BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy15827
MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIELERFPDHSYYNMVSLSGEKLSNIMND
PVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID

High Scoring Gene Products

Symbol, full name Information P value
Cad96Ca
Cadherin 96Ca
protein from Drosophila melanogaster 3.4e-12
FGFR1
Uncharacterized protein
protein from Sus scrofa 4.3e-05
FGFR2
Fibroblast growth factor receptor 2
protein from Homo sapiens 4.9e-05
FGFR4
Fibroblast growth factor receptor
protein from Gallus gallus 8.1e-05
FGFR3
Uncharacterized protein
protein from Canis lupus familiaris 8.3e-05
FGFR3
Fibroblast growth factor receptor 3
protein from Gallus gallus 8.6e-05
FGFR3
Fibroblast growth factor receptor
protein from Gallus gallus 8.6e-05
Src
Rous sarcoma oncogene
protein from Mus musculus 8.7e-05
SRC
Uncharacterized protein
protein from Sus scrofa 9.0e-05
FGFR3
Fibroblast growth factor receptor
protein from Homo sapiens 0.00011
FGFR3
Fibroblast growth factor receptor
protein from Bos taurus 0.00011
FGFR3
Fibroblast growth factor receptor
protein from Canis lupus familiaris 0.00011
fgfr3
fibroblast growth factor receptor 3
gene_product from Danio rerio 0.00011
FGFR3
Fibroblast growth factor receptor 3
protein from Homo sapiens 0.00011
FGFR2
Fibroblast growth factor receptor 2
protein from Homo sapiens 0.00011
FGFR2
Fibroblast growth factor receptor
protein from Canis lupus familiaris 0.00012
FGFR2
Fibroblast growth factor receptor
protein from Homo sapiens 0.00012
Fgfr2
Fibroblast growth factor receptor
protein from Rattus norvegicus 0.00013
Fgfr3
fibroblast growth factor receptor 3
protein from Mus musculus 0.00014
FGFR2
Fibroblast growth factor receptor 2
protein from Homo sapiens 0.00014
Fgfr2
fibroblast growth factor receptor 2
protein from Mus musculus 0.00014
FGFR2
Fibroblast growth factor receptor
protein from Canis lupus familiaris 0.00014
FGFR2
Fibroblast growth factor receptor 2
protein from Gallus gallus 0.00014
FGFR2
Fibroblast growth factor receptor 2
protein from Pleurodeles waltl 0.00014
FGFR2
Fibroblast growth factor receptor
protein from Gallus gallus 0.00015
FGFR2
Fibroblast growth factor receptor
protein from Bos taurus 0.00015
Fgfr2
Fibroblast growth factor receptor
protein from Rattus norvegicus 0.00015
FGFR2
Fibroblast growth factor receptor
protein from Canis lupus familiaris 0.00015
Fgfr2
Fibroblast growth factor receptor
protein from Rattus norvegicus 0.00015
KDR
Uncharacterized protein
protein from Gallus gallus 0.00017
FGFR4
Fibroblast growth factor receptor 4
protein from Homo sapiens 0.00022
fgfr1a
fibroblast growth factor receptor 1a
gene_product from Danio rerio 0.00023
FGFR1
Fibroblast growth factor receptor
protein from Sus scrofa 0.00026
FGFR1
Fibroblast growth factor receptor
protein from Homo sapiens 0.00026
FGFR1
Fibroblast growth factor receptor
protein from Sus scrofa 0.00026
FGFR1
Fibroblast growth factor receptor
protein from Sus scrofa 0.00026
LCK
Uncharacterized protein
protein from Sus scrofa 0.00027
FGFR1
Fibroblast growth factor receptor
protein from Bos taurus 0.00030
FGFR1
Fibroblast growth factor receptor
protein from Sus scrofa 0.00030
FGFR1
Fibroblast growth factor receptor
protein from Canis lupus familiaris 0.00030
FGFR1
Fibroblast growth factor receptor
protein from Homo sapiens 0.00030
FGFR1
Fibroblast growth factor receptor 1
protein from Homo sapiens 0.00030
FGFR1
Fibroblast growth factor receptor
protein from Sus scrofa 0.00030
Fgfr1
fibroblast growth factor receptor 1
protein from Mus musculus 0.00030
Fgfr1
Fibroblast growth factor receptor 1
gene from Rattus norvegicus 0.00030
fgfr2
fibroblast growth factor receptor 2
gene_product from Danio rerio 0.00031
Fgfr4
fibroblast growth factor receptor 4
gene from Rattus norvegicus 0.00037
FGFR1
Fibroblast growth factor receptor
protein from Gallus gallus 0.00038
FGFR1
Fibroblast growth factor receptor 1
protein from Gallus gallus 0.00038
Fgfr4
fibroblast growth factor receptor 4
protein from Mus musculus 0.00047
FLT3
Uncharacterized protein
protein from Sus scrofa 0.00061
FGFR4
Uncharacterized protein
protein from Sus scrofa 0.00061
FLT3
Uncharacterized protein
protein from Sus scrofa 0.00067
FGFR4
Fibroblast growth factor receptor
protein from Canis lupus familiaris 0.00072
fgfr4
fibroblast growth factor receptor 4
gene_product from Danio rerio 0.00072
FLT3
Receptor-type tyrosine-protein kinase FLT3
protein from Homo sapiens 0.00074
FGFR4
Fibroblast growth factor receptor
protein from Canis lupus familiaris 0.00078
FGFR4
Uncharacterized protein
protein from Canis lupus familiaris 0.00078
fgfr1
Fibroblast growth factor receptor 1
protein from Xenopus laevis 0.00079
LCK
Proto-oncogene tyrosine-protein kinase LCK
protein from Gallus gallus 0.00092
FGFR4
Fibroblast growth factor receptor 4
protein from Homo sapiens 0.0010

The BLAST search returned 13 gene products which did not match your query constraints. Please see the full BLAST report below for the details.

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy15827
        (101 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

FB|FBgn0022800 - symbol:Cad96Ca "Cadherin 96Ca" species:7...   175  3.4e-12   1
UNIPROTKB|K7GQ46 - symbol:FGFR1 "Uncharacterized protein"...   101  4.3e-05   1
UNIPROTKB|H7C265 - symbol:FGFR2 "Fibroblast growth factor...   104  4.9e-05   1
UNIPROTKB|F1LQ69 - symbol:Fgfr2 "Protein Fgfr2" species:1...   104  4.9e-05   1
UNIPROTKB|F1NCL8 - symbol:FGFR3 "Fibroblast growth factor...   106  8.1e-05   1
UNIPROTKB|F1PK02 - symbol:FGFR3 "Uncharacterized protein"...   105  8.3e-05   1
UNIPROTKB|P18460 - symbol:FGFR3 "Fibroblast growth factor...   106  8.6e-05   1
UNIPROTKB|F1P3S0 - symbol:FGFR3 "Fibroblast growth factor...   106  8.6e-05   1
MGI|MGI:98397 - symbol:Src "Rous sarcoma oncogene" specie...    89  8.7e-05   2
UNIPROTKB|F1SEK8 - symbol:SRC "Uncharacterized protein" s...    89  9.0e-05   2
UNIPROTKB|F8W9L4 - symbol:FGFR3 "Fibroblast growth factor...   105  0.00011   1
UNIPROTKB|F6PVB0 - symbol:FGFR3 "Fibroblast growth factor...   105  0.00011   1
UNIPROTKB|F1P9Z7 - symbol:FGFR3 "Fibroblast growth factor...   105  0.00011   1
ZFIN|ZDB-GENE-000816-1 - symbol:fgfr3 "fibroblast growth ...   105  0.00011   1
UNIPROTKB|P22607 - symbol:FGFR3 "Fibroblast growth factor...   105  0.00011   1
UNIPROTKB|H7BXU9 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00011   1
UNIPROTKB|F1PPH0 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00012   1
UNIPROTKB|E7EVR7 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00012   1
UNIPROTKB|F1LN06 - symbol:Fgfr2 "Fibroblast growth factor...   104  0.00012   1
UNIPROTKB|F1LRU8 - symbol:Fgfr2 "Fibroblast growth factor...   104  0.00013   1
MGI|MGI:95524 - symbol:Fgfr3 "fibroblast growth factor re...   104  0.00014   1
UNIPROTKB|F1LSN4 - symbol:Fgfr3 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|F1LQA0 - symbol:Fgfr3 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|F1LNR8 - symbol:Fgfr2 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|P21802 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00014   1
MGI|MGI:95523 - symbol:Fgfr2 "fibroblast growth factor re...   104  0.00014   1
UNIPROTKB|F1PPD8 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|F1LSD0 - symbol:Fgfr2 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|P18461 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|F1NV76 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|Q91286 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|F1NV77 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00014   1
UNIPROTKB|F1NEE9 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00015   1
UNIPROTKB|F1MNW2 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00015   1
UNIPROTKB|F1LNW0 - symbol:Fgfr2 "Fibroblast growth factor...   104  0.00015   1
UNIPROTKB|F1Q2E3 - symbol:FGFR2 "Fibroblast growth factor...   104  0.00015   1
UNIPROTKB|F1LSG7 - symbol:Fgfr2 "Fibroblast growth factor...   104  0.00015   1
UNIPROTKB|F1NW21 - symbol:KDR "Uncharacterized protein" s...    90  0.00017   2
UNIPROTKB|Q90ZF0 - symbol:KDR "Flk-1 receptor" species:90...    90  0.00021   1
UNIPROTKB|H0Y9P2 - symbol:FGFR4 "Fibroblast growth factor...    96  0.00022   1
ZFIN|ZDB-GENE-980526-255 - symbol:fgfr1a "fibroblast grow...   102  0.00023   1
UNIPROTKB|K7GQJ1 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00026   1
UNIPROTKB|E7EU09 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00026   1
UNIPROTKB|K7GL40 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00026   1
UNIPROTKB|K7GL48 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00026   1
UNIPROTKB|F1LPM6 - symbol:Fgfr1 "Fibroblast growth factor...   101  0.00026   1
UNIPROTKB|F1SV94 - symbol:LCK "Uncharacterized protein" s...    99  0.00027   1
UNIPROTKB|F1M7N5 - symbol:Fgfr1 "Fibroblast growth factor...   101  0.00029   1
UNIPROTKB|A4IFL5 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00030   1
UNIPROTKB|F1RZJ8 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00030   1
UNIPROTKB|E2R186 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00030   1
UNIPROTKB|J3KNT4 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00030   1
UNIPROTKB|P11362 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00030   1
UNIPROTKB|K7GKU3 - symbol:FGFR1 "Fibroblast growth factor...   101  0.00030   1
MGI|MGI:95522 - symbol:Fgfr1 "fibroblast growth factor re...   101  0.00030   1
RGD|620713 - symbol:Fgfr1 "Fibroblast growth factor recep...   101  0.00030   1
UNIPROTKB|F1LM54 - symbol:Fgfr1 "Fibroblast growth factor...   101  0.00030   1
ZFIN|ZDB-GENE-030323-1 - symbol:fgfr2 "fibroblast growth ...   101  0.00031   1
RGD|2612 - symbol:Fgfr4 "fibroblast growth factor recepto...   100  0.00037   1
UNIPROTKB|Q498D6 - symbol:Fgfr4 "Fibroblast growth factor...   100  0.00037   1
UNIPROTKB|F1NJ92 - symbol:F1NJ92 "Fibroblast growth facto...   100  0.00038   1
UNIPROTKB|P21804 - symbol:FGFR1 "Fibroblast growth factor...   100  0.00038   1
MGI|MGI:95525 - symbol:Fgfr4 "fibroblast growth factor re...    99  0.00047   1
UNIPROTKB|K7GKA2 - symbol:FLT3 "Uncharacterized protein" ...    92  0.00061   2
UNIPROTKB|K7GKB5 - symbol:FGFR4 "Uncharacterized protein"...    91  0.00061   1
UNIPROTKB|F1RSW2 - symbol:FLT3 "Uncharacterized protein" ...    92  0.00067   2
UNIPROTKB|J9NUD6 - symbol:FGFR4 "Fibroblast growth factor...    97  0.00072   1
ZFIN|ZDB-GENE-980526-488 - symbol:fgfr4 "fibroblast growt...    98  0.00072   1
UNIPROTKB|E7ER61 - symbol:FLT3 "Receptor-type tyrosine-pr...    89  0.00074   2
UNIPROTKB|F6XBX5 - symbol:FGFR4 "Fibroblast growth factor...    97  0.00078   1
UNIPROTKB|E2QYW5 - symbol:FGFR4 "Uncharacterized protein"...    97  0.00078   1
UNIPROTKB|P22182 - symbol:fgfr1 "Fibroblast growth factor...    97  0.00079   1
UNIPROTKB|P42683 - symbol:LCK "Proto-oncogene tyrosine-pr...    94  0.00092   1
UNIPROTKB|P22455 - symbol:FGFR4 "Fibroblast growth factor...    96  0.0010    1


