLQFEGRKRISAEEAMK  285 (301)
T ss_pred             HHHHhcCCcccCcCHHHHhc
Confidence            36899999999999988865


No 172
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=83.82  E-value=1.3  Score=30.55  Aligned_cols=22  Identities=23%  Similarity=0.534  Sum_probs=17.5

Q ss_pred             CeeEeceeccccCceEEEeEEe
Q psy15827         77 HIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..++.+.||+|+||.||+|...
T Consensus        21 ~y~~~~~lg~g~~~~v~~~~~~   42 (296)
T cd06654          21 KYTRFEKIGQGASGTVYTAMDV   42 (296)
T ss_pred             ceeeEEEecCCCCeEEEEEEEC
Confidence            4455678999999999999754


No 173
>KOG0612|consensus
Probab=83.76  E-value=0.3  Score=40.76  Aligned_cols=29  Identities=17%  Similarity=0.474  Sum_probs=23.3

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      .+.+++..+.+.||.|+||+|..-+.+++
T Consensus        71 rl~~~DfeilKvIGrGaFGEV~lVr~k~t   99 (1317)
T KOG0612|consen   71 RLKAEDFEILKVIGRGAFGEVALVRHKST   99 (1317)
T ss_pred             hCCHHhhHHHHHhcccccceeEEEEeecc
Confidence            35667788889999999999997776543


No 174
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=83.53  E-value=0.66  Score=31.54  Aligned_cols=22  Identities=27%  Similarity=0.721  Sum_probs=17.5

Q ss_pred             CeeEeceeccccCceEEEeEEe
Q psy15827         77 HIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..++.+.||+|.||.||+|+..
T Consensus        17 ~~~~~~~lg~g~~~~v~~~~~~   38 (282)
T cd06636          17 IFELVEVVGNGTYGQVYKGRHV   38 (282)
T ss_pred             hhhhheeeccCCCeEEEEEEEc
Confidence            3344568999999999998864


No 175
>KOG4250|consensus
Probab=83.17  E-value=0.56  Score=37.24  Aligned_cols=19  Identities=32%  Similarity=0.704  Sum_probs=16.1

Q ss_pred             eEeceeccccCceEEEeEE
Q psy15827         79 KVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        79 ~~~~~lG~G~fg~v~~g~~   97 (101)
                      ...+.||+|+||.||+|+-
T Consensus        16 ~~~e~LG~Ga~g~V~rgrn   34 (732)
T KOG4250|consen   16 EMDERLGKGAFGNVYRGRN   34 (732)
T ss_pred             eehhhhcCCccceeeeecc
Confidence            4467899999999999983


No 176
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=82.78  E-value=0.29  Score=33.60  Aligned_cols=16  Identities=19%  Similarity=0.110  Sum_probs=13.3

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+||..||.+||++.
T Consensus       236 i~~~l~~~P~~R~~~~  251 (285)
T cd05605         236 CRQLLTKDPGFRLGCR  251 (285)
T ss_pred             HHHHccCCHHHhcCCC
Confidence            4689999999999544


No 177
>KOG1006|consensus
Probab=82.64  E-value=0.21  Score=35.81  Aligned_cols=28  Identities=21%  Similarity=0.395  Sum_probs=24.4

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEe
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKC   95 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g   95 (101)
                      ..-|++.++++.-...||.|+||.|.+=
T Consensus        56 ~~~~~F~~~~Lqdlg~iG~G~fG~V~KM   83 (361)
T KOG1006|consen   56 AHLHTFTSDNLQDLGEIGNGAFGTVNKM   83 (361)
T ss_pred             ccccccccchHHHHHHhcCCcchhhhhh
Confidence            4569999999998889999999999763


No 178
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=82.61  E-value=0.47  Score=32.92  Aligned_cols=20  Identities=15%  Similarity=0.081  Sum_probs=17.5

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+|+..||.+|||..++..
T Consensus       266 i~~~L~~dp~~R~t~~e~l~  285 (309)
T cd07872         266 LTKFLQYESKKRISAEEAMK  285 (309)
T ss_pred             HHHhccCChhhCCCHHHHhc
Confidence            36899999999999998865


No 179
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=82.38  E-value=1.5  Score=30.03  Aligned_cols=23  Identities=26%  Similarity=0.560  Sum_probs=18.4

Q ss_pred             CeeEeceeccccCceEEEeEEec
Q psy15827         77 HIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .-.+.+.||+|.||.||+++..+
T Consensus        13 ~y~~~~~lg~g~~~~v~~~~~~~   35 (310)
T cd07865          13 KYEKLAKIGQGTFGEVFKARHKK   35 (310)
T ss_pred             heEEEEEeecCCCEEEEEEEECC
Confidence            34556889999999999998653


No 180
>KOG1152|consensus
Probab=82.21  E-value=1.1  Score=35.27  Aligned_cols=32  Identities=22%  Similarity=0.250  Sum_probs=22.3

Q ss_pred             CCCceeeCC---CeeEeceeccccCceEEEeEEec
Q psy15827         68 DDKWEVPRQ---HIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        68 ~~~w~i~~~---~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...||..-.   +-+-.+.+|+|+||+|+.+..+.
T Consensus       550 ~~~~e~~~~k~s~yttlq~lG~GAyGkV~lai~K~  584 (772)
T KOG1152|consen  550 NIGCEKEYKKFSDYTTLQPLGEGAYGKVNLAIHKE  584 (772)
T ss_pred             cccceeeecccccceeeeeccccccceEEEeeecc
Confidence            344554332   34556789999999999998763


No 181
>PHA03207 serine/threonine kinase US3; Provisional
Probab=82.00  E-value=0.58  Score=33.95  Aligned_cols=20  Identities=15%  Similarity=0.164  Sum_probs=17.7

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      .+|+..+|.+|||..+++.+
T Consensus       356 ~~ml~~dp~~Rpsa~e~l~~  375 (392)
T PHA03207        356 AKMLTFDQEFRPSAQDILSL  375 (392)
T ss_pred             HHHhccChhhCCCHHHHhhC
Confidence            58999999999999998764


No 182
>PLN00181 protein SPA1-RELATED; Provisional
Probab=81.90  E-value=0.59  Score=37.25  Aligned_cols=19  Identities=32%  Similarity=0.599  Sum_probs=17.1

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      ..||..+|.+||++.+|++
T Consensus       246 ~~~L~~~P~~Rps~~eil~  264 (793)
T PLN00181        246 LWLLHPEPSCRPSMSELLQ  264 (793)
T ss_pred             HHhCCCChhhCcChHHHhh
Confidence            5699999999999999865


No 183
>KOG1166|consensus
Probab=81.69  E-value=1.2  Score=36.75  Aligned_cols=29  Identities=24%  Similarity=0.516  Sum_probs=24.7

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeEE
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      ...++..+...+.+.||.|+||.||+|.-
T Consensus       691 ~~~~~~~~~~~I~~e~G~g~y~~vy~a~~  719 (974)
T KOG1166|consen  691 TEFEVGGEKFCISKEIGEGSYGSVYVATH  719 (974)
T ss_pred             ceeeecceeEEEEeeeccccceEEEEeec
Confidence            44677788888899999999999999864


No 184
>KOG0583|consensus
Probab=81.29  E-value=1.3  Score=32.57  Aligned_cols=24  Identities=25%  Similarity=0.314  Sum_probs=19.7

Q ss_pred             CCCeeEeceeccccCceEEEeEEe
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...-.+++.||+|+||.|+.|...
T Consensus        16 ~g~y~~~~~lG~GsfgkV~~a~~~   39 (370)
T KOG0583|consen   16 IGKYELGRTLGSGSFGKVKLAKHR   39 (370)
T ss_pred             cCceeeeeeecCCCCeeEEEeeec
Confidence            445667899999999999999754


No 185
>smart00090 RIO RIO-like kinase.
Probab=81.29  E-value=0.91  Score=31.09  Aligned_cols=18  Identities=11%  Similarity=0.123  Sum_probs=15.8

Q ss_pred             eEeceeccccCceEEEeE
Q psy15827         79 KVFDILGEGCFGQVWKCE   96 (101)
Q Consensus        79 ~~~~~lG~G~fg~v~~g~   96 (101)
                      .+.+.||+|+||.||+|+
T Consensus        31 ~i~~~Lg~G~~g~Vy~a~   48 (237)
T smart00090       31 AIGGCISTGKEANVYHAL   48 (237)
T ss_pred             HhCCeeccCcceeEEEEE
Confidence            456789999999999997


No 186
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=81.17  E-value=0.63  Score=31.39  Aligned_cols=29  Identities=24%  Similarity=0.187  Sum_probs=23.7

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      +.+...+...+.||.|.+|.||.|.|.|.
T Consensus        18 ~~~~~~~~v~~~L~KG~~s~Vyl~~~~~~   46 (201)
T COG2112          18 EEGKYELRVEKELAKGTTSVVYLGEWRGG   46 (201)
T ss_pred             eccchhhhhhhhhhcccccEEEEeeccCc
Confidence            34455777788999999999999999874


No 187
>KOG0198|consensus
Probab=80.98  E-value=0.72  Score=33.26  Aligned_cols=21  Identities=29%  Similarity=0.664  Sum_probs=18.7

Q ss_pred             hhhcccCCCCCCCHHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDLL   22 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~l   22 (101)
                      ..|...+|..|||+.+++.+.
T Consensus       257 ~~C~~~~p~~Rpta~eLL~hp  277 (313)
T KOG0198|consen  257 RKCFKRDPEKRPTAEELLEHP  277 (313)
T ss_pred             HHHhhcCcccCcCHHHHhhCh
Confidence            689999999999999997754


No 188
>PTZ00036 glycogen synthase kinase; Provisional
Probab=80.92  E-value=0.52  Score=34.93  Aligned_cols=21  Identities=24%  Similarity=0.059  Sum_probs=18.2

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||..+|.+|||..+++.+
T Consensus       331 i~~~L~~dP~~R~ta~e~l~h  351 (440)
T PTZ00036        331 ISQFLKYEPLKRLNPIEALAD  351 (440)
T ss_pred             HHHHCCCChhHCcCHHHHhCC
Confidence            468999999999999998754


No 189
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=80.89  E-value=2.1  Score=29.18  Aligned_cols=23  Identities=22%  Similarity=0.642  Sum_probs=18.7

Q ss_pred             CCeeEeceeccccCceEEEeEEe
Q psy15827         76 QHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ++..+.+.||+|.||.||++...
T Consensus        22 ~~y~~~~~l~~g~~~~vy~~~~~   44 (291)
T cd06639          22 DTWEIIETIGKGTYGKVYKVTNK   44 (291)
T ss_pred             CCeEEEEEeecCCCeEEEEEEEC
Confidence            45566778999999999998764


No 190
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=80.71  E-value=1.7  Score=30.04  Aligned_cols=20  Identities=25%  Similarity=0.594  Sum_probs=16.4

Q ss_pred             eEeceeccccCceEEEeEEe
Q psy15827         79 KVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        79 ~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ++.+.||+|+||.||++...
T Consensus        22 ~~~~~lg~g~~g~v~~~~~~   41 (297)
T cd06656          22 TRFEKIGQGASGTVYTAIDI   41 (297)
T ss_pred             eeeeeeccCCCeEEEEEEEC
Confidence            34678999999999998753


No 191
>PHA03212 serine/threonine kinase US3; Provisional
Probab=80.62  E-value=0.63  Score=33.97  Aligned_cols=20  Identities=20%  Similarity=0.290  Sum_probs=16.7

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+|+..||.+|||..+++.
T Consensus       356 i~~mL~~dP~~Rpta~elL~  375 (391)
T PHA03212        356 ICKMLAFDAHHRPSAEALLD  375 (391)
T ss_pred             HHHHhcCChhhCCCHHHHhc
Confidence            35789999999999998865


No 192
>KOG1989|consensus
Probab=80.59  E-value=1.6  Score=35.02  Aligned_cols=33  Identities=24%  Similarity=0.448  Sum_probs=28.9

Q ss_pred             CCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         67 SDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        67 ~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .....+|.+..+++.+.|-+|.|+.||.+...+
T Consensus        28 ~G~~~~Vg~~~v~V~~vLAEGGFa~VYla~~~~   60 (738)
T KOG1989|consen   28 VGQTFTVGSHRVTVEKVLAEGGFAQVYLAQDVK   60 (738)
T ss_pred             CceEEEECCEEEEEEEEEccCCcEEEEEEEecC
Confidence            346689999999999999999999999988654