>FB|FBgn0022800 [details] [associations]
            symbol:Cad96Ca "Cadherin 96Ca" species:7227 "Drosophila
            melanogaster" [GO:0006468 "protein phosphorylation"
            evidence=IEA;ISS;NAS] [GO:0004713 "protein tyrosine kinase
            activity" evidence=ISS;NAS] [GO:0004714 "transmembrane receptor
            protein tyrosine kinase activity" evidence=ISS] [GO:0005887
            "integral to plasma membrane" evidence=ISS] [GO:0004672 "protein
            kinase activity" evidence=ISS] [GO:0016339 "calcium-dependent
            cell-cell adhesion" evidence=ISS] [GO:0007156 "homophilic cell
            adhesion" evidence=IEA] [GO:0005509 "calcium ion binding"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0016020
            "membrane" evidence=IEA] [GO:0045792 "negative regulation of cell
            size" evidence=IMP] [GO:0007030 "Golgi organization" evidence=IMP]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR002126
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR015919
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS00232 PROSITE:PS50011
            PROSITE:PS50268 SMART:SM00112 SMART:SM00219 EMBL:AE014297
            GO:GO:0005524 GO:GO:0005887 eggNOG:COG0515 GO:GO:0004714
            SUPFAM:SSF56112 GO:GO:0005509 GO:GO:0004713 GO:GO:0016339
            GO:GO:0045792 GO:GO:0007156 GO:GO:0007030 SUPFAM:SSF49313
            Gene3D:2.60.40.60 EMBL:AY070958 EMBL:BT001586 EMBL:BT001657
            EMBL:AJ002910 RefSeq:NP_651349.1 UniGene:Dm.6193
            ProteinModelPortal:Q9VBW3 SMR:Q9VBW3 STRING:Q9VBW3
            EnsemblMetazoa:FBtr0084874 GeneID:43026 KEGG:dme:Dmel_CG10244
            CTD:43026 FlyBase:FBgn0022800 GeneTree:ENSGT00670000097694
            InParanoid:Q9VBW3 KO:K08252 OMA:ELEVMKS OrthoDB:EOG4ZS7JC
            PhylomeDB:Q9VBW3 GenomeRNAi:43026 NextBio:831866 Bgee:Q9VBW3
            GermOnline:CG10244 Uniprot:Q9VBW3
        Length = 773

 Score = 175 (66.7 bits), Expect = 3.4e-12, P = 3.4e-12
 Identities = 32/54 (59%), Positives = 35/54 (64%)

Query:     1 MYYCWDKEPNERPNFTXXXXXXXXXXXXXTDYIELERFPDHSYYNMVSLSGEKL 54
             MYYCW  +P ERP F               DYIELERFPDH+YYN+VSLSGEKL
Sbjct:   720 MYYCWSHDPQERPLFAEIIQMLDKLLHTEMDYIELERFPDHNYYNIVSLSGEKL 773

 Score = 128 (50.1 bits), Expect = 3.6e-07, P = 3.6e-07
 Identities = 21/33 (63%), Positives = 26/33 (78%)

Query:    69 DKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D+WE PR  +K F+ILGEG FGQVW+CEA  I+
Sbjct:   461 DRWEFPRYRLKFFNILGEGAFGQVWRCEATNIN 493


>UNIPROTKB|K7GQ46 [details] [associations]
            symbol:FGFR1 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0005524 "ATP binding" evidence=IEA] [GO:0004672
            "protein kinase activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF07714 PROSITE:PS00107 PROSITE:PS50011
            PROSITE:PS50835 Gene3D:2.60.40.10 InterPro:IPR013783
            SUPFAM:SSF56112 GeneTree:ENSGT00670000097694 EMBL:CU571183
            Ensembl:ENSSSCT00000035373 Uniprot:K7GQ46
        Length = 235

 Score = 101 (40.6 bits), Expect = 4.3e-05, P = 4.3e-05
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   147 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 180


>UNIPROTKB|H7C265 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor 2"
            species:9606 "Homo sapiens" [GO:0004713 "protein tyrosine kinase
            activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 SMART:SM00219 GO:GO:0005524 SUPFAM:SSF56112
            GO:GO:0004713 EMBL:AC009988 HGNC:HGNC:3689
            ProteinModelPortal:H7C265 PRIDE:H7C265 Ensembl:ENST00000429361
            Bgee:H7C265 Uniprot:H7C265
        Length = 371

 Score = 104 (41.7 bits), Expect = 4.9e-05, P = 4.9e-05
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:    63 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 96


>UNIPROTKB|F1LQ69 [details] [associations]
            symbol:Fgfr2 "Protein Fgfr2" species:10116 "Rattus
            norvegicus" [GO:0004713 "protein tyrosine kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 SMART:SM00219 RGD:2611 GO:GO:0005524
            SUPFAM:SSF56112 GO:GO:0004713 IPI:IPI00206914
            Ensembl:ENSRNOT00000022042 ArrayExpress:F1LQ69 Uniprot:F1LQ69
        Length = 371

 Score = 104 (41.7 bits), Expect = 4.9e-05, P = 4.9e-05
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:    63 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 96


>UNIPROTKB|F1NCL8 [details] [associations]
            symbol:FGFR3 "Fibroblast growth factor receptor"
            species:9031 "Gallus gallus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GeneTree:ENSGT00670000097694
            InterPro:IPR013151 Pfam:PF00047 GO:GO:0005007 EMBL:AADN02014938
            EMBL:AADN02014939 EMBL:AADN02014940 EMBL:AADN02014941
            EMBL:AADN02014942 EMBL:AADN02014943 IPI:IPI00598143
            ProteinModelPortal:F1NCL8 Ensembl:ENSGALT00000025332 Uniprot:F1NCL8
        Length = 770

 Score = 106 (42.4 bits), Expect = 8.1e-05, P = 8.1e-05
 Identities = 24/54 (44%), Positives = 30/54 (55%)

Query:    48 SLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             S  G  L+N+     L    D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   403 SSDGPMLANVSE---LELPPDPKWELARSRLTLGKPLGEGCFGQVVMAEAIGID 453


>UNIPROTKB|F1PK02 [details] [associations]
            symbol:FGFR3 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0004713 "protein
            tyrosine kinase activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0016021
            GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 GO:GO:0004713 InterPro:IPR013098
            Pfam:PF07679 GeneTree:ENSGT00670000097694 EMBL:AAEX03002461
            Ensembl:ENSCAFT00000023773 Uniprot:F1PK02
        Length = 648

 Score = 105 (42.0 bits), Expect = 8.3e-05, P = 8.3e-05
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   290 GPALANVSE---LELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGID 337


>UNIPROTKB|P18460 [details] [associations]
            symbol:FGFR3 "Fibroblast growth factor receptor 3"
            species:9031 "Gallus gallus" [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0006915 "apoptotic process" evidence=IEA]
            [GO:0000122 "negative regulation of transcription from RNA
            polymerase II promoter" evidence=IEA] [GO:0000165 "MAPK cascade"
            evidence=IEA] [GO:0001938 "positive regulation of endothelial cell
            proliferation" evidence=IEA] [GO:0002009 "morphogenesis of an
            epithelium" evidence=IEA] [GO:0002089 "lens morphogenesis in
            camera-type eye" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005764
            "lysosome" evidence=IEA] [GO:0005887 "integral to plasma membrane"
            evidence=IEA] [GO:0009898 "internal side of plasma membrane"
            evidence=IEA] [GO:0010518 "positive regulation of phospholipase
            activity" evidence=IEA] [GO:0017134 "fibroblast growth factor
            binding" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0021762 "substantia nigra
            development" evidence=IEA] [GO:0022010 "central nervous system
            myelination" evidence=IEA] [GO:0031398 "positive regulation of
            protein ubiquitination" evidence=IEA] [GO:0035019 "somatic stem
            cell maintenance" evidence=IEA] [GO:0042511 "positive regulation of
            tyrosine phosphorylation of Stat1 protein" evidence=IEA]
            [GO:0042517 "positive regulation of tyrosine phosphorylation of
            Stat3 protein" evidence=IEA] [GO:0043065 "positive regulation of
            apoptotic process" evidence=IEA] [GO:0043066 "negative regulation
            of apoptotic process" evidence=IEA] [GO:0043552 "positive
            regulation of phosphatidylinositol 3-kinase activity" evidence=IEA]
            [GO:0045597 "positive regulation of cell differentiation"
            evidence=IEA] [GO:0045839 "negative regulation of mitosis"
            evidence=IEA] [GO:0045879 "negative regulation of smoothened
            signaling pathway" evidence=IEA] [GO:0046777 "protein
            autophosphorylation" evidence=IEA] [GO:0048471 "perinuclear region
            of cytoplasm" evidence=IEA] [GO:0048546 "digestive tract
            morphogenesis" evidence=IEA] [GO:0048678 "response to axon injury"
            evidence=IEA] [GO:0048712 "negative regulation of astrocyte
            differentiation" evidence=IEA] [GO:0050680 "negative regulation of
            epithelial cell proliferation" evidence=IEA] [GO:0051216 "cartilage
            development" evidence=IEA] [GO:0060113 "inner ear receptor cell
            differentiation" evidence=IEA] [GO:0060349 "bone morphogenesis"
            evidence=IEA] [GO:0060385 "axonogenesis involved in innervation"
            evidence=IEA] [GO:0061144 "alveolar secondary septum development"
            evidence=IEA] [GO:0070307 "lens fiber cell development"
            evidence=IEA] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=IEA] [GO:0072148 "epithelial cell fate
            commitment" evidence=IEA] [GO:0090080 "positive regulation of
            MAPKKK cascade by fibroblast growth factor receptor signaling
            pathway" evidence=IEA] [GO:0090102 "cochlea development"
            evidence=IEA] [GO:0090263 "positive regulation of canonical Wnt
            receptor signaling pathway" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0005524 GO:GO:0048471 GO:GO:0006915
            GO:GO:0000165 GO:GO:0043066 GO:GO:0030154 GO:GO:0005887
            Gene3D:2.60.40.10 InterPro:IPR013783 eggNOG:COG0515 GO:GO:0001938
            BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0045597 GO:GO:0048678
            GO:GO:0046777 GO:GO:0005764 GO:GO:0000122 GO:GO:0043065
            GO:GO:0031398 GO:GO:0045839 InterPro:IPR013098 Pfam:PF07679
            GO:GO:0090263 GO:GO:0050680 GO:GO:0010518 GO:GO:0042517
            GO:GO:0009898 GO:GO:0043552 InterPro:IPR013151 Pfam:PF00047
            GO:GO:0045879 GO:GO:0090080 HOVERGEN:HBG000345 GO:GO:0005007
            KO:K05094 HOGENOM:HOG000263410 EMBL:M35195 IPI:IPI00579747
            PIR:A35963 RefSeq:NP_990840.2 UniGene:Gga.14066
            ProteinModelPortal:P18460 SMR:P18460 STRING:P18460 GeneID:396515
            KEGG:gga:396515 CTD:2261 InParanoid:P18460 NextBio:20816552
            GO:GO:0042511 Uniprot:P18460
        Length = 806

 Score = 106 (42.4 bits), Expect = 8.6e-05, P = 8.6e-05
 Identities = 24/54 (44%), Positives = 30/54 (55%)

Query:    48 SLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             S  G  L+N+     L    D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   439 SSDGPMLANVSE---LELPPDPKWELARSRLTLGKPLGEGCFGQVVMAEAIGID 489


>UNIPROTKB|F1P3S0 [details] [associations]
            symbol:FGFR3 "Fibroblast growth factor receptor"
            species:9031 "Gallus gallus" [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0000122 "negative regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0000165 "MAPK
            cascade" evidence=IEA] [GO:0001938 "positive regulation of
            endothelial cell proliferation" evidence=IEA] [GO:0002009
            "morphogenesis of an epithelium" evidence=IEA] [GO:0002089 "lens
            morphogenesis in camera-type eye" evidence=IEA] [GO:0005007
            "fibroblast growth factor-activated receptor activity"
            evidence=IEA] [GO:0005764 "lysosome" evidence=IEA] [GO:0005887
            "integral to plasma membrane" evidence=IEA] [GO:0009898 "internal
            side of plasma membrane" evidence=IEA] [GO:0010518 "positive
            regulation of phospholipase activity" evidence=IEA] [GO:0017134
            "fibroblast growth factor binding" evidence=IEA] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0021762
            "substantia nigra development" evidence=IEA] [GO:0022010 "central
            nervous system myelination" evidence=IEA] [GO:0031398 "positive
            regulation of protein ubiquitination" evidence=IEA] [GO:0035019
            "somatic stem cell maintenance" evidence=IEA] [GO:0042511 "positive
            regulation of tyrosine phosphorylation of Stat1 protein"
            evidence=IEA] [GO:0042517 "positive regulation of tyrosine
            phosphorylation of Stat3 protein" evidence=IEA] [GO:0043065
            "positive regulation of apoptotic process" evidence=IEA]
            [GO:0043066 "negative regulation of apoptotic process"
            evidence=IEA] [GO:0043552 "positive regulation of
            phosphatidylinositol 3-kinase activity" evidence=IEA] [GO:0045597
            "positive regulation of cell differentiation" evidence=IEA]
            [GO:0045839 "negative regulation of mitosis" evidence=IEA]
            [GO:0045879 "negative regulation of smoothened signaling pathway"
            evidence=IEA] [GO:0046777 "protein autophosphorylation"
            evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0048546 "digestive tract morphogenesis"
            evidence=IEA] [GO:0048678 "response to axon injury" evidence=IEA]
            [GO:0048712 "negative regulation of astrocyte differentiation"
            evidence=IEA] [GO:0050680 "negative regulation of epithelial cell
            proliferation" evidence=IEA] [GO:0051216 "cartilage development"
            evidence=IEA] [GO:0060113 "inner ear receptor cell differentiation"
            evidence=IEA] [GO:0060349 "bone morphogenesis" evidence=IEA]
            [GO:0060385 "axonogenesis involved in innervation" evidence=IEA]
            [GO:0061144 "alveolar secondary septum development" evidence=IEA]
            [GO:0070307 "lens fiber cell development" evidence=IEA] [GO:0070374
            "positive regulation of ERK1 and ERK2 cascade" evidence=IEA]
            [GO:0072148 "epithelial cell fate commitment" evidence=IEA]
            [GO:0090080 "positive regulation of MAPKKK cascade by fibroblast
            growth factor receptor signaling pathway" evidence=IEA] [GO:0090102
            "cochlea development" evidence=IEA] [GO:0090263 "positive
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0005524 GO:GO:0048471 GO:GO:0000165 GO:GO:0043066
            GO:GO:0030154 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0001938 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0045597 GO:GO:0048678
            GO:GO:0046777 GO:GO:0005764 GO:GO:0000122 GO:GO:0043065
            GO:GO:0031398 GO:GO:0045839 InterPro:IPR013098 Pfam:PF07679
            GO:GO:0090263 GO:GO:0050680 GO:GO:0010518 GO:GO:0042517
            GO:GO:0009898 GeneTree:ENSGT00670000097694 GO:GO:0043552
            InterPro:IPR013151 Pfam:PF00047 GO:GO:0045879 GO:GO:0090080
            GO:GO:0005007 IPI:IPI00579747 GO:GO:0042511 OMA:VFTHDLL
            EMBL:AADN02014938 EMBL:AADN02014939 EMBL:AADN02014940
            EMBL:AADN02014941 EMBL:AADN02014942 EMBL:AADN02014943
            Ensembl:ENSGALT00000001712 Uniprot:F1P3S0
        Length = 811

 Score = 106 (42.4 bits), Expect = 8.6e-05, P = 8.6e-05
 Identities = 24/54 (44%), Positives = 30/54 (55%)