No 193
>KOG0986|consensus
Probab=80.56  E-value=1.6  Score=33.58  Aligned_cols=27  Identities=33%  Similarity=0.813  Sum_probs=21.9

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      .+........+.||.|.||+|+.+...
T Consensus       181 pvt~n~F~~~RvlGkGGFGEV~acqvr  207 (591)
T KOG0986|consen  181 PVTKNTFRVYRVLGKGGFGEVCACQVR  207 (591)
T ss_pred             hccccceeeeEEEecccccceeEEEEe
Confidence            456667777889999999999987754


No 194
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=80.40  E-value=0.62  Score=32.22  Aligned_cols=19  Identities=11%  Similarity=-0.066  Sum_probs=16.1

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      .+|++.||.+|||..+++.
T Consensus       269 ~~mL~~dp~~R~s~~~~l~  287 (303)
T cd07869         269 SKLLQCFPKNRLSAQAALS  287 (303)
T ss_pred             HHHhccCchhccCHHHHhc
Confidence            5789999999999888754


No 195
>KOG0596|consensus
Probab=80.30  E-value=0.6  Score=36.44  Aligned_cols=20  Identities=30%  Similarity=0.599  Sum_probs=18.3

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |+.|...||.+||+..+++.
T Consensus       607 mK~CL~rdPkkR~si~eLLq  626 (677)
T KOG0596|consen  607 MKCCLARDPKKRWSIPELLQ  626 (677)
T ss_pred             HHHHHhcCcccCCCcHHHhc
Confidence            78999999999999998865


No 196
>KOG0576|consensus
Probab=80.15  E-value=0.64  Score=37.05  Aligned_cols=25  Identities=24%  Similarity=0.663  Sum_probs=21.0

Q ss_pred             eCCCeeEeceeccccCceEEEeEEe
Q psy15827         74 PRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        74 ~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      |++++.+...+|+|.||+||+++=+
T Consensus        13 P~ddyellqrvgsgTygdvyKaRd~   37 (829)
T KOG0576|consen   13 PQDDYELLQRVGSGTYGDVYKARDK   37 (829)
T ss_pred             CccchhheeeecCCcccchhhhccc
Confidence            4567888889999999999998744


No 197
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=80.10  E-value=0.91  Score=31.68  Aligned_cols=21  Identities=24%  Similarity=0.536  Sum_probs=17.3

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ....+.||+|+||.||+++..
T Consensus        27 f~~~~~lg~G~~~~v~~~~~~   47 (317)
T cd06635          27 FTDLREIGHGSFGAVYFARDV   47 (317)
T ss_pred             hhhhheeccCCCeEEEEEEEc
Confidence            345678999999999998864


No 198
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=79.96  E-value=1.8  Score=29.82  Aligned_cols=21  Identities=24%  Similarity=0.520  Sum_probs=16.7

Q ss_pred             CeeEeceeccccCceEEEeEE
Q psy15827         77 HIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      ...+.+.||+|.||.||++..
T Consensus        20 ~~~~~~~lg~g~~g~v~~~~~   40 (293)
T cd06647          20 KYTRFEKIGQGASGTVYTAID   40 (293)
T ss_pred             hceeeeEecCCCCeEEEEEEE
Confidence            334467899999999999874


No 199
>PF08247 ENOD40:  ENOD40 protein;  InterPro: IPR013186 The soybean early nodulin 40 (ENOD40) mRNA contains two short overlapping ORFs; in vitro translation yields two peptides of 12 and 24 amino acids []. The putative role of the ENOD40 genes has been in favour of organogenesis, such as induction of the cortical cell divisions that lead to initiation of nodule primordia, in developing lateral roots and embryonic tissues. This supports the hypothesis for a role of ENOD40 in lateral organ development [].
Probab=79.87  E-value=0.54  Score=17.34  Aligned_cols=8  Identities=50%  Similarity=1.315  Sum_probs=5.9

Q ss_pred             ChhhcccC
Q psy15827          1 MYYCWDKE    8 (101)
Q Consensus         1 m~~CW~~~    8 (101)
                      |.-||+..
T Consensus         1 m~l~wqks    8 (12)
T PF08247_consen    1 MELCWQKS    8 (12)
T ss_pred             CceeEeee
Confidence            77899764


No 200
>KOG0663|consensus
Probab=79.86  E-value=0.96  Score=33.41  Aligned_cols=20  Identities=20%  Similarity=0.508  Sum_probs=16.4

Q ss_pred             EeceeccccCceEEEeEEec
Q psy15827         80 VFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        80 ~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ..+.|++|.||.||+|+-+.
T Consensus        80 ~lnrI~EGtyGiVYRakdk~   99 (419)
T KOG0663|consen   80 KLNRIEEGTYGVVYRAKDKK   99 (419)
T ss_pred             HHhhcccCcceeEEEeccCC
Confidence            35689999999999998543


No 201
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=79.77  E-value=0.66  Score=32.71  Aligned_cols=19  Identities=11%  Similarity=-0.034  Sum_probs=16.9

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      .+|+..||.+|||..+++.
T Consensus       279 ~~mL~~dp~~R~s~~ell~  297 (343)
T cd07878         279 EKMLVLDSDKRISASEALA  297 (343)
T ss_pred             HHHcCCChhhCCCHHHHhc
Confidence            5799999999999998875


No 202
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=79.36  E-value=0.48  Score=33.05  Aligned_cols=22  Identities=9%  Similarity=0.270  Sum_probs=17.2

Q ss_pred             ChhhcccCCCCCCCHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLL   22 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l   22 (101)
                      +.+||..||.+||++..+.+.|
T Consensus       224 i~~~L~~dp~~R~~~~~~~e~l  245 (312)
T cd05585         224 LIGLLSRDPTRRLGYNGAQEIK  245 (312)
T ss_pred             HHHHcCCCHHHcCCCCCHHHHH
Confidence            4689999999999886655444


No 203
>KOG1035|consensus
Probab=79.15  E-value=0.98  Score=38.13  Aligned_cols=16  Identities=44%  Similarity=0.877  Sum_probs=14.0

Q ss_pred             eceeccccCceEEEeE
Q psy15827         81 FDILGEGCFGQVWKCE   96 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~   96 (101)
                      .+.||+|+||.||+.+
T Consensus       484 L~lLGkGGFG~VvkVR  499 (1351)
T KOG1035|consen  484 LELLGKGGFGSVVKVR  499 (1351)
T ss_pred             HHHhcCCCCceEEEEe
Confidence            4578999999999876


No 204
>KOG0201|consensus
Probab=78.85  E-value=1.1  Score=33.84  Aligned_cols=21  Identities=38%  Similarity=0.581  Sum_probs=18.4

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |..|.+.+|+.||+..+++.+
T Consensus       243 V~~CL~k~P~~RpsA~~LLKh  263 (467)
T KOG0201|consen  243 VEACLDKNPEFRPSAKELLKH  263 (467)
T ss_pred             HHHHhhcCcccCcCHHHHhhh
Confidence            467999999999999999764


No 205
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=78.82  E-value=0.51  Score=32.46  Aligned_cols=15  Identities=27%  Similarity=0.253  Sum_probs=13.0

Q ss_pred             ChhhcccCCCCCCCH
Q psy15827          1 MYYCWDKEPNERPNF   15 (101)
Q Consensus         1 m~~CW~~~p~~RPsf   15 (101)
                      +.+||+.+|.+|||+
T Consensus       236 i~~~l~~~p~~R~s~  250 (285)
T cd05630         236 CKMLLCKDPKERLGC  250 (285)
T ss_pred             HHHHhhcCHHHccCC
Confidence            368999999999994


No 206
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=78.64  E-value=0.6  Score=32.04  Aligned_cols=16  Identities=19%  Similarity=0.264  Sum_probs=13.4

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +..||+.+|.+||++.
T Consensus       236 i~~~l~~~P~~R~~~~  251 (285)
T cd05632         236 CKMLLTKDPKQRLGCQ  251 (285)
T ss_pred             HHHHccCCHhHcCCCc
Confidence            3679999999999943


No 207
>KOG2052|consensus
Probab=78.63  E-value=1.3  Score=33.71  Aligned_cols=28  Identities=29%  Similarity=0.431  Sum_probs=24.3

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      |+.||..+|..|-|.=-|.+.|.++.+.
T Consensus       479 MkeCW~~Np~aRltALriKKtl~~l~~~  506 (513)
T KOG2052|consen  479 MKECWYANPAARLTALRIKKTLAKLSNS  506 (513)
T ss_pred             HHHhhcCCchhhhHHHHHHHHHHHHhcC
Confidence            7899999999999999888888877653


No 208
>PTZ00284 protein kinase; Provisional
Probab=78.03  E-value=0.86  Score=33.89  Aligned_cols=20  Identities=15%  Similarity=0.232  Sum_probs=17.5

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +..|+..||.+|||..+++.
T Consensus       418 i~~mL~~dP~~R~ta~e~L~  437 (467)
T PTZ00284        418 IYGLLHYDRQKRLNARQMTT  437 (467)
T ss_pred             HHHhCCcChhhCCCHHHHhc
Confidence            35799999999999999875


No 209
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=77.38  E-value=1.6  Score=35.30  Aligned_cols=19  Identities=16%  Similarity=0.342  Sum_probs=16.0

Q ss_pred             EeceeccccCceEEEeEEe
Q psy15827         80 VFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        80 ~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..+.||+|+||.||+|+..
T Consensus       694 ~~~~ig~G~~g~Vy~~~~~  712 (968)
T PLN00113        694 EENVISRGKKGASYKGKSI  712 (968)
T ss_pred             cccEEccCCCeeEEEEEEC
Confidence            3457999999999999864


No 210
>KOG0581|consensus
Probab=77.16  E-value=1.2  Score=32.84  Aligned_cols=29  Identities=21%  Similarity=0.361  Sum_probs=24.4

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      .|..++++....||+|+-|.|++.+.+.+
T Consensus        75 ~i~~~dle~~~~lG~G~gG~V~kv~Hk~t  103 (364)
T KOG0581|consen   75 GISLSDLERLGVLGSGNGGTVYKVRHKPT  103 (364)
T ss_pred             ccCHHHhhhhhhcccCCCcEEEEEEEcCC
Confidence            45666899999999999999999987743


No 211
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=76.94  E-value=0.64  Score=32.58  Aligned_cols=15  Identities=20%  Similarity=0.293  Sum_probs=13.8

Q ss_pred             ChhhcccCCCCCCCH
Q psy15827          1 MYYCWDKEPNERPNF   15 (101)
Q Consensus         1 m~~CW~~~p~~RPsf   15 (101)
                      |.+||..||.+||+.
T Consensus       227 i~~~l~~dP~~R~s~  241 (318)
T cd05570         227 LKSFLTKNPEKRLGC  241 (318)
T ss_pred             HHHHccCCHHHcCCC
Confidence            468999999999999


No 212
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=76.76  E-value=1.1  Score=31.99  Aligned_cols=19  Identities=11%  Similarity=-0.008  Sum_probs=16.6

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      .+|+..||.+|||..++++
T Consensus       299 ~~mL~~dP~~R~t~~e~L~  317 (364)
T cd07875         299 SKMLVIDASKRISVDEALQ  317 (364)
T ss_pred             HHhcCcCcccCCCHHHHhc
Confidence            5799999999999998865


No 213
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=76.72  E-value=0.63  Score=31.92  Aligned_cols=15  Identities=27%  Similarity=0.290  Sum_probs=12.9

Q ss_pred             ChhhcccCCCCCCCH
Q psy15827          1 MYYCWDKEPNERPNF   15 (101)
Q Consensus         1 m~~CW~~~p~~RPsf   15 (101)
                      +.+||+.+|.+||++
T Consensus       236 i~~~l~~~P~~R~~~  250 (285)
T cd05631         236 CRMLLTKNPKERLGC  250 (285)
T ss_pred             HHHHhhcCHHHhcCC
Confidence            368999999999984


No 214
>KOG0661|consensus
Probab=76.69  E-value=1.2  Score=34.09  Aligned_cols=20  Identities=35%  Similarity=0.690  Sum_probs=16.6

Q ss_pred             eEeceeccccCceEEEeEEe
Q psy15827         79 KVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        79 ~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ++.+.||.|.||.||+|+-+
T Consensus        13 ~~i~klGDGTfGsV~la~~~   32 (538)
T KOG0661|consen   13 TVIRKLGDGTFGSVYLAKSK   32 (538)
T ss_pred             HHHHHhcCCcceeEEEeeec
Confidence            34678999999999999754


No 215
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=76.38  E-value=0.86  Score=31.59  Aligned_cols=20  Identities=15%  Similarity=0.092  Sum_probs=15.7