Query:    48 SLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             S  G  L+N+     L    D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   444 SSDGPMLANVSE---LELPPDPKWELARSRLTLGKPLGEGCFGQVVMAEAIGID 494


>MGI|MGI:98397 [details] [associations]
            symbol:Src "Rous sarcoma oncogene" species:10090 "Mus
            musculus" [GO:0000166 "nucleotide binding" evidence=IEA]
            [GO:0004672 "protein kinase activity" evidence=ISO;IDA] [GO:0004713
            "protein tyrosine kinase activity" evidence=ISO;IMP] [GO:0004715
            "non-membrane spanning protein tyrosine kinase activity"
            evidence=IEA] [GO:0005080 "protein kinase C binding" evidence=ISO]
            [GO:0005102 "receptor binding" evidence=ISO] [GO:0005158 "insulin
            receptor binding" evidence=ISO] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005634
            "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA;ISO]
            [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005743
            "mitochondrial inner membrane" evidence=ISO] [GO:0005764 "lysosome"
            evidence=ISO] [GO:0005770 "late endosome" evidence=ISO] [GO:0005856
            "cytoskeleton" evidence=IEA] [GO:0005886 "plasma membrane"
            evidence=ISO;IDA] [GO:0005901 "caveola" evidence=ISO] [GO:0006468
            "protein phosphorylation" evidence=IEA;IMP;IDA] [GO:0007049 "cell
            cycle" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA]
            [GO:0007243 "intracellular protein kinase cascade" evidence=ISO]
            [GO:0008022 "protein C-terminus binding" evidence=ISO] [GO:0008283
            "cell proliferation" evidence=ISO] [GO:0010628 "positive regulation
            of gene expression" evidence=ISO] [GO:0010740 "positive regulation
            of intracellular protein kinase cascade" evidence=ISO] [GO:0010907
            "positive regulation of glucose metabolic process" evidence=ISO]
            [GO:0014069 "postsynaptic density" evidence=ISO] [GO:0014911
            "positive regulation of smooth muscle cell migration" evidence=ISO]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016301 "kinase activity"
            evidence=IMP] [GO:0016310 "phosphorylation" evidence=IMP]
            [GO:0016477 "cell migration" evidence=IMP] [GO:0016740 "transferase
            activity" evidence=IEA] [GO:0016772 "transferase activity,
            transferring phosphorus-containing groups" evidence=IEA]
            [GO:0018105 "peptidyl-serine phosphorylation" evidence=ISO]
            [GO:0018108 "peptidyl-tyrosine phosphorylation" evidence=ISO;IDA]
            [GO:0019899 "enzyme binding" evidence=ISO] [GO:0019901 "protein
            kinase binding" evidence=ISO] [GO:0019904 "protein domain specific
            binding" evidence=IPI] [GO:0020037 "heme binding" evidence=ISO]
            [GO:0030331 "estrogen receptor binding" evidence=ISO] [GO:0030900
            "forebrain development" evidence=IGI] [GO:0031954 "positive
            regulation of protein autophosphorylation" evidence=ISO]
            [GO:0032148 "activation of protein kinase B activity" evidence=ISO]
            [GO:0032403 "protein complex binding" evidence=ISO] [GO:0032463
            "negative regulation of protein homooligomerization" evidence=ISO]
            [GO:0033146 "regulation of intracellular estrogen receptor
            signaling pathway" evidence=IMP] [GO:0034332 "adherens junction
            organization" evidence=ISO] [GO:0042169 "SH2 domain binding"
            evidence=ISO] [GO:0042802 "identical protein binding" evidence=ISO]
            [GO:0043005 "neuron projection" evidence=ISO] [GO:0043065 "positive
            regulation of apoptotic process" evidence=ISO] [GO:0043154
            "negative regulation of cysteine-type endopeptidase activity
            involved in apoptotic process" evidence=ISO] [GO:0043393
            "regulation of protein binding" evidence=IDA] [GO:0043406 "positive
            regulation of MAP kinase activity" evidence=ISO] [GO:0043552
            "positive regulation of phosphatidylinositol 3-kinase activity"
            evidence=ISO] [GO:0044325 "ion channel binding" evidence=ISO]
            [GO:0045056 "transcytosis" evidence=ISO] [GO:0045453 "bone
            resorption" evidence=IMP] [GO:0045737 "positive regulation of
            cyclin-dependent protein kinase activity" evidence=ISO] [GO:0045785
            "positive regulation of cell adhesion" evidence=ISO] [GO:0045892
            "negative regulation of transcription, DNA-dependent" evidence=ISO]
            [GO:0045893 "positive regulation of transcription, DNA-dependent"
            evidence=ISO] [GO:0046628 "positive regulation of insulin receptor
            signaling pathway" evidence=ISO] [GO:0046777 "protein
            autophosphorylation" evidence=ISO] [GO:0046875 "ephrin receptor
            binding" evidence=ISO;IPI] [GO:0048011 "neurotrophin TRK receptor
            signaling pathway" evidence=ISO] [GO:0048477 "oogenesis"
            evidence=IMP] [GO:0050715 "positive regulation of cytokine
            secretion" evidence=ISO] [GO:0050839 "cell adhesion molecule
            binding" evidence=ISO] [GO:0050847 "progesterone receptor signaling
            pathway" evidence=ISO] [GO:0051219 "phosphoprotein binding"
            evidence=ISO] [GO:0051222 "positive regulation of protein
            transport" evidence=ISO] [GO:0051895 "negative regulation of focal
            adhesion assembly" evidence=ISO] [GO:0051897 "positive regulation
            of protein kinase B signaling cascade" evidence=ISO] [GO:0060065
            "uterus development" evidence=IMP] [GO:0060444 "branching involved
            in mammary gland duct morphogenesis" evidence=IMP] [GO:0070374
            "positive regulation of ERK1 and ERK2 cascade" evidence=ISO;IMP]
            [GO:0070555 "response to interleukin-1" evidence=ISO] [GO:0071393
            "cellular response to progesterone stimulus" evidence=ISO]
            [GO:0071803 "positive regulation of podosome assembly"
            evidence=IGI;IDA] [GO:0090263 "positive regulation of canonical Wnt
            receptor signaling pathway" evidence=IGI] [GO:2000573 "positive
            regulation of DNA biosynthetic process" evidence=ISO] [GO:2000811
            "negative regulation of anoikis" evidence=ISO] [GO:2001237
            "negative regulation of extrinsic apoptotic signaling pathway"
            evidence=ISO] [GO:2001243 "negative regulation of intrinsic
            apoptotic signaling pathway" evidence=ISO] Pfam:PF00018
            Pfam:PF00017 InterPro:IPR000719 InterPro:IPR000980
            InterPro:IPR001245 InterPro:IPR001452 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PRINTS:PR00109 PRINTS:PR00401 PRINTS:PR00452
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50001 PROSITE:PS50002
            PROSITE:PS50011 SMART:SM00219 SMART:SM00252 SMART:SM00326
            MGI:MGI:98397 GO:GO:0005829 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0016477 GO:GO:0005856 GO:GO:0005743
            Gene3D:3.30.505.10 eggNOG:COG0515 GO:GO:0018108 SUPFAM:SSF56112
            GO:GO:0070374 GO:GO:0030900 GO:GO:0043393 GO:GO:0007155
            GO:GO:0048477 EMBL:CH466551 Reactome:REACT_115202 GO:GO:0020037
            SUPFAM:SSF50044 GO:GO:0007049 BRENDA:2.7.10.2 GO:GO:0004715
            Reactome:REACT_127416 GO:GO:0004713 GO:GO:0045453 GO:GO:0090263
            EMBL:AL672259 HOGENOM:HOG000233858 HOVERGEN:HBG008761 GO:GO:0033146
            GO:GO:0060444 GO:GO:0071803 GO:GO:0060065
            GeneTree:ENSGT00620000087702 CTD:6714 KO:K05704 OMA:CQCWRKD
            EMBL:M17031 EMBL:AY902331 IPI:IPI00222801 PIR:A43610
            RefSeq:NP_001020566.1 RefSeq:NP_033297.2 UniGene:Mm.22845
            ProteinModelPortal:P05480 SMR:P05480 DIP:DIP-31071N IntAct:P05480
            MINT:MINT-85032 STRING:P05480 PhosphoSite:P05480 PaxDb:P05480
            PRIDE:P05480 Ensembl:ENSMUST00000092576 Ensembl:ENSMUST00000109529
            GeneID:20779 KEGG:mmu:20779 InParanoid:Q2M4I4 OrthoDB:EOG4KKZ2S
            Reactome:REACT_23985 BindingDB:P05480 ChEMBL:CHEMBL3074
            NextBio:299503 Bgee:P05480 CleanEx:MM_SRC Genevestigator:P05480
            GermOnline:ENSMUSG00000027646 Uniprot:P05480
        Length = 541

 Score = 89 (36.4 bits), Expect = 8.7e-05, Sum P(2) = 8.7e-05
 Identities = 13/25 (52%), Positives = 20/25 (80%)

Query:    69 DKWEVPRQHIKVFDILGEGCFGQVW 93
             D WE+PR+ +++   LG+GCFG+VW
Sbjct:   266 DAWEIPRESLRLEVKLGQGCFGEVW 290

 Score = 36 (17.7 bits), Expect = 8.7e-05, Sum P(2) = 8.7e-05
 Identities = 8/42 (19%), Positives = 19/42 (45%)

Query:    30 TDYIELERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKW 71
             T ++ L  +   +  ++    GE+L  + N   ++ +  D W
Sbjct:    86 TTFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWW 127


>UNIPROTKB|F1SEK8 [details] [associations]
            symbol:SRC "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:2001243 "negative regulation of intrinsic apoptotic
            signaling pathway" evidence=IEA] [GO:2001237 "negative regulation
            of extrinsic apoptotic signaling pathway" evidence=IEA] [GO:2000811
            "negative regulation of anoikis" evidence=IEA] [GO:0090263
            "positive regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0071803 "positive regulation of podosome
            assembly" evidence=IEA] [GO:0070555 "response to interleukin-1"
            evidence=IEA] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=IEA] [GO:0060444 "branching involved in mammary
            gland duct morphogenesis" evidence=IEA] [GO:0060065 "uterus
            development" evidence=IEA] [GO:0051897 "positive regulation of
            protein kinase B signaling cascade" evidence=IEA] [GO:0048477
            "oogenesis" evidence=IEA] [GO:0046875 "ephrin receptor binding"
            evidence=IEA] [GO:0045453 "bone resorption" evidence=IEA]
            [GO:0044325 "ion channel binding" evidence=IEA] [GO:0043154
            "negative regulation of cysteine-type endopeptidase activity
            involved in apoptotic process" evidence=IEA] [GO:0042169 "SH2
            domain binding" evidence=IEA] [GO:0033146 "regulation of
            intracellular estrogen receptor signaling pathway" evidence=IEA]
            [GO:0032463 "negative regulation of protein homooligomerization"
            evidence=IEA] [GO:0030900 "forebrain development" evidence=IEA]
            [GO:0020037 "heme binding" evidence=IEA] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0016477 "cell
            migration" evidence=IEA] [GO:0007243 "intracellular protein kinase
            cascade" evidence=IEA] [GO:0005901 "caveola" evidence=IEA]
            [GO:0005770 "late endosome" evidence=IEA] [GO:0005764 "lysosome"
            evidence=IEA] [GO:0005743 "mitochondrial inner membrane"
            evidence=IEA] [GO:0004713 "protein tyrosine kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] Pfam:PF00018
            Pfam:PF00017 InterPro:IPR000719 InterPro:IPR000980
            InterPro:IPR001245 InterPro:IPR001452 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PRINTS:PR00109 PRINTS:PR00401 PRINTS:PR00452
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50001 PROSITE:PS50002
            PROSITE:PS50011 SMART:SM00219 SMART:SM00252 SMART:SM00326
            GO:GO:0005524 GO:GO:0016477 GO:GO:0005743 Gene3D:3.30.505.10
            GO:GO:0018108 SUPFAM:SSF56112 GO:GO:0030900 GO:GO:0048477
            GO:GO:0007243 GO:GO:0005764 GO:GO:0020037 GO:GO:0005770
            SUPFAM:SSF50044 GO:GO:0004713 GO:GO:0005901 GO:GO:0070555
            GO:GO:0090263 GO:GO:2001243 GO:GO:0033146 GO:GO:0060444
            GO:GO:2001237 GO:GO:0060065 GeneTree:ENSGT00620000087702
            OMA:CQCWRKD EMBL:CU024884 Ensembl:ENSSSCT00000008025
            Ensembl:ENSSSCT00000033033 Uniprot:F1SEK8
        Length = 548

 Score = 89 (36.4 bits), Expect = 9.0e-05, Sum P(2) = 9.0e-05
 Identities = 13/25 (52%), Positives = 20/25 (80%)

Query:    69 DKWEVPRQHIKVFDILGEGCFGQVW 93
             D WE+PR+ +++   LG+GCFG+VW
Sbjct:   273 DAWEIPRESLRLEVKLGQGCFGEVW 297

 Score = 36 (17.7 bits), Expect = 9.0e-05, Sum P(2) = 9.0e-05
 Identities = 8/42 (19%), Positives = 19/42 (45%)

Query:    30 TDYIELERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKW 71
             T ++ L  +   +  ++    GE+L  + N   ++ +  D W
Sbjct:    93 TTFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWW 134


>UNIPROTKB|F8W9L4 [details] [associations]
            symbol:FGFR3 "Fibroblast growth factor receptor"
            species:9606 "Homo sapiens" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0016021 "integral to membrane" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 GO:GO:0016021 GO:GO:0005524
            Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112
            InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 InterPro:IPR013151 Pfam:PF00047
            GO:GO:0005007 EMBL:AC016773 HGNC:HGNC:3690 ChiTaRS:FGFR3
            IPI:IPI00945340 ProteinModelPortal:F8W9L4 SMR:F8W9L4
            Ensembl:ENST00000481110 UCSC:uc003gdq.3 ArrayExpress:F8W9L4
            Bgee:F8W9L4 Uniprot:F8W9L4
        Length = 792

 Score = 105 (42.0 bits), Expect = 0.00011, P = 0.00011
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   449 GPTLANVSE---LELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGID 496


>UNIPROTKB|F6PVB0 [details] [associations]
            symbol:FGFR3 "Fibroblast growth factor receptor"
            species:9913 "Bos taurus" [GO:0090263 "positive regulation of
            canonical Wnt receptor signaling pathway" evidence=IEA] [GO:0090102
            "cochlea development" evidence=IEA] [GO:0090080 "positive
            regulation of MAPKKK cascade by fibroblast growth factor receptor
            signaling pathway" evidence=IEA] [GO:0072148 "epithelial cell fate
            commitment" evidence=IEA] [GO:0070374 "positive regulation of ERK1
            and ERK2 cascade" evidence=IEA] [GO:0070307 "lens fiber cell
            development" evidence=IEA] [GO:0061144 "alveolar secondary septum
            development" evidence=IEA] [GO:0060385 "axonogenesis involved in
            innervation" evidence=IEA] [GO:0060349 "bone morphogenesis"
            evidence=IEA] [GO:0060113 "inner ear receptor cell differentiation"
            evidence=IEA] [GO:0051216 "cartilage development" evidence=IEA]
            [GO:0050680 "negative regulation of epithelial cell proliferation"
            evidence=IEA] [GO:0048712 "negative regulation of astrocyte
            differentiation" evidence=IEA] [GO:0048678 "response to axon
            injury" evidence=IEA] [GO:0048546 "digestive tract morphogenesis"
            evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0046777 "protein autophosphorylation"
            evidence=IEA] [GO:0045879 "negative regulation of smoothened
            signaling pathway" evidence=IEA] [GO:0045839 "negative regulation
            of mitosis" evidence=IEA] [GO:0045597 "positive regulation of cell
            differentiation" evidence=IEA] [GO:0043552 "positive regulation of
            phosphatidylinositol 3-kinase activity" evidence=IEA] [GO:0043066
            "negative regulation of apoptotic process" evidence=IEA]
            [GO:0043065 "positive regulation of apoptotic process"
            evidence=IEA] [GO:0042517 "positive regulation of tyrosine
            phosphorylation of Stat3 protein" evidence=IEA] [GO:0042511
            "positive regulation of tyrosine phosphorylation of Stat1 protein"
            evidence=IEA] [GO:0035019 "somatic stem cell maintenance"
            evidence=IEA] [GO:0031398 "positive regulation of protein
            ubiquitination" evidence=IEA] [GO:0022010 "central nervous system
            myelination" evidence=IEA] [GO:0021762 "substantia nigra
            development" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0017134 "fibroblast growth
            factor binding" evidence=IEA] [GO:0010518 "positive regulation of
            phospholipase activity" evidence=IEA] [GO:0009898 "internal side of
            plasma membrane" evidence=IEA] [GO:0005887 "integral to plasma
            membrane" evidence=IEA] [GO:0005764 "lysosome" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] [GO:0002089 "lens morphogenesis in camera-type eye"
            evidence=IEA] [GO:0002009 "morphogenesis of an epithelium"
            evidence=IEA] [GO:0001938 "positive regulation of endothelial cell
            proliferation" evidence=IEA] [GO:0000165 "MAPK cascade"
            evidence=IEA] [GO:0000122 "negative regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0005524 GO:GO:0002009 GO:GO:0048471 GO:GO:0000165
            GO:GO:0043066 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0001938 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0045597 GO:GO:0048678
            GO:GO:0046777 GO:GO:0005764 GO:GO:0000122 GO:GO:0043065
            GO:GO:0051216 GO:GO:0022010 GO:GO:0031398 GO:GO:0035019
            GO:GO:0045839 InterPro:IPR013098 Pfam:PF07679 GO:GO:0090263
            GO:GO:0050680 GO:GO:0060349 GO:GO:0010518 GO:GO:0042517
            GO:GO:0009898 GO:GO:0090102 GO:GO:0048712 GO:GO:0048546
            GO:GO:0070307 GO:GO:0060113 GeneTree:ENSGT00670000097694
            GO:GO:0043552 GO:GO:0045879 GO:GO:0002089 GO:GO:0090080
            GO:GO:0021762 GO:GO:0005007 GO:GO:0042511 OMA:VFTHDLL GO:GO:0061144
            GO:GO:0060385 GO:GO:0072148 EMBL:DAAA02018571 EMBL:DAAA02018569
            EMBL:DAAA02018570 IPI:IPI00713396 Ensembl:ENSBTAT00000009427
            Uniprot:F6PVB0
        Length = 801

 Score = 105 (42.0 bits), Expect = 0.00011, P = 0.00011
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   444 GPTLANVSE---LELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGID 491


>UNIPROTKB|F1P9Z7 [details] [associations]
            symbol:FGFR3 "Fibroblast growth factor receptor"
            species:9615 "Canis lupus familiaris" [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 OMA:VFTHDLL
            EMBL:AAEX03002461 Ensembl:ENSCAFT00000026184 Uniprot:F1P9Z7
        Length = 801