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      +.+||..+|.+||+.+...+
T Consensus       265 i~~~l~~~p~~R~s~~~~~~  284 (316)
T cd05574         265 IRKLLVKDPSKRLGSKRGAA  284 (316)
T ss_pred             HHHHccCCHhHCCCchhhHH
Confidence            46899999999999554443


No 216
>KOG0615|consensus
Probab=75.92  E-value=2.8  Score=31.73  Aligned_cols=23  Identities=26%  Similarity=0.284  Sum_probs=17.8

Q ss_pred             CCeeEeceeccccCceEEEeEEe
Q psy15827         76 QHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +.-.+.+.||+|+||.|-+|.=+
T Consensus       172 d~yii~~~LGsGafg~Vkla~e~  194 (475)
T KOG0615|consen  172 DYYIISKTLGSGAFGLVKLAYEK  194 (475)
T ss_pred             ceeEeeeeecCCceeEEEEEEEc
Confidence            34455789999999999887643


No 217
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=75.85  E-value=3.5  Score=28.46  Aligned_cols=21  Identities=19%  Similarity=0.482  Sum_probs=17.7

Q ss_pred             CeeEeceeccccCceEEEeEE
Q psy15827         77 HIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      ...+.+.||+|.||.||+|..
T Consensus        20 ~y~~~~~lg~g~~g~vy~~~~   40 (296)
T cd06655          20 KYTRYEKIGQGASGTVFTAID   40 (296)
T ss_pred             eEEEEEEEecCCCeEEEEEEE
Confidence            456678899999999999874


No 218
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=75.45  E-value=2.1  Score=29.65  Aligned_cols=21  Identities=24%  Similarity=0.536  Sum_probs=17.0

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ....+.||+|.||.||+|+..
T Consensus        17 y~~~~~lg~g~~g~vy~~~~~   37 (307)
T cd06607          17 FTDLREIGHGSFGAVYFARDV   37 (307)
T ss_pred             hhhheeecCCCCeEEEEEEEc
Confidence            344578999999999999764


No 219
>KOG0577|consensus
Probab=74.62  E-value=1.6  Score=34.78  Aligned_cols=17  Identities=29%  Similarity=0.657  Sum_probs=14.2

Q ss_pred             ceeccccCceEEEeEEe
Q psy15827         82 DILGEGCFGQVWKCEAL   98 (101)
Q Consensus        82 ~~lG~G~fg~v~~g~~~   98 (101)
                      +.||.|+||.||-++-.
T Consensus        32 rEIGHGSFGAVYfArd~   48 (948)
T KOG0577|consen   32 REIGHGSFGAVYFARDV   48 (948)
T ss_pred             HHhcCCccceeEEeecc
Confidence            57899999999987643


No 220
>KOG0669|consensus
Probab=74.30  E-value=0.3  Score=34.89  Aligned_cols=19  Identities=32%  Similarity=0.747  Sum_probs=15.7

Q ss_pred             eceeccccCceEEEeEEec
Q psy15827         81 FDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...||+|.||+||+++.++
T Consensus        22 ~~kigqGtfgeVFkAr~~n   40 (376)
T KOG0669|consen   22 LAKIGQGTFGEVFKARSKN   40 (376)
T ss_pred             HHhcCCchHHHHHHHhhcC
Confidence            4578999999999887654


No 221
>PF03109 ABC1:  ABC1 family;  InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli []. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex [] and E. coli AarF is required for ubiquinone production []. It has been suggested that members of the ABC1 family are novel chaperonins []. These proteins are unrelated to the ABC transporter proteins.
Probab=74.18  E-value=1.3  Score=27.20  Aligned_cols=17  Identities=18%  Similarity=0.247  Sum_probs=15.4

Q ss_pred             ceeccccCceEEEeEEe
Q psy15827         82 DILGEGCFGQVWKCEAL   98 (101)
Q Consensus        82 ~~lG~G~fg~v~~g~~~   98 (101)
                      +.||+|+.|+||+|+++
T Consensus        17 ~PlasASiaQVh~a~l~   33 (119)
T PF03109_consen   17 EPLASASIAQVHRARLK   33 (119)
T ss_pred             chhhheehhhheeeeec
Confidence            47899999999999986


No 222
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=72.84  E-value=4.2  Score=28.81  Aligned_cols=21  Identities=19%  Similarity=0.248  Sum_probs=16.9

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ....+.||+|+||.||++.-.
T Consensus        18 y~~~~~lg~g~~g~V~~~~~~   38 (353)
T cd07850          18 YQNLKPIGSGAQGIVCAAYDT   38 (353)
T ss_pred             eEEEEEeccCCCEEEEEEEEC
Confidence            445678999999999998753


No 223
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=72.53  E-value=1.5  Score=36.38  Aligned_cols=20  Identities=15%  Similarity=0.172  Sum_probs=18.0

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |..||..+|.+||++.+++.
T Consensus       275 I~~~L~~dPeeRPSa~QlL~  294 (1021)
T PTZ00266        275 IKNLLNLSAKERPSALQCLG  294 (1021)
T ss_pred             HHHHhcCChhHCcCHHHHhc
Confidence            46899999999999999975


No 224
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=72.53  E-value=3.2  Score=28.93  Aligned_cols=18  Identities=28%  Similarity=0.589  Sum_probs=15.1

Q ss_pred             eceeccccCceEEEeEEe
Q psy15827         81 FDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~~   98 (101)
                      .+.||+|+||.||+|+..
T Consensus        26 ~~~lg~g~~g~v~~~~~~   43 (313)
T cd06633          26 LHEIGHGSFGAVYFATNS   43 (313)
T ss_pred             ceeeccCCCeEEEEEEEC
Confidence            456999999999999753


No 225
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=72.40  E-value=1.2  Score=29.87  Aligned_cols=26  Identities=12%  Similarity=0.092  Sum_probs=19.2

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      |.+||..+|.+||+...-  .+..++++
T Consensus       227 i~~~l~~~p~~R~~~~~~--~~~~l~~~  252 (262)
T cd05572         227 IKQLLRRNPEERLGNLKG--GIKDIKKH  252 (262)
T ss_pred             HHHHccCChhhCcCCccc--CHHHHhcC
Confidence            468999999999997653  34555553


No 226
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=72.34  E-value=2.7  Score=29.05  Aligned_cols=19  Identities=32%  Similarity=0.394  Sum_probs=15.8

Q ss_pred             eceeccccCceEEEeEEec
Q psy15827         81 FDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...||+|+||.||++...+
T Consensus        25 ~~~lg~g~~g~v~~~~~~~   43 (292)
T cd06657          25 FIKIGEGSTGIVCIATVKS   43 (292)
T ss_pred             HHHcCCCCCeEEEEEEEcC
Confidence            3579999999999988653


No 227
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=72.12  E-value=1.1  Score=31.24  Aligned_cols=17  Identities=12%  Similarity=0.239  Sum_probs=14.6

Q ss_pred             ChhhcccCCCCCCCHHH
Q psy15827          1 MYYCWDKEPNERPNFTE   17 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~   17 (101)
                      +.+||+.||.+||+..+
T Consensus       229 i~~~l~~~P~~R~~a~~  245 (318)
T cd05582         229 LRALFKRNPANRLGAGP  245 (318)
T ss_pred             HHHHhhcCHhHcCCCCC
Confidence            46899999999999665


No 228
>KOG1187|consensus
Probab=71.40  E-value=4.1  Score=29.80  Aligned_cols=24  Identities=29%  Similarity=0.684  Sum_probs=20.4

Q ss_pred             hhhcccCCCCCCCHHHHHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDLLEKL   25 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~l~~~   25 (101)
                      ..|-+.+|.+||+..+++..|..+
T Consensus       329 ~~C~~~~~~~RP~m~~Vv~~L~~~  352 (361)
T KOG1187|consen  329 LRCLRPDPKERPTMSQVVKELEGI  352 (361)
T ss_pred             HHHcCcCCCcCcCHHHHHHHHHhh
Confidence            479999999999999998887443


No 229
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=70.95  E-value=2.5  Score=31.71  Aligned_cols=17  Identities=18%  Similarity=0.276  Sum_probs=15.3

Q ss_pred             ceeccccCceEEEeEEe
Q psy15827         82 DILGEGCFGQVWKCEAL   98 (101)
Q Consensus        82 ~~lG~G~fg~v~~g~~~   98 (101)
                      +.||+|++|+||+|+++
T Consensus       123 ~plasaSigQVh~A~l~  139 (437)
T TIGR01982       123 KPLAAASIAQVHRARLV  139 (437)
T ss_pred             cceeeeehhheEEEEec
Confidence            57999999999999875


No 230
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=70.24  E-value=1.6  Score=30.92  Aligned_cols=21  Identities=5%  Similarity=-0.067  Sum_probs=17.5

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+|++.+|.+||+..+++.+
T Consensus       280 i~~~L~~dp~~R~t~~e~l~h  300 (345)
T cd07877         280 LEKMLVLDSDKRITAAQALAH  300 (345)
T ss_pred             HHHHcCCChhhcCCHHHHhcC
Confidence            357999999999999888654


No 231
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=70.00  E-value=3.1  Score=28.45  Aligned_cols=21  Identities=29%  Similarity=0.376  Sum_probs=16.5

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +...+.||+|+||.||++...
T Consensus        21 ~~~~~~lg~g~~g~v~~~~~~   41 (285)
T cd06648          21 LDNFVKIGEGSTGIVCIATDK   41 (285)
T ss_pred             hhcceEeccCCCeEEEEEEEC
Confidence            333468999999999998754


No 232
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=69.94  E-value=1.7  Score=30.81  Aligned_cols=19  Identities=11%  Similarity=-0.099  Sum_probs=16.7

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      .+|...+|.+|||..+++.
T Consensus       279 ~~~l~~dP~~R~t~~~~l~  297 (343)
T cd07880         279 EKMLVLDAESRITAAEALA  297 (343)
T ss_pred             HHHcCCChhhCCCHHHHhc
Confidence            5799999999999998864


No 233
>KOG0608|consensus
Probab=69.49  E-value=4.4  Score=32.69  Aligned_cols=25  Identities=20%  Similarity=0.417  Sum_probs=21.0

Q ss_pred             eeCCCeeEeceeccccCceEEEeEE
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      .+++..+..+.||-|+||+|.+..-
T Consensus       626 MdKSmFvkik~iGvGAFGeV~Lv~K  650 (1034)
T KOG0608|consen  626 MDKSMFVKIKTIGVGAFGEVCLVRK  650 (1034)
T ss_pred             ccccceEEEeeecccccceeEEEee
Confidence            5667788889999999999997654


No 234
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=69.27  E-value=5.9  Score=27.91  Aligned_cols=27  Identities=22%  Similarity=0.423  Sum_probs=19.6

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      |.+... -.+.+.||.|.||.||++...
T Consensus         6 ~~~~~~-y~~~~~ig~g~~g~v~~~~~~   32 (328)
T cd07856           6 FEITNR-YVDLQPVGMGAFGLVCSARDQ   32 (328)
T ss_pred             eccccc-eEEEEeecccCCeEEEEEEEC
Confidence            444444 444679999999999998744


No 235
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=69.20  E-value=3.6  Score=28.56  Aligned_cols=21  Identities=24%  Similarity=0.536  Sum_probs=16.9

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ....+.||+|+||.||+|+..
T Consensus        17 ~~~~~~lg~g~~g~v~~~~~~   37 (308)
T cd06634          17 FSDLREIGHGSFGAVYFARDV   37 (308)
T ss_pred             HHHHHheeeCCCEEEEEEEEc
Confidence            344568999999999999864


No 236
>KOG0661|consensus
Probab=69.19  E-value=2.1  Score=32.88  Aligned_cols=21  Identities=14%  Similarity=0.251  Sum_probs=17.8

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |.+|..+||.+|||..+.+++
T Consensus       271 i~~ll~WDP~kRpTA~~al~~  291 (538)
T KOG0661|consen  271 IERLLAWDPDKRPTASQALQH  291 (538)
T ss_pred             HHHHhcCCCccCccHHHHhcC
Confidence            467899999999999988764


No 237
>KOG0984|consensus
Probab=69.13  E-value=1.1  Score=31.17  Aligned_cols=27  Identities=37%  Similarity=0.661  Sum_probs=23.0

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEE
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWK   94 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~   94 (101)
                      ...++++.+++.-...||+|++|.|-+
T Consensus        38 ~~~~eV~ad~L~~i~elGrGayG~vek   64 (282)
T KOG0984|consen   38 DRNFEVPADDLVGIEELGRGAYGVVEK   64 (282)
T ss_pred             cCccccchhhhhhhhhhcCCccchhhh
Confidence            345899999999999999999998753


No 238
>KOG0581|consensus
Probab=68.48  E-value=2.2  Score=31.46  Aligned_cols=20  Identities=35%  Similarity=0.672  Sum_probs=17.8

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      ..|.+.||.+||+..++..+
T Consensus       316 ~~CL~Kdp~~R~s~~qLl~H  335 (364)
T KOG0581|consen  316 SCCLRKDPSERPSAKQLLQH  335 (364)
T ss_pred             HHHhcCCcccCCCHHHHhcC
Confidence            57999999999999999764


No 239
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=68.44  E-value=1.9  Score=33.86  Aligned_cols=20  Identities=20%  Similarity=0.273  Sum_probs=17.9

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      ..||..+|.+||++.+++++
T Consensus       615 ~~lL~~dP~~R~ta~e~l~h  634 (669)
T cd05610         615 EILLTMDPTKRAGLKELKQH  634 (669)
T ss_pred             HHHcccChhHCcCHHHHHhC
Confidence            57999999999999999764


No 240
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=68.41  E-value=1.9  Score=30.27  Aligned_cols=21  Identities=0%  Similarity=-0.005  Sum_probs=17.7

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.+||..+|.+||++.++..+
T Consensus       237 i~~~l~~~~~rr~s~~~ll~h  257 (333)
T cd05600         237 ITKLINDPSRRFGSLEDIKNH  257 (333)
T ss_pred             HHHHhhChhhhcCCHHHHHhC
Confidence            357999999999999988764


No 241
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=67.99  E-value=2  Score=29.71  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=14.7

Q ss_pred             eceeccccCceEEEeEEe
Q psy15827         81 FDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~~   98 (101)
                      ...||+|.||.||++...
T Consensus        26 ~~~ig~g~~g~v~~~~~~   43 (297)
T cd06659          26 YIKIGEGSTGIVCIAREK   43 (297)
T ss_pred             hhhcCCCCceeEEEEEEc
Confidence            447899999999998753


No 242
>KOG1989|consensus
Probab=67.63  E-value=4.5  Score=32.59  Aligned_cols=28  Identities=21%  Similarity=0.354  Sum_probs=24.9

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHhc
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~~   28 (101)
                      +..|.+.+|.+||++.++.+.+-.+...
T Consensus       287 I~~mL~~nP~~RPnI~Qv~~~~~~l~~~  314 (738)
T KOG1989|consen  287 IRTMLQPNPDERPNIYQVLEEIFELANK  314 (738)
T ss_pred             HHHHhccCcccCCCHHHHHHHHHHHhcC
Confidence            3579999999999999999999888875


No 243
>KOG0575|consensus
Probab=67.55  E-value=4.4  Score=31.77  Aligned_cols=20  Identities=25%  Similarity=0.456  Sum_probs=17.1

Q ss_pred             eeEeceeccccCceEEEeEE
Q psy15827         78 IKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~   97 (101)
                      -.+++.||+|+|..||+++-
T Consensus        20 Y~~g~~LGkGgFA~cYe~~~   39 (592)
T KOG0575|consen   20 YKRGRFLGKGGFARCYEARD   39 (592)
T ss_pred             eeeeeeeccCcceEEEEEEE
Confidence            45678999999999999875


No 244
>KOG0593|consensus
Probab=67.01  E-value=2.3  Score=31.14  Aligned_cols=20  Identities=20%  Similarity=0.512  Sum_probs=17.8

Q ss_pred             ChhhcccCCCCCCCHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~   20 (101)
                      |+.|...||.+|++..++..
T Consensus       264 ~k~cL~~dP~~R~sc~qll~  283 (396)
T KOG0593|consen  264 LKKCLKMDPDDRLSCEQLLH  283 (396)
T ss_pred             HHHHhcCCccccccHHHHhc
Confidence            67899999999999988864


No 245
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=66.65  E-value=4.3  Score=27.54  Aligned_cols=15  Identities=33%  Similarity=0.363  Sum_probs=12.9

Q ss_pred             eccccCceEEEeEEe
Q psy15827         84 LGEGCFGQVWKCEAL   98 (101)
Q Consensus        84 lG~G~fg~v~~g~~~   98 (101)
                      ||+|.||.||++.-+
T Consensus        24 lg~g~~g~v~~~~~~   38 (267)
T PHA03390         24 LIDGKFGKVSVLKHK   38 (267)
T ss_pred             ecCCCceEEEEEEEc
Confidence            799999999988754


No 246
>KOG0585|consensus
Probab=66.60  E-value=3.2  Score=32.03  Aligned_cols=22  Identities=18%  Similarity=0.432  Sum_probs=17.8

Q ss_pred             CCeeEeceeccccCceEEEeEE
Q psy15827         76 QHIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      .+-++.+.||+|+||.|-+++-
T Consensus        97 Nqy~l~~eiG~G~yGkVkLar~  118 (576)
T KOG0585|consen   97 NQYELIKEIGSGQYGKVKLARD  118 (576)
T ss_pred             hheehhhhhcCCccceEEEEee
Confidence            4556678899999999998874


No 247
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=66.19  E-value=1.8  Score=30.47  Aligned_cols=14  Identities=7%  Similarity=0.012  Sum_probs=12.4

Q ss_pred             ChhhcccCCCCCCC
Q psy15827          1 MYYCWDKEPNERPN   14 (101)
Q Consensus         1 m~~CW~~~p~~RPs   14 (101)
                      +.+||+.||.+||+
T Consensus       246 i~~~L~~dP~~R~~  259 (329)
T PTZ00263        246 VKGLLQTDHTKRLG  259 (329)
T ss_pred             HHHHhhcCHHHcCC
Confidence            36899999999997


No 248
>KOG0610|consensus
Probab=65.86  E-value=1.5  Score=32.97  Aligned_cols=29  Identities=28%  Similarity=0.478  Sum_probs=24.0

Q ss_pred             eeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         72 EVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        72 ~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      .+..+++.+.+.||+|.-|.||.++..|+
T Consensus        73 ~l~l~~f~llk~LG~GdiG~VyL~~l~~t  101 (459)
T KOG0610|consen   73 SLGLRHFRLLKRLGCGDIGTVYLVELRGT  101 (459)
T ss_pred             ccCHHHHHHHHHcCCCCceeEEEEEecCC
Confidence            35556777788999999999999998875


No 249
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=65.36  E-value=1.9  Score=29.45  Aligned_cols=17  Identities=24%  Similarity=0.386  Sum_probs=14.2

Q ss_pred             ChhhcccCCCCCCCHHH
Q psy15827          1 MYYCWDKEPNERPNFTE   17 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~   17 (101)
                      +.+||+.+|.+||+|++
T Consensus       232 i~~~l~~~P~~R~~~~~  248 (280)
T cd05608         232 CEALLAKDPEKRLGFRD  248 (280)
T ss_pred             HHHHhcCCHHHhcCCCC
Confidence            35899999999997764


No 250
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=65.28  E-value=1.9  Score=30.47  Aligned_cols=15  Identities=27%  Similarity=0.432  Sum_probs=13.1

Q ss_pred             ChhhcccCCCCCCCH
Q psy15827          1 MYYCWDKEPNERPNF   15 (101)
Q Consensus         1 m~~CW~~~p~~RPsf   15 (101)
                      +.+||..||.+||+.
T Consensus       236 l~~~L~~dP~~R~~~  250 (329)
T cd05618         236 LKSFLNKDPKERLGC  250 (329)
T ss_pred             HHHHhcCCHHHcCCC
Confidence            468999999999985


No 251
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=65.28  E-value=4.1  Score=27.72  Aligned_cols=21  Identities=33%  Similarity=0.589  Sum_probs=17.5

Q ss_pred             eeEeceeccccCceEEEeEEe
Q psy15827         78 IKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ....+.||+|.||.||++...
T Consensus        21 ~~~~~~l~~g~~~~v~~~~~~   41 (286)
T cd06614          21 YKNLEKIGEGASGEVYKATDR   41 (286)
T ss_pred             chHhHhccCCCCeEEEEEEEc
Confidence            445678999999999998875


No 252
>KOG0592|consensus
Probab=65.25  E-value=3.6  Score=32.13  Aligned_cols=24  Identities=29%  Similarity=0.386  Sum_probs=20.5

Q ss_pred             CCCeeEeceeccccCceEEEeEEe
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ..+..+++.||.|+|..|++++-+
T Consensus        72 ~~DF~Fg~~lGeGSYStV~~A~~~   95 (604)
T KOG0592|consen   72 PNDFKFGKILGEGSYSTVVLAREK   95 (604)
T ss_pred             hhhcchhheeccccceeEEEeeec
Confidence            357889999999999999998744


No 253
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=65.10  E-value=2.6  Score=29.08  Aligned_cols=18  Identities=33%  Similarity=0.407  Sum_probs=14.9

Q ss_pred             eceeccccCceEEEeEEe
Q psy15827         81 FDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~~   98 (101)
                      ...||+|+||.||++...
T Consensus        27 ~~~lg~g~~g~v~~~~~~   44 (292)
T cd06658          27 FIKIGEGSTGIVCIATEK   44 (292)
T ss_pred             hhcccCCCCeEEEEEEEC
Confidence            467999999999988753


No 254
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=64.91  E-value=2.2  Score=29.91  Aligned_cols=18  Identities=22%  Similarity=0.255  Sum_probs=14.6

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      ..|+. +|.+||++.++..
T Consensus       245 ~~ll~-~p~~R~t~~~l~~  262 (330)
T cd05601         245 QSLLC-GQKERLGYEGLCC  262 (330)
T ss_pred             HHHcc-ChhhCCCHHHHhC
Confidence            46786 9999999998754


No 255
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=64.88  E-value=1.9  Score=29.50  Aligned_cols=20  Identities=10%  Similarity=0.107  Sum_probs=15.2

Q ss_pred             ChhhcccCCCCCCC-----HHHHHH
Q psy15827          1 MYYCWDKEPNERPN-----FTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RPs-----f~~i~~   20 (101)
                      +.+||+.+|.+||+     .+++.+
T Consensus       230 i~~~l~~~p~~R~~~~~~~~~~~~~  254 (279)
T cd05633         230 LEGLLQRDVSKRLGCLGRGAQEVKE  254 (279)
T ss_pred             HHHHhcCCHHHhcCCCCCCHHHHHh
Confidence            35899999999994     665544


No 256
>KOG3653|consensus
Probab=64.83  E-value=3.3  Score=31.82  Aligned_cols=27  Identities=19%  Similarity=0.512  Sum_probs=22.9

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHh
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLL   27 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~   27 (101)
                      |..||+.||+.|-|..-+-+++..+..
T Consensus       479 ~EeCWDhDaeARLTA~Cv~eR~~~l~~  505 (534)
T KOG3653|consen  479 IEECWDHDAEARLTAGCVEERMAELMM  505 (534)
T ss_pred             HHHHcCCchhhhhhhHHHHHHHHHHhc
Confidence            357999999999999988888876654


No 257
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=64.46  E-value=2.1  Score=29.98  Aligned_cols=15  Identities=20%  Similarity=0.268  Sum_probs=12.5

Q ss_pred             ChhhcccCCCCCCCH
Q psy15827          1 MYYCWDKEPNERPNF   15 (101)
Q Consensus         1 m~~CW~~~p~~RPsf   15 (101)
                      +.+||..||.+||+.
T Consensus       242 i~~~l~~dp~~R~~~  256 (332)
T cd05614         242 LHKLLRKDPKKRLGA  256 (332)
T ss_pred             HHHHcCCCHHHcCCC
Confidence            368999999999943


No 258
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=63.78  E-value=2.2  Score=29.95  Aligned_cols=20  Identities=20%  Similarity=0.360  Sum_probs=15.9

Q ss_pred             ChhhcccCCCCCC-----CHHHHHH
Q psy15827          1 MYYCWDKEPNERP-----NFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RP-----sf~~i~~   20 (101)
                      +.+||..||.+||     +..+|..
T Consensus       226 i~~~L~~dP~~R~~~~~~~~~~ll~  250 (323)
T cd05571         226 LAGLLKKDPKQRLGGGPEDAKEIME  250 (323)
T ss_pred             HHHHccCCHHHcCCCCCCCHHHHHc
Confidence            3689999999999     5666654


No 259
>KOG0666|consensus
Probab=63.43  E-value=5.1  Score=29.60  Aligned_cols=17  Identities=29%  Similarity=0.722  Sum_probs=14.4