 Score = 105 (42.0 bits), Expect = 0.00011, P = 0.00011
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   443 GPALANVSE---LELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGID 490


>ZFIN|ZDB-GENE-000816-1 [details] [associations]
            symbol:fgfr3 "fibroblast growth factor receptor 3"
            species:7955 "Danio rerio" [GO:0004672 "protein kinase activity"
            evidence=IEA] [GO:0004713 "protein tyrosine kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0008543 "fibroblast
            growth factor receptor signaling pathway" evidence=IEA] [GO:0004714
            "transmembrane receptor protein tyrosine kinase activity"
            evidence=IEA] [GO:0016740 "transferase activity" evidence=IEA]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016301 "kinase activity"
            evidence=IEA] [GO:0000166 "nucleotide binding" evidence=IEA]
            [GO:0005886 "plasma membrane" evidence=IEA] [GO:0016310
            "phosphorylation" evidence=IEA] [GO:0006915 "apoptotic process"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            ZFIN:ZDB-GENE-000816-1 GO:GO:0016021 GO:GO:0005524
            Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 EMBL:CR556722
            EMBL:CR559942 EMBL:CU694230 IPI:IPI01017053
            ProteinModelPortal:F1QPA0 Ensembl:ENSDART00000013534
            ArrayExpress:F1QPA0 Bgee:F1QPA0 Uniprot:F1QPA0
        Length = 804

 Score = 105 (42.0 bits), Expect = 0.00011, P = 0.00011
 Identities = 25/54 (46%), Positives = 29/54 (53%)

Query:    48 SLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             S  G  L N+     L   SD KWE  R  + +   LGEGCFGQV   EA+GID
Sbjct:   437 SSDGPMLPNVSE---LELPSDPKWEFTRTKLTLGKPLGEGCFGQVVMAEAIGID 487


>UNIPROTKB|P22607 [details] [associations]
            symbol:FGFR3 "Fibroblast growth factor receptor 3"
            species:9606 "Homo sapiens" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0006915 "apoptotic process" evidence=IEA] [GO:0000122 "negative
            regulation of transcription from RNA polymerase II promoter"
            evidence=IEA] [GO:0000165 "MAPK cascade" evidence=IEA] [GO:0001938
            "positive regulation of endothelial cell proliferation"
            evidence=IEA] [GO:0002009 "morphogenesis of an epithelium"
            evidence=IEA] [GO:0002089 "lens morphogenesis in camera-type eye"
            evidence=IEA] [GO:0005764 "lysosome" evidence=IEA] [GO:0009898
            "internal side of plasma membrane" evidence=IEA] [GO:0021762
            "substantia nigra development" evidence=IEA] [GO:0022010 "central
            nervous system myelination" evidence=IEA] [GO:0031398 "positive
            regulation of protein ubiquitination" evidence=IEA] [GO:0035019
            "somatic stem cell maintenance" evidence=IEA] [GO:0043065 "positive
            regulation of apoptotic process" evidence=IEA] [GO:0043066
            "negative regulation of apoptotic process" evidence=IEA]
            [GO:0045597 "positive regulation of cell differentiation"
            evidence=IEA] [GO:0045839 "negative regulation of mitosis"
            evidence=IEA] [GO:0045879 "negative regulation of smoothened
            signaling pathway" evidence=IEA] [GO:0048471 "perinuclear region of
            cytoplasm" evidence=IEA] [GO:0048546 "digestive tract
            morphogenesis" evidence=IEA] [GO:0048678 "response to axon injury"
            evidence=IEA] [GO:0048712 "negative regulation of astrocyte
            differentiation" evidence=IEA] [GO:0050680 "negative regulation of
            epithelial cell proliferation" evidence=IEA] [GO:0060113 "inner ear
            receptor cell differentiation" evidence=IEA] [GO:0060385
            "axonogenesis involved in innervation" evidence=IEA] [GO:0061144
            "alveolar secondary septum development" evidence=IEA] [GO:0070307
            "lens fiber cell development" evidence=IEA] [GO:0072148 "epithelial
            cell fate commitment" evidence=IEA] [GO:0090080 "positive
            regulation of MAPKKK cascade by fibroblast growth factor receptor
            signaling pathway" evidence=IEA] [GO:0090102 "cochlea development"
            evidence=IEA] [GO:0090263 "positive regulation of canonical Wnt
            receptor signaling pathway" evidence=IEA] [GO:0005783 "endoplasmic
            reticulum" evidence=IEA] [GO:0016023 "cytoplasmic membrane-bounded
            vesicle" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IMP] [GO:0008284
            "positive regulation of cell proliferation" evidence=IGI;IMP]
            [GO:0017134 "fibroblast growth factor binding" evidence=IDA;IPI]
            [GO:0008543 "fibroblast growth factor receptor signaling pathway"
            evidence=IGI;IDA;TAS] [GO:0005887 "integral to plasma membrane"
            evidence=IDA] [GO:0018108 "peptidyl-tyrosine phosphorylation"
            evidence=IDA] [GO:0043552 "positive regulation of
            phosphatidylinositol 3-kinase activity" evidence=IMP;TAS]
            [GO:0004713 "protein tyrosine kinase activity" evidence=IDA]
            [GO:0043410 "positive regulation of MAPK cascade" evidence=IMP]
            [GO:0042511 "positive regulation of tyrosine phosphorylation of
            Stat1 protein" evidence=IMP] [GO:0070374 "positive regulation of
            ERK1 and ERK2 cascade" evidence=IMP] [GO:0042517 "positive
            regulation of tyrosine phosphorylation of Stat3 protein"
            evidence=IMP] [GO:0046777 "protein autophosphorylation"
            evidence=IDA] [GO:0010518 "positive regulation of phospholipase
            activity" evidence=IMP] [GO:0042981 "regulation of apoptotic
            process" evidence=IMP] [GO:0060349 "bone morphogenesis"
            evidence=TAS] [GO:0035988 "chondrocyte proliferation" evidence=TAS]
            [GO:0002062 "chondrocyte differentiation" evidence=TAS] [GO:0005925
            "focal adhesion" evidence=TAS] [GO:0003416 "endochondral bone
            growth" evidence=TAS] [GO:0001958 "endochondral ossification"
            evidence=TAS] [GO:0001501 "skeletal system development"
            evidence=TAS] [GO:0007259 "JAK-STAT cascade" evidence=TAS]
            [GO:0005886 "plasma membrane" evidence=TAS] [GO:0008286 "insulin
            receptor signaling pathway" evidence=TAS] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0070977 "bone maturation" evidence=ISS]
            [GO:0048640 "negative regulation of developmental growth"
            evidence=ISS] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0005783 GO:GO:0005524 GO:GO:0002009 GO:GO:0048471
            Reactome:REACT_111102 Reactome:REACT_116125 Reactome:REACT_6900
            GO:GO:0006915 GO:GO:0008286 GO:GO:0000165 GO:GO:0043066
            GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0042981
            EMBL:CH471131 eggNOG:COG0515 GO:GO:0008284 GO:GO:0001938
            BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003599
            SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0070374
            GO:GO:0045597 GO:GO:0048678 GO:GO:0046777 GO:GO:0005764
            GO:GO:0016023 GO:GO:0000122 GO:GO:0043065 GO:GO:0022010
            GO:GO:0031398 GO:GO:0035019 GO:GO:0045839
            Pathway_Interaction_DB:fgf_pathway InterPro:IPR013098 Pfam:PF07679
            GO:GO:0002062 GO:GO:0090263 GO:GO:0050680 GO:GO:0017134
            GO:GO:0010518 GO:GO:0042517 GO:GO:0009898 GO:GO:0090102
            GO:GO:0048712 GO:GO:0048546 GO:GO:0070307 GO:GO:0001958
            GO:GO:0060113 GO:GO:0043552 GO:GO:0007259 MIM:254500
            InterPro:IPR013151 Pfam:PF00047 GO:GO:0045879 GO:GO:0002089
            DrugBank:DB00039 GO:GO:0035988 GO:GO:0003416 MIM:273300
            Orphanet:35098 MIM:149730 Orphanet:2363 PDB:1RY7 PDBsum:1RY7
            GO:GO:0090080 GO:GO:0021762 HOVERGEN:HBG000345 GO:GO:0005007
            KO:K05094 HOGENOM:HOG000263410 Orphanet:1555 Orphanet:794 CTD:2261
            GO:GO:0042511 EMBL:M58051 EMBL:AF245114 EMBL:AB209441 EMBL:AY768549
            EMBL:AC016773 EMBL:M64347 EMBL:M59374 EMBL:S76733 EMBL:X84939
            EMBL:U22410 IPI:IPI00027174 IPI:IPI00220253 IPI:IPI00220254
            IPI:IPI01013721 PIR:A38576 RefSeq:NP_000133.1 RefSeq:NP_001156685.1
            RefSeq:NP_075254.1 UniGene:Hs.1420 ProteinModelPortal:P22607
            SMR:P22607 DIP:DIP-4016N IntAct:P22607 MINT:MINT-1034697
            STRING:P22607 PhosphoSite:P22607 DMDM:120050 PaxDb:P22607
            PRIDE:P22607 DNASU:2261 Ensembl:ENST00000260795
            Ensembl:ENST00000340107 Ensembl:ENST00000352904
            Ensembl:ENST00000412135 Ensembl:ENST00000440486 GeneID:2261
            KEGG:hsa:2261 UCSC:uc003gdr.3 UCSC:uc003gds.3 UCSC:uc003gdu.2
            GeneCards:GC04P001795 HGNC:HGNC:3690 HPA:CAB004231 MIM:100800
            MIM:109800 MIM:134934 MIM:146000 MIM:162900 MIM:182000 MIM:187600
            MIM:187601 MIM:602849 MIM:603956 MIM:610474 MIM:612247
            neXtProt:NX_P22607 Orphanet:15 Orphanet:85164 Orphanet:93262
            Orphanet:429 Orphanet:35099 Orphanet:2343 Orphanet:53271
            Orphanet:85165 Orphanet:1860 Orphanet:93274 PharmGKB:PA28129
            OMA:VFTHDLL BindingDB:P22607 ChEMBL:CHEMBL2742 ChiTaRS:FGFR3
            EvolutionaryTrace:P22607 GenomeRNAi:2261 NextBio:9179
            ArrayExpress:P22607 Bgee:P22607 CleanEx:HS_FGFR3
            Genevestigator:P22607 GermOnline:ENSG00000068078 GO:GO:0061144
            GO:GO:0060385 GO:GO:0070977 GO:GO:0072148 GO:GO:0048640
            Uniprot:P22607
        Length = 806

 Score = 105 (42.0 bits), Expect = 0.00011, P = 0.00011
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   448 GPTLANVSE---LELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGID 495


>UNIPROTKB|H7BXU9 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor 2"
            species:9606 "Homo sapiens" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007 EMBL:AC009988
            HGNC:HGNC:3689 ProteinModelPortal:H7BXU9 SMR:H7BXU9
            Ensembl:ENST00000336553 Bgee:H7BXU9 Uniprot:H7BXU9
        Length = 669

 Score = 104 (41.7 bits), Expect = 0.00011, P = 0.00011
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   380 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 413


>UNIPROTKB|F1PPH0 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9615 "Canis lupus familiaris" [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 EMBL:AAEX03015597
            EMBL:AAEX03015596 Ensembl:ENSCAFT00000019648 Uniprot:F1PPH0
        Length = 707

 Score = 104 (41.7 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   357 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 390


>UNIPROTKB|E7EVR7 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9606 "Homo sapiens" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007 EMBL:AC009988
            HGNC:HGNC:3689 IPI:IPI00377178 ProteinModelPortal:E7EVR7 SMR:E7EVR7
            PRIDE:E7EVR7 Ensembl:ENST00000369059 ArrayExpress:E7EVR7
            Bgee:E7EVR7 Uniprot:E7EVR7
        Length = 707

 Score = 104 (41.7 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   357 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 390


>UNIPROTKB|F1LN06 [details] [associations]
            symbol:Fgfr2 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:2611 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 CTD:2263 KO:K05093
            IPI:IPI00876571 RefSeq:NP_001103365.1 UniGene:Rn.12732
            Ensembl:ENSRNOT00000022331 GeneID:25022 KEGG:rno:25022
            NextBio:605119 ArrayExpress:F1LN06 Uniprot:F1LN06
        Length = 726

 Score = 104 (41.7 bits), Expect = 0.00012, P = 0.00012
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   376 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 409


>UNIPROTKB|F1LRU8 [details] [associations]
            symbol:Fgfr2 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:2611 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 CTD:2263 KO:K05093
            UniGene:Rn.12732 GeneID:25022 KEGG:rno:25022 NextBio:605119
            IPI:IPI00206890 RefSeq:NP_001103363.1 Ensembl:ENSRNOT00000065448
            ArrayExpress:F1LRU8 Uniprot:F1LRU8
        Length = 752

 Score = 104 (41.7 bits), Expect = 0.00013, P = 0.00013
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   402 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 435


>MGI|MGI:95524 [details] [associations]
            symbol:Fgfr3 "fibroblast growth factor receptor 3"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IMP]
            [GO:0000165 "MAPK cascade" evidence=IDA] [GO:0000166 "nucleotide
            binding" evidence=IEA] [GO:0001938 "positive regulation of
            endothelial cell proliferation" evidence=IMP] [GO:0002009
            "morphogenesis of an epithelium" evidence=IMP] [GO:0002089 "lens
            morphogenesis in camera-type eye" evidence=IMP] [GO:0004672
            "protein kinase activity" evidence=IEA] [GO:0004713 "protein
            tyrosine kinase activity" evidence=ISO] [GO:0004714 "transmembrane
            receptor protein tyrosine kinase activity" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=ISO;IDA] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0005634 "nucleus"
            evidence=ISO] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005764
            "lysosome" evidence=IDA] [GO:0005783 "endoplasmic reticulum"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005887 "integral to plasma membrane" evidence=ISO] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0006915 "apoptotic
            process" evidence=IEA] [GO:0007267 "cell-cell signaling"
            evidence=ISO] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IGI;ISO] [GO:0008285 "negative regulation
            of cell proliferation" evidence=IGI;IMP] [GO:0008543 "fibroblast
            growth factor receptor signaling pathway" evidence=IGI;ISO;IDA]
            [GO:0009898 "internal side of plasma membrane" evidence=IDA]
            [GO:0009986 "cell surface" evidence=ISO] [GO:0010518 "positive
            regulation of phospholipase activity" evidence=ISO] [GO:0014003
            "oligodendrocyte development" evidence=IMP] [GO:0016020 "membrane"
            evidence=IEA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0016301 "kinase activity" evidence=IEA] [GO:0016310
            "phosphorylation" evidence=IEA] [GO:0016740 "transferase activity"
            evidence=IEA] [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0017134 "fibroblast
            growth factor binding" evidence=ISO] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=ISO] [GO:0021762 "substantia nigra
            development" evidence=IMP] [GO:0022010 "central nervous system
            myelination" evidence=IMP] [GO:0030154 "cell differentiation"
            evidence=IMP] [GO:0030900 "forebrain development" evidence=IMP]
            [GO:0031398 "positive regulation of protein ubiquitination"
            evidence=IDA] [GO:0031410 "cytoplasmic vesicle" evidence=IEA]
            [GO:0035019 "somatic stem cell maintenance" evidence=IMP]
            [GO:0036342 "post-anal tail morphogenesis" evidence=IMP]
            [GO:0042511 "positive regulation of tyrosine phosphorylation of
            Stat1 protein" evidence=ISO] [GO:0042517 "positive regulation of
            tyrosine phosphorylation of Stat3 protein" evidence=ISO]
            [GO:0042981 "regulation of apoptotic process" evidence=ISO]
            [GO:0043065 "positive regulation of apoptotic process"
            evidence=IMP] [GO:0043066 "negative regulation of apoptotic
            process" evidence=IMP] [GO:0043410 "positive regulation of MAPK
            cascade" evidence=ISO;IMP] [GO:0043552 "positive regulation of
            phosphatidylinositol 3-kinase activity" evidence=ISO] [GO:0045597
            "positive regulation of cell differentiation" evidence=IMP]
            [GO:0045839 "negative regulation of mitosis" evidence=IGI]
            [GO:0045879 "negative regulation of smoothened signaling pathway"
            evidence=IMP] [GO:0046777 "protein autophosphorylation"
            evidence=ISO] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IDA] [GO:0048546 "digestive tract morphogenesis"
            evidence=IMP] [GO:0048640 "negative regulation of developmental
            growth" evidence=IMP] [GO:0048678 "response to axon injury"
            evidence=IMP] [GO:0048712 "negative regulation of astrocyte
            differentiation" evidence=IMP] [GO:0048839 "inner ear development"
            evidence=IMP] [GO:0050680 "negative regulation of epithelial cell
            proliferation" evidence=ISO;IMP] [GO:0050731 "positive regulation
            of peptidyl-tyrosine phosphorylation" evidence=IDA] [GO:0051216
            "cartilage development" evidence=IMP] [GO:0060113 "inner ear
            receptor cell differentiation" evidence=IGI;IMP] [GO:0060349 "bone
            morphogenesis" evidence=IMP] [GO:0060385 "axonogenesis involved in
            innervation" evidence=IMP] [GO:0061144 "alveolar secondary septum
            development" evidence=IGI] [GO:0070307 "lens fiber cell
            development" evidence=IGI] [GO:0070374 "positive regulation of ERK1
            and ERK2 cascade" evidence=ISO] [GO:0070977 "bone maturation"
            evidence=IMP] [GO:0072148 "epithelial cell fate commitment"
            evidence=IMP] [GO:0090080 "positive regulation of MAPKKK cascade by
            fibroblast growth factor receptor signaling pathway" evidence=IGI]
            [GO:0090102 "cochlea development" evidence=IMP] [GO:0090263
            "positive regulation of canonical Wnt receptor signaling pathway"
            evidence=IMP] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            MGI:MGI:95524 GO:GO:0005783 GO:GO:0005524 GO:GO:0002009
            GO:GO:0048471 GO:GO:0006915 GO:GO:0000165 GO:GO:0043066
            GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783 eggNOG:COG0515
            GO:GO:0001938 BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 GO:GO:0070374 GO:GO:0045597
            GO:GO:0048678 GO:GO:0046777 GO:GO:0005764 GO:GO:0016023
            GO:GO:0000122 GO:GO:0043065 GO:GO:0051216 GO:GO:0022010
            GO:GO:0031398 GO:GO:0035019 GO:GO:0045839 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0090263 GO:GO:0050680 GO:GO:0060349
            GO:GO:0017134 GO:GO:0010518 GO:GO:0042517 GO:GO:0009898
            GO:GO:0090102 GO:GO:0048712 GO:GO:0036342 GO:GO:0048546
            GO:GO:0070307 GO:GO:0060113 GO:GO:0043552 GO:GO:0045879
            GO:GO:0002089 GO:GO:0090080 GO:GO:0021762 HOVERGEN:HBG000345
            GO:GO:0005007 HOGENOM:HOG000263410 GO:GO:0042511 ChiTaRS:FGFR3
            GO:GO:0061144 GO:GO:0060385 GO:GO:0070977 GO:GO:0072148
            GO:GO:0048640 EMBL:M81342 EMBL:S56291 EMBL:L26492 IPI:IPI00126264
            IPI:IPI00223033 PIR:A48991 PIR:I55363 UniGene:Mm.6904
            ProteinModelPortal:Q61851 SMR:Q61851 DIP:DIP-6031N IntAct:Q61851
            STRING:Q61851 PhosphoSite:Q61851 PaxDb:Q61851 PRIDE:Q61851
            UCSC:uc012dut.1 OrthoDB:EOG48WC1F ChEMBL:CHEMBL4066
            CleanEx:MM_FGFR3 Genevestigator:Q61851 Uniprot:Q61851
        Length = 801