Q ss_pred             eceeccccCceEEEeEE
Q psy15827         81 FDILGEGCFGQVWKCEA   97 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~   97 (101)
                      ...||+|.||.||++.-
T Consensus        29 ig~Ig~GTYG~VykA~~   45 (438)
T KOG0666|consen   29 IGKIGRGTYGKVYKAVR   45 (438)
T ss_pred             cceecccccceeeEeee
Confidence            45789999999999853


No 260
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=62.91  E-value=2.2  Score=29.39  Aligned_cols=19  Identities=5%  Similarity=-0.060  Sum_probs=14.8

Q ss_pred             ChhhcccCCCCCCC-----HHHHH
Q psy15827          1 MYYCWDKEPNERPN-----FTELC   19 (101)
Q Consensus         1 m~~CW~~~p~~RPs-----f~~i~   19 (101)
                      +.+||..||.+||+     +.++.
T Consensus       229 i~~~l~~dp~~R~~~~~~~~~~~l  252 (291)
T cd05612         229 IKKLLVVDRTRRLGNMKNGADDVK  252 (291)
T ss_pred             HHHHcCCCHHHccCCccCCHHHHh
Confidence            46899999999996     55554


No 261
>KOG0695|consensus
Probab=62.64  E-value=4.2  Score=30.39  Aligned_cols=33  Identities=12%  Similarity=0.225  Sum_probs=28.1

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      +.+|.+...+..+.+.||.|+|..|...+.+.+
T Consensus       242 ~~~~~l~l~df~ll~vigrgsyakvl~~~~~~t  274 (593)
T KOG0695|consen  242 KISQGLGLQDFDLLRVIGRGSYAKVLLVRLKKT  274 (593)
T ss_pred             ccccccccccceeeeeecCcchhhhhheehccc
Confidence            467999999999999999999999988776543


No 262
>KOG0582|consensus
Probab=61.88  E-value=3.8  Score=31.36  Aligned_cols=20  Identities=30%  Similarity=0.594  Sum_probs=17.7

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      ..|...||.+|||.+++..+
T Consensus       274 ~~CL~kDP~kRptAskLlkh  293 (516)
T KOG0582|consen  274 ALCLVKDPSKRPTASKLLKH  293 (516)
T ss_pred             HHHhhcCcccCCCHHHHhcc
Confidence            47999999999999998764


No 263
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=61.62  E-value=7.3  Score=29.21  Aligned_cols=22  Identities=5%  Similarity=-0.017  Sum_probs=17.9

Q ss_pred             CeeEeceeccccCceEEEeEEe
Q psy15827         77 HIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...+.+.||.|+||.||++.-.
T Consensus        68 ~y~~~~~lg~G~~g~vy~a~~~   89 (478)
T PTZ00267         68 MYVLTTLVGRNPTTAAFVATRG   89 (478)
T ss_pred             eEEEEEEEEeCCCcEEEEEEEc
Confidence            3566789999999999988643


No 264
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=60.64  E-value=2.4  Score=29.73  Aligned_cols=17  Identities=18%  Similarity=0.387  Sum_probs=14.7

Q ss_pred             hhhcccCCCCCCCHH-HH
Q psy15827          2 YYCWDKEPNERPNFT-EL   18 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~-~i   18 (101)
                      .+||..+|.+||+.. ++
T Consensus       228 ~~~l~~~P~~R~~~~~~l  245 (316)
T cd05619         228 VKLFVREPERRLGVKGDI  245 (316)
T ss_pred             HHHhccCHhhcCCChHHH
Confidence            589999999999997 44


No 265
>PF13095 FTA2:  Kinetochore Sim4 complex subunit FTA2
Probab=60.16  E-value=21  Score=24.38  Aligned_cols=25  Identities=36%  Similarity=0.640  Sum_probs=22.5

Q ss_pred             CCeeEeceeccccC-ceEEEeEEecC
Q psy15827         76 QHIKVFDILGEGCF-GQVWKCEALGI  100 (101)
Q Consensus        76 ~~~~~~~~lG~G~f-g~v~~g~~~g~  100 (101)
                      .+|++.+.||.|.- |.||+.+..|.
T Consensus        37 ~~I~flefLg~g~~~~~V~kv~I~g~   62 (207)
T PF13095_consen   37 DDIEFLEFLGHGSHDGYVFKVEIDGR   62 (207)
T ss_pred             CcEeeeeecCCCCceeEEEEEEECCe
Confidence            79999999999999 99999888763


No 266
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=59.17  E-value=2.5  Score=29.63  Aligned_cols=16  Identities=13%  Similarity=0.409  Sum_probs=13.9

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+||+.||.+||+..
T Consensus       227 i~~~l~~dP~~R~~~~  242 (316)
T cd05620         227 LEKLFERDPTRRLGVV  242 (316)
T ss_pred             HHHHccCCHHHcCCCh
Confidence            3689999999999974


No 267
>KOG0584|consensus
Probab=59.09  E-value=4.5  Score=31.92  Aligned_cols=20  Identities=35%  Similarity=0.609  Sum_probs=17.5

Q ss_pred             CeeEeceeccccCceEEEeE
Q psy15827         77 HIKVFDILGEGCFGQVWKCE   96 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~   96 (101)
                      .+.+.+.||+|+|-.||+|.
T Consensus        41 y~k~~evLGrGafKtVYka~   60 (632)
T KOG0584|consen   41 YLKFDEVLGRGAFKTVYKAF   60 (632)
T ss_pred             eeehhhhcccccceeeeecc
Confidence            56778899999999999985


No 268
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=59.07  E-value=2.9  Score=28.60  Aligned_cols=13  Identities=8%  Similarity=-0.031  Sum_probs=11.4

Q ss_pred             hhhcccCCCCCCC
Q psy15827          2 YYCWDKEPNERPN   14 (101)
Q Consensus         2 ~~CW~~~p~~RPs   14 (101)
                      .+||..+|.+|++
T Consensus       230 ~~~l~~~p~~R~~  242 (290)
T cd05580         230 RNLLQVDLTKRLG  242 (290)
T ss_pred             HHHccCCHHHccC
Confidence            6899999999983


No 269
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=58.79  E-value=3.3  Score=29.10  Aligned_cols=19  Identities=21%  Similarity=0.319  Sum_probs=15.8

Q ss_pred             hhhcccCCCCCCC-HHHHHHH
Q psy15827          2 YYCWDKEPNERPN-FTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPs-f~~i~~~   21 (101)
                      .+|+. +|.+||+ +.+++.+
T Consensus       266 ~~ll~-dp~~R~~s~~~ll~h  285 (350)
T cd05573         266 CRLLC-DPEDRLGSFEEIKSH  285 (350)
T ss_pred             HHHcc-ChhhcCCCHHHHhcC
Confidence            57887 9999999 9988764


No 270
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=58.66  E-value=3.4  Score=28.91  Aligned_cols=16  Identities=13%  Similarity=0.443  Sum_probs=14.0

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+||+.+|.+||+..
T Consensus       227 l~~~l~~~P~~R~~~~  242 (316)
T cd05592         227 LSKLFERDPTKRLGVD  242 (316)
T ss_pred             HHHHccCCHHHcCCCh
Confidence            3689999999999985


No 271
>KOG0614|consensus
Probab=58.41  E-value=3.9  Score=32.02  Aligned_cols=26  Identities=31%  Similarity=0.373  Sum_probs=20.9

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +..+++.....||-|.||.|-.-..+
T Consensus       417 v~l~dl~~iaTLGvGgFGRVELV~~~  442 (732)
T KOG0614|consen  417 VKLSDLKRIATLGVGGFGRVELVKVN  442 (732)
T ss_pred             cchhhhhhhhhcccCccceEEEEEec
Confidence            55667888889999999999876554


No 272
>KOG0579|consensus
Probab=57.97  E-value=0.91  Score=36.45  Aligned_cols=17  Identities=41%  Similarity=0.780  Sum_probs=13.9

Q ss_pred             ceeccccCceEEEeEEe
Q psy15827         82 DILGEGCFGQVWKCEAL   98 (101)
Q Consensus        82 ~~lG~G~fg~v~~g~~~   98 (101)
                      -.||-|+||.||++.-+
T Consensus        38 GELGDGAFGKVyKA~nk   54 (1187)
T KOG0579|consen   38 GELGDGAFGKVYKAVNK   54 (1187)
T ss_pred             hhhcCccchhhhhhhcc
Confidence            46899999999987643


No 273
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=57.80  E-value=3.5  Score=28.84  Aligned_cols=16  Identities=19%  Similarity=0.202  Sum_probs=13.3

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+||..||.+||++.
T Consensus       232 i~~~L~~dP~~R~~~~  247 (324)
T cd05589         232 MRRLLRRNPERRLGSG  247 (324)
T ss_pred             HHHHhhcCHhHcCCCC
Confidence            4689999999999644


No 274
>KOG0664|consensus
Probab=57.46  E-value=4.1  Score=29.60  Aligned_cols=19  Identities=42%  Similarity=0.754  Sum_probs=15.6

Q ss_pred             CCeeEeceeccccCceEEE
Q psy15827         76 QHIKVFDILGEGCFGQVWK   94 (101)
Q Consensus        76 ~~~~~~~~lG~G~fg~v~~   94 (101)
                      .+|.-.+.||=|+||.||.
T Consensus        53 ~Di~PDRPIGYGAFGVVWs   71 (449)
T KOG0664|consen   53 QDIQPDRPIGYGAFGVVWS   71 (449)
T ss_pred             ccCCCCCcccccceeEEEe
Confidence            3566678899999999994


No 275
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=56.23  E-value=4.6  Score=31.30  Aligned_cols=20  Identities=5%  Similarity=-0.197  Sum_probs=17.3

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      .+|...||.+|||..+++++
T Consensus       431 ~~mL~~dP~kR~ta~e~L~H  450 (566)
T PLN03225        431 KSMMRFKGRQRISAKAALAH  450 (566)
T ss_pred             HHHccCCcccCCCHHHHhCC
Confidence            56889999999999998764


No 276
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=54.37  E-value=3.8  Score=28.86  Aligned_cols=15  Identities=27%  Similarity=0.386  Sum_probs=13.0

Q ss_pred             ChhhcccCCCCCCCH
Q psy15827          1 MYYCWDKEPNERPNF   15 (101)
Q Consensus         1 m~~CW~~~p~~RPsf   15 (101)
                      +.+|++.||.+||++
T Consensus       236 i~~~L~~dP~~R~~~  250 (329)
T cd05588         236 LKGFLNKDPKERLGC  250 (329)
T ss_pred             HHHHhccCHHHcCCC
Confidence            468999999999984


No 277
>KOG2345|consensus
Probab=53.86  E-value=14  Score=26.37  Aligned_cols=28  Identities=21%  Similarity=0.304  Sum_probs=23.3

Q ss_pred             CCceeeCCCeeEeceeccccCceEEEeE
Q psy15827         69 DKWEVPRQHIKVFDILGEGCFGQVWKCE   96 (101)
Q Consensus        69 ~~w~i~~~~~~~~~~lG~G~fg~v~~g~   96 (101)
                      +.--|+...-++.+.||+|.|..|+.++
T Consensus        14 ~tv~In~~Ryri~~~LgeGGfsfv~LV~   41 (302)
T KOG2345|consen   14 GTVIINNKRYRIQRLLGEGGFSFVDLVK   41 (302)
T ss_pred             CcEEEcCceEEEeeeecCCCceeeeeec
Confidence            3345888888889999999999999765


No 278
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=53.68  E-value=2.9  Score=29.36  Aligned_cols=20  Identities=20%  Similarity=0.343  Sum_probs=15.5

Q ss_pred             ChhhcccCCCCCC-----CHHHHHH
Q psy15827          1 MYYCWDKEPNERP-----NFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RP-----sf~~i~~   20 (101)
                      +.+||..+|.+||     +..++.+
T Consensus       226 i~~~L~~dP~~R~~~~~~~~~~~l~  250 (323)
T cd05595         226 LAGLLKKDPKQRLGGGPSDAKEVME  250 (323)
T ss_pred             HHHHccCCHHHhCCCCCCCHHHHHc
Confidence            3689999999998     6666654


No 279
>PHA03210 serine/threonine kinase US3; Provisional
Probab=53.53  E-value=6.3  Score=29.82  Aligned_cols=19  Identities=21%  Similarity=0.086  Sum_probs=16.9

Q ss_pred             hhhcccCCCCCCCHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~   20 (101)
                      .+|...||.+|||..+++.
T Consensus       435 ~kmL~~DP~~Rpsa~elL~  453 (501)
T PHA03210        435 VKMLTFDWHLRPGAAELLA  453 (501)
T ss_pred             HHHhccCcccCcCHHHHhh
Confidence            3689999999999999976


No 280
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=53.51  E-value=4.4  Score=28.37  Aligned_cols=20  Identities=15%  Similarity=0.262  Sum_probs=15.2

Q ss_pred             ChhhcccCCCCCC-----CHHHHHH
Q psy15827          1 MYYCWDKEPNERP-----NFTELCD   20 (101)
Q Consensus         1 m~~CW~~~p~~RP-----sf~~i~~   20 (101)
                      +.+||..+|.+||     +..++..
T Consensus       231 i~~~l~~~p~~R~~~~~~~~~~l~~  255 (323)
T cd05584         231 LKKLLKRNPSSRLGAGPGDAAEVQS  255 (323)
T ss_pred             HHHHcccCHhHcCCCCCCCHHHHhc
Confidence            4689999999999     5555543


No 281
>KOG0195|consensus
Probab=52.97  E-value=3.7  Score=29.83  Aligned_cols=29  Identities=21%  Similarity=0.436  Sum_probs=24.7

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEecCC
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEALGID  101 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~g~~  101 (101)
                      |...++.+...|.+.+-|+.|+|+|.|.+
T Consensus       187 id~~~lnl~tkl~e~hsgelwrgrwqgnd  215 (448)
T KOG0195|consen  187 IDVSSLNLITKLAESHSGELWRGRWQGND  215 (448)
T ss_pred             cchhhhhhhhhhccCCCcccccccccCcc
Confidence            66678888888999999999999998853


No 282
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=52.63  E-value=8.8  Score=29.80  Aligned_cols=17  Identities=18%  Similarity=0.087  Sum_probs=15.6

Q ss_pred             ceeccccCceEEEeEEe
Q psy15827         82 DILGEGCFGQVWKCEAL   98 (101)
Q Consensus        82 ~~lG~G~fg~v~~g~~~   98 (101)
                      +.||+|++|+||+++.+
T Consensus       125 ~PlasaSiaQVh~A~l~  141 (537)
T PRK04750        125 KPLASASIAQVHFARLK  141 (537)
T ss_pred             hhhcCCCccEEEEEEEC
Confidence            68999999999999986


No 283
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=51.97  E-value=3.8  Score=28.70  Aligned_cols=21  Identities=19%  Similarity=0.289  Sum_probs=16.8

Q ss_pred             ChhhcccCCCCCC-----CHHHHHHH
Q psy15827          1 MYYCWDKEPNERP-----NFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RP-----sf~~i~~~   21 (101)
                      +.+||..||.+|+     +..++.++
T Consensus       227 i~~~L~~dP~~R~~~~~~~~~~il~h  252 (325)
T cd05594         227 LSGLLKKDPKQRLGGGPDDAKEIMQH  252 (325)
T ss_pred             HHHHhhcCHHHhCCCCCCCHHHHhcC
Confidence            3579999999996     78877653


No 284
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=51.71  E-value=9.4  Score=31.69  Aligned_cols=27  Identities=30%  Similarity=0.265  Sum_probs=21.8

Q ss_pred             hhhcccCCCCCC-CHHHHHHHHHHHHhc
Q psy15827          2 YYCWDKEPNERP-NFTELCDLLEKLLLN   28 (101)
Q Consensus         2 ~~CW~~~p~~RP-sf~~i~~~l~~~~~~   28 (101)
                      .+|+..+|.+|| ++.++...|...++.
T Consensus       266 ~rcL~~DP~kR~ss~eeLl~~Le~~lq~  293 (932)
T PRK13184        266 MKALAVDPAERYSSVQELKQDLEPHLQG  293 (932)
T ss_pred             HHHccCChhhCcCHHHHHHHHHHHHHhc
Confidence            579999999995 677787888877664


No 285
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=51.26  E-value=5  Score=28.13  Aligned_cols=16  Identities=13%  Similarity=0.169  Sum_probs=13.1

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+||..+|.+||+..
T Consensus       229 i~~~L~~~P~~R~~~~  244 (330)
T cd05586         229 VKGLLNRNPQHRLGAH  244 (330)
T ss_pred             HHHHcCCCHHHCCCCC
Confidence            3679999999999654


No 286
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=51.08  E-value=5.5  Score=27.13  Aligned_cols=15  Identities=20%  Similarity=0.253  Sum_probs=12.1

Q ss_pred             ChhhcccCCCCCCCH
Q psy15827          1 MYYCWDKEPNERPNF   15 (101)
Q Consensus         1 m~~CW~~~p~~RPsf   15 (101)
                      +.+||+.+|.+||+.
T Consensus       243 l~~~l~~~p~~R~~~  257 (290)
T cd05613         243 IQRLLMKDPKKRLGC  257 (290)
T ss_pred             HHHHhcCCHHHhcCC
Confidence            358999999999844


No 287
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=50.41  E-value=4.6  Score=28.43  Aligned_cols=21  Identities=24%  Similarity=0.241  Sum_probs=16.5

Q ss_pred             ChhhcccCCCCCC-----CHHHHHHH
Q psy15827          1 MYYCWDKEPNERP-----NFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RP-----sf~~i~~~   21 (101)
                      +.+|+..+|.+||     +..+|.++
T Consensus       226 i~~~L~~dP~~R~~~~~~~~~~il~h  251 (328)
T cd05593         226 LSGLLIKDPNKRLGGGPDDAKEIMRH  251 (328)
T ss_pred             HHHHcCCCHHHcCCCCCCCHHHHhcC
Confidence            3589999999997     77777653


No 288
>KOG0671|consensus
Probab=49.44  E-value=7.5  Score=29.12  Aligned_cols=17  Identities=53%  Similarity=1.017  Sum_probs=14.3

Q ss_pred             eceeccccCceEEEeEE
Q psy15827         81 FDILGEGCFGQVWKCEA   97 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~~   97 (101)
                      ...+|+|.||.|.++.-
T Consensus        94 ~~~lGeGtFGkV~ec~D  110 (415)
T KOG0671|consen   94 VDLLGEGTFGKVVECWD  110 (415)
T ss_pred             hhhhcCCcccceEEEee
Confidence            56899999999988754


No 289
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=48.39  E-value=4.6  Score=28.29  Aligned_cols=17  Identities=18%  Similarity=0.110  Sum_probs=14.3

Q ss_pred             ChhhcccCCCCCCCHHH
Q psy15827          1 MYYCWDKEPNERPNFTE   17 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~   17 (101)
                      +.+|+..||.+||+..+
T Consensus       227 i~~~L~~dP~~R~~~~~  243 (320)
T cd05590         227 LKAFMTKNPTMRLGSLT  243 (320)
T ss_pred             HHHHcccCHHHCCCCCC
Confidence            36899999999999854


No 290
>KOG0690|consensus
Probab=47.76  E-value=7.9  Score=28.86  Aligned_cols=26  Identities=31%  Similarity=0.685  Sum_probs=19.9

Q ss_pred             eeCCCeeEeceeccccCceEEEeEEe
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      +.-++..+.+.||.|.||.|-.++=+
T Consensus       165 vTm~dFdfLKvLGkGTFGKVIL~rEK  190 (516)
T KOG0690|consen  165 VTMEDFDFLKVLGKGTFGKVILCREK  190 (516)
T ss_pred             eccchhhHHHHhcCCccceEEEEeec
Confidence            45556667789999999999876643


No 291
>KOG0574|consensus
Probab=47.33  E-value=1.6  Score=32.04  Aligned_cols=20  Identities=35%  Similarity=0.639  Sum_probs=15.8

Q ss_pred             eeEeceeccccCceEEEeEE
Q psy15827         78 IKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~   97 (101)
                      ..+...||+|+||.||++..
T Consensus        35 FDi~~KLGEGSYGSV~KAIH   54 (502)
T KOG0574|consen   35 FDIVGKLGEGSYGSVHKAIH   54 (502)
T ss_pred             HHHHHHhcCCcchHHHHHHH
Confidence            34467899999999998754


No 292
>KOG1345|consensus
Probab=46.38  E-value=5.9  Score=28.76  Aligned_cols=23  Identities=30%  Similarity=0.440  Sum_probs=18.3

Q ss_pred             eeEeceeccccCceEEEeEEecC
Q psy15827         78 IKVFDILGEGCFGQVWKCEALGI  100 (101)
Q Consensus        78 ~~~~~~lG~G~fg~v~~g~~~g~  100 (101)
                      -.+.+.||+|.||.+-.++.++.
T Consensus        26 y~I~k~lgeG~FgkIlL~eHr~s   48 (378)
T KOG1345|consen   26 YTINKQLGEGRFGKILLAEHRQS   48 (378)
T ss_pred             hhHHHHhcccceeeEEeeeccCC
Confidence            34567899999999998887653


No 293
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=45.31  E-value=6.5  Score=27.45  Aligned_cols=16  Identities=25%  Similarity=0.322  Sum_probs=12.9

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+|+..+|.+||++.
T Consensus       227 l~~~L~~dp~~R~~~~  242 (321)
T cd05591         227 LKAFMTKNPNKRLGCV  242 (321)
T ss_pred             HHHHhccCHHHcCCCC
Confidence            3579999999999544


No 294
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=44.99  E-value=6.3  Score=27.69  Aligned_cols=16  Identities=25%  Similarity=0.362  Sum_probs=13.2

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+|++.||.+|++..
T Consensus       234 i~~~L~~dP~~R~~~~  249 (327)
T cd05617         234 LKGFLNKDPKERLGCQ  249 (327)
T ss_pred             HHHHhccCHHHcCCCC
Confidence            3679999999999853


No 295
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=42.57  E-value=6  Score=27.66  Aligned_cols=16  Identities=19%  Similarity=0.081  Sum_probs=13.5

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+||..+|.+|++..
T Consensus       232 i~~~l~~~P~~R~~~~  247 (324)
T cd05587         232 CKGLLTKHPAKRLGCG  247 (324)
T ss_pred             HHHHhhcCHHHcCCCC
Confidence            3689999999999873


No 296
>KOG1290|consensus
Probab=39.68  E-value=28  Score=27.25  Aligned_cols=24  Identities=29%  Similarity=0.374  Sum_probs=18.7

Q ss_pred             eeCCCeeEeceeccccCceEEEeE
Q psy15827         73 VPRQHIKVFDILGEGCFGQVWKCE   96 (101)
Q Consensus        73 i~~~~~~~~~~lG~G~fg~v~~g~   96 (101)
                      +....-++.+.||=|+|..||++.
T Consensus        75 F~~gRY~v~rKLGWGHFSTVWLaw   98 (590)
T KOG1290|consen   75 FNGGRYHVQRKLGWGHFSTVWLAW   98 (590)
T ss_pred             ccCceEEEEEeccccccceeEEEe
Confidence            343455667899999999999875


No 297
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=39.13  E-value=34  Score=23.67  Aligned_cols=23  Identities=13%  Similarity=0.023  Sum_probs=18.7

Q ss_pred             CCCeeEeceeccccCceEEEeEE
Q psy15827         75 RQHIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        75 ~~~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      .......+.||.|.||.||....
T Consensus        30 ~~~y~~~~~l~~~~f~~v~l~~~   52 (232)
T PRK10359         30 SYNIKTIKVFRNIDDTKVSLIDT   52 (232)
T ss_pred             hCceEEEEEecCCCceEEEEEec
Confidence            45777889999999999997543


No 298
>KOG0983|consensus
Probab=38.54  E-value=11  Score=27.49  Aligned_cols=29  Identities=28%  Similarity=0.525  Sum_probs=22.7

Q ss_pred             ceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827         71 WEVPRQHIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        71 w~i~~~~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      ...+-.+|.....||+|.-|.||+.+++.
T Consensus        87 ~~~dindl~~l~dlGsGtcG~V~k~~~rs  115 (391)
T KOG0983|consen   87 YQADINDLENLGDLGSGTCGQVWKMRFRS  115 (391)
T ss_pred             cccChHHhhhHHhhcCCCccceEEEEEcc
Confidence            33445677777889999999999988764


No 299
>KOG1167|consensus
Probab=38.27  E-value=5.7  Score=29.86  Aligned_cols=21  Identities=38%  Similarity=0.689  Sum_probs=16.4

Q ss_pred             CeeEeceeccccCceEEEeEE
Q psy15827         77 HIKVFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~   97 (101)
                      .....+.||+|+|+.||+++.
T Consensus        37 ~~~~v~kigeGsFssv~~a~~   57 (418)
T KOG1167|consen   37 AYKVVNKIGEGSFSSVYKATD   57 (418)
T ss_pred             hhhhhccccccchhhhhhhhH
Confidence            344567899999999998764


No 300
>KOG4279|consensus
Probab=38.06  E-value=22  Score=29.32  Aligned_cols=15  Identities=33%  Similarity=0.897  Sum_probs=13.4

Q ss_pred             eeccccCceEEEeEE
Q psy15827         83 ILGEGCFGQVWKCEA   97 (101)
Q Consensus        83 ~lG~G~fg~v~~g~~   97 (101)
                      .||.|.||.||.|+-
T Consensus       582 VLGKGTYG~VYA~RD  596 (1226)
T KOG4279|consen  582 VLGKGTYGTVYAARD  596 (1226)
T ss_pred             EeecCceeEEEeecc
Confidence            689999999999873


No 301
>KOG4279|consensus
Probab=37.89  E-value=15  Score=30.31  Aligned_cols=25  Identities=24%  Similarity=0.703  Sum_probs=20.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHHh
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLLL   27 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~~   27 (101)
                      +++|+..+|.+||+.++++.  +..+.
T Consensus       812 ilrcFepd~~~R~sA~~LL~--DpFlq  836 (1226)
T KOG4279|consen  812 ILRCFEPDPCDRPSAKDLLQ--DPFLQ  836 (1226)
T ss_pred             HHHHcCCCcccCccHHHhcc--Ccccc
Confidence            46899999999999999865  34444


No 302
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=37.51  E-value=37  Score=24.26  Aligned_cols=23  Identities=22%  Similarity=0.390  Sum_probs=19.2

Q ss_pred             CeeEeceeccccCceEEEeEEec
Q psy15827         77 HIKVFDILGEGCFGQVWKCEALG   99 (101)
Q Consensus        77 ~~~~~~~lG~G~fg~v~~g~~~g   99 (101)
                      .++.++.||.|.|+.||..+-..
T Consensus        13 ~l~~~~~i~~g~~~~v~~v~d~~   35 (288)
T PF14531_consen   13 TLVRGRIIGKGGFSIVFEVTDVE   35 (288)
T ss_dssp             EEEEEEEEEEETTEEEEEEEETT
T ss_pred             EEEEccccccCCceEEEEEEEcc
Confidence            66778899999999999887543


No 303
>KOG0586|consensus
Probab=37.39  E-value=26  Score=27.66  Aligned_cols=20  Identities=20%  Similarity=0.458  Sum_probs=16.7

Q ss_pred             eEeceeccccCceEEEeEEe
Q psy15827         79 KVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        79 ~~~~~lG~G~fg~v~~g~~~   98 (101)
                      .+.+.||+|.|+.|.+++..
T Consensus        59 ~i~~tig~g~f~~V~La~~~   78 (596)
T KOG0586|consen   59 VIIKTIGKGNFAKVKLARHI   78 (596)
T ss_pred             eeeeeeccceeEEEEeeEec
Confidence            44678999999999998854


No 304
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=37.07  E-value=14  Score=25.13  Aligned_cols=19  Identities=16%  Similarity=0.101  Sum_probs=15.2

Q ss_pred             hhhcccCCCCCC-----CHHHHHH
Q psy15827          2 YYCWDKEPNERP-----NFTELCD   20 (101)
Q Consensus         2 ~~CW~~~p~~RP-----sf~~i~~   20 (101)
                      .+|+..+|.+||     +..++.+
T Consensus       231 ~~~l~~~p~~R~~~~~~~~~~ll~  254 (278)
T cd05606         231 EGLLQRDVNRRLGCLGRGAQEVKE  254 (278)
T ss_pred             HHHhhcCHHhccCCCCCCHHHHHh
Confidence            579999999999     6766653


No 305
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=36.40  E-value=8.7  Score=26.85  Aligned_cols=16  Identities=13%  Similarity=0.046  Sum_probs=13.5

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+|+..+|.+||+..
T Consensus       227 i~~~l~~~p~~R~~~~  242 (323)
T cd05575         227 LEGLLQKDRTKRLGAK  242 (323)
T ss_pred             HHHHhhcCHHhCCCCC
Confidence            3679999999999875


No 306
>KOG0582|consensus
Probab=35.96  E-value=36  Score=26.26  Aligned_cols=31  Identities=10%  Similarity=0.384  Sum_probs=26.9

Q ss_pred             CCCceeeCCCeeEeceeccccCceEEEeEEe
Q psy15827         68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEAL   98 (101)
Q Consensus        68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~   98 (101)
                      ...|.+...+-.+.+.||.|.-+.||+|+..
T Consensus        18 ~~~~p~n~~~YeL~e~IG~G~sa~V~~A~c~   48 (516)
T KOG0582|consen   18 EKEFPLNAKDYELQEVIGVGASAVVYLARCI   48 (516)
T ss_pred             cccCCCCccceeEEEEEeccceeEeeeeeec
Confidence            4568888899999999999999999998864


No 307
>KOG0578|consensus
Probab=34.49  E-value=18  Score=28.27  Aligned_cols=20  Identities=20%  Similarity=0.263  Sum_probs=17.9

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      .+|...|+.+||+..+|+++
T Consensus       504 ~~cL~~dv~~RasA~eLL~H  523 (550)
T KOG0578|consen  504 DRCLVVDVEQRASAKELLEH  523 (550)
T ss_pred             HHHhhcchhcCCCHHHHhcC
Confidence            47999999999999999764


No 308
>PF13220 DUF4028:  Protein of unknown function (DUF4028)
Probab=33.77  E-value=23  Score=18.98  Aligned_cols=14  Identities=29%  Similarity=0.330  Sum_probs=10.5

Q ss_pred             CCCCCCHHHHHHHH
Q psy15827          9 PNERPNFTELCDLL   22 (101)
Q Consensus         9 p~~RPsf~~i~~~l   22 (101)
                      --.||+|+++-..-
T Consensus        38 elgrptfkevekdw   51 (65)
T PF13220_consen   38 ELGRPTFKEVEKDW   51 (65)
T ss_pred             hhCCCcHHHHHHHH
Confidence            45799999986543


No 309
>PF08403 AA_permease_N:  Amino acid permease N-terminal;  InterPro: IPR013612 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell. A number of such proteins have been found to be evolutionary related [, , ]. These proteins appear to contain up to 12 transmembrane segments. The best conserved region in this family is located in the second transmembrane segment. This domain is found to the N terminus of the amino acid permease domain (IPR004841 from INTERPRO) in metazoan Na-K-Cl cotransporters. 
Probab=33.32  E-value=42  Score=19.11  Aligned_cols=19  Identities=37%  Similarity=0.567  Sum_probs=14.2

Q ss_pred             ccCCCCCCCHHHHHHHHHH
Q psy15827          6 DKEPNERPNFTELCDLLEK   24 (101)
Q Consensus         6 ~~~p~~RPsf~~i~~~l~~   24 (101)
                      ...-..|||..+|+..++.
T Consensus        34 ~~~k~~RPSL~~Lh~~~~~   52 (74)
T PF08403_consen   34 GGQKKSRPSLDELHSQLEK   52 (74)
T ss_pred             CCcccCCCCHHHHHHHhhc
Confidence            3344689999999887654


No 310
>KOG0589|consensus
Probab=32.17  E-value=24  Score=26.76  Aligned_cols=21  Identities=29%  Similarity=0.349  Sum_probs=18.7

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      |..|.+.+|..||+..+|+..
T Consensus       238 v~~~l~~~P~~RPsa~~LL~~  258 (426)
T KOG0589|consen  238 VKSMLRKNPEHRPSALELLRR  258 (426)
T ss_pred             HHHHhhcCCccCCCHHHHhhC
Confidence            467899999999999999876


No 311
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=31.92  E-value=11  Score=26.32  Aligned_cols=18  Identities=11%  Similarity=-0.049  Sum_probs=14.6

Q ss_pred             hhhcccCCCCCCCHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELC   19 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~   19 (101)
                      .+|++.+|.+||+..+..
T Consensus       228 ~~~l~~~p~~R~~~~~~~  245 (325)
T cd05602         228 EGLLQKDRTKRLGAKDDF  245 (325)
T ss_pred             HHHcccCHHHCCCCCCCH
Confidence            579999999999887543


No 312
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1. Death Domain (DD) found in tumor necrosis factor receptor-1 (TNFR-1). TNFR-1 has many names including TNFRSF1A, CD120a, p55, p60, and TNFR60. It activates two major intracellular signaling pathways that lead to the activation of the transcription factor NF-kB and the induction of cell death. Upon binding of its ligand TNF, TNFR-1 trimerizes which leads to the recruitment of an adaptor protein named TNFR-associated death domain protein (TRADD) through a DD/DD interaction. Mutations in the TNFRSF1A gene causes TNFR-associated periodic syndrome (TRAPS), a rare disorder characterized recurrent fever, myalgia, abdominal pain, conjunctivitis and skin eruptions. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation a
Probab=30.94  E-value=32  Score=19.78  Aligned_cols=25  Identities=16%  Similarity=0.405  Sum_probs=19.3

Q ss_pred             ChhhcccCCCC-CCCHHHHHHHHHHH
Q psy15827          1 MYYCWDKEPNE-RPNFTELCDLLEKL   25 (101)
Q Consensus         1 m~~CW~~~p~~-RPsf~~i~~~l~~~   25 (101)
                      |.++|...-.. +.+...++..|..+
T Consensus        45 mL~~W~~~~g~~~At~~~L~~aLr~~   70 (80)
T cd08313          45 MLKVWKERGPRPYATLQHLLSVLRDM   70 (80)
T ss_pred             HHHHHHHhcCCCcchHHHHHHHHHHc
Confidence            67788887554 88888888888765


No 313
>KOG1151|consensus
Probab=30.42  E-value=4.1  Score=31.51  Aligned_cols=16  Identities=38%  Similarity=0.775  Sum_probs=13.3

Q ss_pred             eceeccccCceEEEeE
Q psy15827         81 FDILGEGCFGQVWKCE   96 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~   96 (101)
                      ...||.|.|.+||++.
T Consensus       468 LhLLGrGGFSEVyKAF  483 (775)
T KOG1151|consen  468 LHLLGRGGFSEVYKAF  483 (775)
T ss_pred             HHHhccccHHHHHHhc
Confidence            4478999999999875


No 314
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=29.38  E-value=13  Score=25.92  Aligned_cols=18  Identities=17%  Similarity=0.080  Sum_probs=14.0

Q ss_pred             ChhhcccCCCCCCCHHHH
Q psy15827          1 MYYCWDKEPNERPNFTEL   18 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i   18 (101)
                      +.+|+..+|.+||+.+..
T Consensus       227 l~~ll~~~p~~R~~~~~~  244 (325)
T cd05604         227 LEELLEKDRQRRLGAKED  244 (325)
T ss_pred             HHHHhccCHHhcCCCCCC
Confidence            357889999999987643


No 315
>PF04468 PSP1:  PSP1 C-terminal conserved region;  InterPro: IPR007557 The yeast polymerase suppressor 1 (PSP1) protein partially suppresses mutations in DNA polymerases alpha and delta []. The C-terminal half of PSP1 contains a domain, which is also found in several hypothetical proteins from both eukaryotic and prokaryotic sources:   Crithidia fasciculata RBP45 and RBP33, subunits of the cycling sequence binding protein (CSBP) II. RBP45 and RBP33 proteins bind specifically to the cycling sequences present in several mRNAs that accumulate periodically during the cell cycle. RBP45 and RBP33 are phosphoproteins, which are phosphorylated differentially during progression through the cell cycle. Hypothetical proteins with high sequence similarity have been identified in other kinetoplastid organisms [].   Bacillus subtilis yaaT protein, which plays a significant role in phosphorelay during initiation of sporulation. It is possible that the yaaT protein is also related to DNA replication. The sequence of the yaaT protein is widely conserved in prokaryotes (bacteria and archaea), but the functions of the protein are unknown [].   The actual biological significance of the PSP1 C-terminal domain has not yet been clearly established.
Probab=28.28  E-value=66  Score=18.58  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=16.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHh
Q psy15827          8 EPNERPNFTELCDLLEKLLL   27 (101)
Q Consensus         8 ~p~~RPsf~~i~~~l~~~~~   27 (101)
                      ..+.|+.|+.+++.|...+.
T Consensus        61 ~a~~rvDFR~Lvr~L~~~f~   80 (88)
T PF04468_consen   61 TAESRVDFRELVRDLAREFK   80 (88)
T ss_pred             EeCCcCcHHHHHHHHHHHhC
Confidence            35789999999999987765


No 316
>KOG0579|consensus
Probab=25.45  E-value=41  Score=27.63  Aligned_cols=20  Identities=30%  Similarity=0.491  Sum_probs=17.5

Q ss_pred             hhhcccCCCCCCCHHHHHHH
Q psy15827          2 YYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         2 ~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +.|...+|..||+.++|+++
T Consensus       270 k~cL~Knp~~Rp~aaqll~H  289 (1187)
T KOG0579|consen  270 KRCLVKNPRNRPPAAQLLKH  289 (1187)
T ss_pred             HHHHhcCCccCCCHHHHhhC
Confidence            57999999999999988753


No 317
>KOG0587|consensus
Probab=23.97  E-value=74  Score=26.64  Aligned_cols=18  Identities=28%  Similarity=0.885  Sum_probs=14.6

Q ss_pred             EeceeccccCceEEEeEE
Q psy15827         80 VFDILGEGCFGQVWKCEA   97 (101)
Q Consensus        80 ~~~~lG~G~fg~v~~g~~   97 (101)
                      +.+.||.|.+|.||+++-
T Consensus        23 i~evig~Gtygkv~k~k~   40 (953)
T KOG0587|consen   23 IIEVIGNGTYGKVYKGRH   40 (953)
T ss_pred             EEEEEeeccceeEEEEee
Confidence            357899999999998763


No 318
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=23.92  E-value=51  Score=14.84  Aligned_cols=13  Identities=31%  Similarity=0.383  Sum_probs=10.1

Q ss_pred             CCCCCCHHHHHHH
Q psy15827          9 PNERPNFTELCDL   21 (101)
Q Consensus         9 p~~RPsf~~i~~~   21 (101)
                      -+.||+-.+++++
T Consensus         7 l~~RP~~eeLv~r   19 (26)
T smart00707        7 LSQRPTREELEER   19 (26)
T ss_pred             HHcCCCHHHHHHc
Confidence            4679999988763


No 319
>cd08784 Death_DRs Death Domain of Death Receptors. Death domain (DD) found in death receptor proteins. Death receptors are members of the tumor necrosis factor (TNF) receptor superfamily, characterized by having a cytoplasmic DD. Known members of the family are Fas (CD95/APO-1), TNF-receptor 1 (TNFR1/TNFRSF1A/p55/CD120a), TNF-related apoptosis-inducing ligand receptor 1 (TRAIL-R1 /DR4), and receptor 2 (TRAIL-R2/DR5/APO-2/KILLER), as well as Death Receptor 3 (DR3/APO-3/TRAMP/WSL-1/LARD). They are involved in apoptosis signaling pathways. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=23.10  E-value=55  Score=18.45  Aligned_cols=25  Identities=16%  Similarity=0.453  Sum_probs=16.7

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKL   25 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~   25 (101)
                      |+..|...--.+-|...+.+.|..+
T Consensus        45 mL~~W~~k~G~~At~~~L~~aL~~~   69 (79)
T cd08784          45 LLRIWRNKEGRKATLNTLIKALKDL   69 (79)
T ss_pred             HHHHHHhccCcCcHHHHHHHHHHHc
Confidence            5667777666677777776666544


No 320
>KOG0667|consensus
Probab=22.87  E-value=31  Score=27.24  Aligned_cols=21  Identities=19%  Similarity=0.338  Sum_probs=17.7

Q ss_pred             ChhhcccCCCCCCCHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDL   21 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~   21 (101)
                      +++|..+||..|+|..+.+.+
T Consensus       482 lk~~L~~dP~~R~tp~qal~H  502 (586)
T KOG0667|consen  482 LKRCLEWDPAERITPAQALNH  502 (586)
T ss_pred             HHHHhccCchhcCCHHHHhcC
Confidence            468999999999999987653


No 321
>KOG4645|consensus
Probab=22.73  E-value=45  Score=29.20  Aligned_cols=16  Identities=31%  Similarity=0.708  Sum_probs=13.3

Q ss_pred             eceeccccCceEEEeE
Q psy15827         81 FDILGEGCFGQVWKCE   96 (101)
Q Consensus        81 ~~~lG~G~fg~v~~g~   96 (101)
                      +..||.|.||.||-+.
T Consensus      1240 g~~Ig~G~fG~VYtav 1255 (1509)
T KOG4645|consen 1240 GNFIGGGTFGKVYTAV 1255 (1509)
T ss_pred             ccccCCcceeeeEEee
Confidence            3478999999999765


No 322
>PF02173 pKID:  pKID domain;  InterPro: IPR003102 The nuclear factor CREB activates transcription of target genes in part through direct interactions with the KIX domain of the coactivator CBP in a phosphorylation-dependent manner. CBP and P300 bind to the pKID (phosphorylated kinase-inducible-domain) domain of CREB [].; GO: 0005515 protein binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1KDX_B.
Probab=21.75  E-value=73  Score=16.01  Aligned_cols=14  Identities=21%  Similarity=0.579  Sum_probs=11.1

Q ss_pred             CCCCCHHHHHHHHH
Q psy15827         10 NERPNFTELCDLLE   23 (101)
Q Consensus        10 ~~RPsf~~i~~~l~   23 (101)
                      ..|||.+.|+..|.
T Consensus        17 sRRPSYRKIlndLs   30 (41)
T PF02173_consen   17 SRRPSYRKILNDLS   30 (41)
T ss_dssp             TTSTHHHHHHHHHH
T ss_pred             hhCchHHHHHHHhc
Confidence            47999998887764


No 323
>PF02755 RPEL:  RPEL repeat;  InterPro: IPR004018 The RPEL repeat is named after four conserved amino acids it contains. The function of the RPEL repeat is unknown however it might be a DNA binding repeat based on the observation that Q9VZY2 from SWISSPROT contains a SAP domain that is also implicated in DNA binding.; PDB: 2YJE_M 2V52_M 2YJF_M 2V51_E.
Probab=20.94  E-value=54  Score=14.68  Aligned_cols=11  Identities=36%  Similarity=0.679  Sum_probs=6.1

Q ss_pred             CCCCCHHHHHH
Q psy15827         10 NERPNFTELCD   20 (101)
Q Consensus        10 ~~RPsf~~i~~   20 (101)
                      ..||+..++++
T Consensus         8 ~~RP~~~eLv~   18 (26)
T PF02755_consen    8 SQRPTREELVE   18 (26)
T ss_dssp             HT---HHHHHH
T ss_pred             hcCCCHHHHHH
Confidence            47999998876


No 324
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=20.79  E-value=27  Score=24.29  Aligned_cols=16  Identities=13%  Similarity=0.063  Sum_probs=13.2

Q ss_pred             ChhhcccCCCCCCCHH
Q psy15827          1 MYYCWDKEPNERPNFT   16 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~   16 (101)
                      +.+|++.+|.+||+..
T Consensus       227 i~~~l~~~p~~R~~~~  242 (321)
T cd05603         227 LVGLLHKDQRRRLGAK  242 (321)
T ss_pred             HHHHccCCHhhcCCCC
Confidence            3579999999999864


No 325
>PF09039 HTH_Tnp_Mu_2:  Mu DNA binding, I gamma subdomain;  InterPro: IPR015126 This domain is responsible for binding the DNA attachment sites at each end of the Mu genome. They adopt a secondary structure comprising a four helix bundle tightly packed around a hydrophobic core consisting of aliphatic and aromatic amino acid residues. Helices 1 and 2 are oriented antiparallel to each other. Helix 3 crosses helices 1 and 2 at angles of 60 and 120 degrees, respectively. Excluding the C-terminal helix 4, the fold of the I-gamma subdomain is remarkably similar to that of the homeodomain family of helix-turn-helix DNA-binding proteins, although their amino acid sequences are completely unrelated []. ; PDB: 2EZL_A 2EZH_A 2EZI_A 2EZK_A.
Probab=20.77  E-value=1e+02  Score=18.72  Aligned_cols=20  Identities=20%  Similarity=0.356  Sum_probs=13.8

Q ss_pred             CCCCCCHHHHHHHHHHHHhc
Q psy15827          9 PNERPNFTELCDLLEKLLLN   28 (101)
Q Consensus         9 p~~RPsf~~i~~~l~~~~~~   28 (101)
                      -.++|+|+.+.+.+..+.+.
T Consensus        45 r~e~Ps~~~cyrr~~~~a~~   64 (108)
T PF09039_consen   45 RPEKPSFSACYRRLKRAAKE   64 (108)
T ss_dssp             STT---HHHHHHHHHHHHHH
T ss_pred             CccCCCHHHHHHHHHHHHHH
Confidence            35799999999999888765


No 326
>PF00531 Death:  Death domain;  InterPro: IPR000488 The death domain (DD) is a homotypic protein interaction module composed of a bundle of six alpha-helices. DD is related in sequence and structure to the death effector domain (DED, see IPR001875 from INTERPRO) and the caspase recruitment domain (CARD, see IPR001315 from INTERPRO), which work in similar pathways and show similar interaction properties []. DD bind each other forming oligomers. Mammals have numerous and diverse DD-containing proteins []. Within these proteins, the DD domains can be found in combination with other domains, including: CARDs, DEDs, ankyrin repeats (IPR002110 from INTERPRO), caspase-like folds, kinase domains, leucine zippers (IPR002158 from INTERPRO), leucine-rich repeats (LRR) (IPR001611 from INTERPRO), TIR domains (IPR000157 from INTERPRO), and ZU5 domains (IPR000906 from INTERPRO) []. Some DD-containing proteins are involved in the regulation of apoptosis and inflammation through their activation of caspases and NF-kappaB, which typically involves interactions with TNF (tumour necrosis factor) cytokine receptors [, ]. In humans, eight of the over 30 known TNF receptors contain DD in their cytoplasmic tails; several of these TNF receptors use caspase activation as a signalling mechanism. The DD mediates self-association of these receptors, thus giving the signal to downstream events that lead to apoptosis. Other DD-containing proteins, such as ankyrin, MyD88 and pelle, are probably not directly involved in cell death signalling. DD-containing proteins also have links to innate immunity, communicating with Toll family receptors through bipartite adapter proteins such as MyD88 [].; GO: 0005515 protein binding, 0007165 signal transduction; PDB: 3OQ9_L 3EZQ_F 1E41_A 1E3Y_A 2GF5_A 2OF5_L 3EWV_E 3G5B_A 3MOP_L 2A9I_A ....
Probab=20.30  E-value=29  Score=19.09  Aligned_cols=26  Identities=15%  Similarity=0.314  Sum_probs=17.1

Q ss_pred             ChhhcccCCCCCCCHHHHHHHHHHHH
Q psy15827          1 MYYCWDKEPNERPNFTELCDLLEKLL   26 (101)
Q Consensus         1 m~~CW~~~p~~RPsf~~i~~~l~~~~   26 (101)
                      |...|........|...++..|..+-
T Consensus        46 ~L~~W~~~~~~~at~~~L~~aL~~~~   71 (83)
T PF00531_consen   46 MLQRWRQREGPNATVDQLIQALRDIG   71 (83)
T ss_dssp             HHHHHHHHHGSTSSHHHHHHHHHHTT
T ss_pred             HHHHHHHhcCCCCcHHHHHHHHHHCC
Confidence            34566666666777777777776553


No 327
>PF09465 LBR_tudor:  Lamin-B receptor of TUDOR domain;  InterPro: IPR019023  The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane. It is one of the integral inner nuclear envelope membrane proteins responsible for targeting nuclear membranes to chromatin, being a downstream effector of Ran, a small Ras-like nuclear GTPase which regulates NE assembly. Lamin-B receptor interacts with importin beta, a Ran-binding protein, thereby directly contributing to the fusion of membrane vesicles and the formation of the nuclear envelope []. ; PDB: 2L8D_A 2DIG_A.
Probab=20.20  E-value=79  Score=16.95  Aligned_cols=11  Identities=27%  Similarity=0.299  Sum_probs=4.7

Q ss_pred             CceEEEeEEec
Q psy15827         89 FGQVWKCEALG   99 (101)
Q Consensus        89 fg~v~~g~~~g   99 (101)
                      .|++.+++|.|
T Consensus         8 ~Ge~V~~rWP~   18 (55)
T PF09465_consen    8 IGEVVMVRWPG   18 (55)
T ss_dssp             SS-EEEEE-TT
T ss_pred             CCCEEEEECCC
Confidence            45555555554


Done!