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   442 GPVLANVSE---LELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGID 489


>UNIPROTKB|F1LSN4 [details] [associations]
            symbol:Fgfr3 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation
            of transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0000165 "MAPK cascade" evidence=IEA] [GO:0001938 "positive
            regulation of endothelial cell proliferation" evidence=IEA]
            [GO:0002009 "morphogenesis of an epithelium" evidence=IEA]
            [GO:0002089 "lens morphogenesis in camera-type eye" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005764
            "lysosome" evidence=IEA] [GO:0005887 "integral to plasma membrane"
            evidence=IEA] [GO:0009898 "internal side of plasma membrane"
            evidence=IEA] [GO:0010518 "positive regulation of phospholipase
            activity" evidence=IEA] [GO:0017134 "fibroblast growth factor
            binding" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0021762 "substantia nigra
            development" evidence=IEA] [GO:0022010 "central nervous system
            myelination" evidence=IEA] [GO:0031398 "positive regulation of
            protein ubiquitination" evidence=IEA] [GO:0035019 "somatic stem
            cell maintenance" evidence=IEA] [GO:0042511 "positive regulation of
            tyrosine phosphorylation of Stat1 protein" evidence=IEA]
            [GO:0042517 "positive regulation of tyrosine phosphorylation of
            Stat3 protein" evidence=IEA] [GO:0043065 "positive regulation of
            apoptotic process" evidence=IEA] [GO:0043066 "negative regulation
            of apoptotic process" evidence=IEA] [GO:0043552 "positive
            regulation of phosphatidylinositol 3-kinase activity" evidence=IEA]
            [GO:0045597 "positive regulation of cell differentiation"
            evidence=IEA] [GO:0045839 "negative regulation of mitosis"
            evidence=IEA] [GO:0045879 "negative regulation of smoothened
            signaling pathway" evidence=IEA] [GO:0046777 "protein
            autophosphorylation" evidence=IEA] [GO:0048471 "perinuclear region
            of cytoplasm" evidence=IEA] [GO:0048546 "digestive tract
            morphogenesis" evidence=IEA] [GO:0048678 "response to axon injury"
            evidence=IEA] [GO:0048712 "negative regulation of astrocyte
            differentiation" evidence=IEA] [GO:0050680 "negative regulation of
            epithelial cell proliferation" evidence=IEA] [GO:0051216 "cartilage
            development" evidence=IEA] [GO:0060113 "inner ear receptor cell
            differentiation" evidence=IEA] [GO:0060349 "bone morphogenesis"
            evidence=IEA] [GO:0060385 "axonogenesis involved in innervation"
            evidence=IEA] [GO:0061144 "alveolar secondary septum development"
            evidence=IEA] [GO:0070307 "lens fiber cell development"
            evidence=IEA] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=IEA] [GO:0072148 "epithelial cell fate
            commitment" evidence=IEA] [GO:0090080 "positive regulation of
            MAPKKK cascade by fibroblast growth factor receptor signaling
            pathway" evidence=IEA] [GO:0090102 "cochlea development"
            evidence=IEA] [GO:0090263 "positive regulation of canonical Wnt
            receptor signaling pathway" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 RGD:620714 GO:GO:0016021 GO:GO:0005524
            Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112
            InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GeneTree:ENSGT00670000097694
            GO:GO:0005007 IPI:IPI00200026 Ensembl:ENSRNOT00000023144
            ArrayExpress:F1LSN4 Uniprot:F1LSN4
        Length = 801

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   443 GPVLANVSE---LELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGID 490


>UNIPROTKB|F1LQA0 [details] [associations]
            symbol:Fgfr3 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:620714 GO:GO:0005524 GO:GO:0002009 GO:GO:0048471 GO:GO:0000165
            GO:GO:0043066 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0001938 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003599
            SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0070374
            GO:GO:0045597 GO:GO:0048678 GO:GO:0046777 GO:GO:0005764
            GO:GO:0000122 GO:GO:0043065 GO:GO:0051216 GO:GO:0022010
            GO:GO:0031398 GO:GO:0035019 GO:GO:0045839 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0090263 GO:GO:0050680 GO:GO:0060349
            GO:GO:0010518 GO:GO:0042517 GO:GO:0009898 GO:GO:0090102
            GO:GO:0048712 GO:GO:0048546 GO:GO:0070307 GO:GO:0060113
            GO:GO:0043552 GO:GO:0045879 GO:GO:0002089 GO:GO:0090080
            GO:GO:0021762 GO:GO:0005007 GO:GO:0042511 OMA:VFTHDLL GO:GO:0061144
            GO:GO:0060385 GO:GO:0072148 IPI:IPI00569376
            Ensembl:ENSRNOT00000040791 ArrayExpress:F1LQA0 Uniprot:F1LQA0
        Length = 802

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 23/51 (45%), Positives = 30/51 (58%)

Query:    51 GEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             G  L+N+     L   +D KWE+ R  + +   LGEGCFGQV   EA+GID
Sbjct:   444 GPVLANVSE---LELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGID 491


>UNIPROTKB|F1LNR8 [details] [associations]
            symbol:Fgfr2 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:2611 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007
            IPI:IPI00948303 Ensembl:ENSRNOT00000022289 ArrayExpress:F1LNR8
            Uniprot:F1LNR8
        Length = 814

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   472 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 505


>UNIPROTKB|P21802 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor 2"
            species:9606 "Homo sapiens" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0006915 "apoptotic process" evidence=IEA] [GO:0008201 "heparin
            binding" evidence=IEA] [GO:0007528 "neuromuscular junction
            development" evidence=IEA] [GO:0008285 "negative regulation of cell
            proliferation" evidence=IEA] [GO:0045839 "negative regulation of
            mitosis" evidence=IEA] [GO:0048489 "synaptic vesicle transport"
            evidence=IEA] [GO:0060365 "coronal suture morphogenesis"
            evidence=IEA] [GO:0061031 "endodermal digestive tract
            morphogenesis" evidence=IEA] [GO:0070307 "lens fiber cell
            development" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA]
            [GO:0016023 "cytoplasmic membrane-bounded vesicle" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IGI;IDA;NAS] [GO:0004713 "protein tyrosine kinase
            activity" evidence=NAS] [GO:0016021 "integral to membrane"
            evidence=NAS] [GO:0009986 "cell surface" evidence=IDA] [GO:0048568
            "embryonic organ development" evidence=ISS] [GO:0048608
            "reproductive structure development" evidence=ISS] [GO:0048730
            "epidermis morphogenesis" evidence=ISS] [GO:0048755 "branching
            morphogenesis of a nerve" evidence=ISS] [GO:0048762 "mesenchymal
            cell differentiation" evidence=ISS] [GO:0050679 "positive
            regulation of epithelial cell proliferation" evidence=ISS]
            [GO:0051150 "regulation of smooth muscle cell differentiation"
            evidence=ISS] [GO:0051781 "positive regulation of cell division"
            evidence=ISS] [GO:0055010 "ventricular cardiac muscle tissue
            morphogenesis" evidence=ISS] [GO:0060045 "positive regulation of
            cardiac muscle cell proliferation" evidence=ISS] [GO:0060174 "limb
            bud formation" evidence=ISS] [GO:0060348 "bone development"
            evidence=ISS] [GO:0060349 "bone morphogenesis" evidence=ISS]
            [GO:0060442 "branching involved in prostate gland morphogenesis"
            evidence=ISS] [GO:0060445 "branching involved in salivary gland
            morphogenesis" evidence=ISS] [GO:0060449 "bud elongation involved
            in lung branching" evidence=ISS] [GO:0060463 "lung lobe
            morphogenesis" evidence=ISS] [GO:0060484 "lung-associated
            mesenchyme development" evidence=ISS] [GO:0060501 "positive
            regulation of epithelial cell proliferation involved in lung
            morphogenesis" evidence=ISS] [GO:0060512 "prostate gland
            morphogenesis" evidence=ISS] [GO:0060523 "prostate epithelial cord
            elongation" evidence=ISS] [GO:0060527 "prostate epithelial cord
            arborization involved in prostate glandular acinus morphogenesis"
            evidence=ISS] [GO:0060529 "squamous basal epithelial stem cell
            differentiation involved in prostate gland acinus development"
            evidence=ISS] [GO:0060595 "fibroblast growth factor receptor
            signaling pathway involved in mammary gland specification"
            evidence=ISS] [GO:0060601 "lateral sprouting from an epithelium"
            evidence=ISS] [GO:0060615 "mammary gland bud formation"
            evidence=ISS] [GO:0060664 "epithelial cell proliferation involved
            in salivary gland morphogenesis" evidence=ISS] [GO:0060667 "branch
            elongation involved in salivary gland morphogenesis" evidence=ISS]
            [GO:0060670 "branching involved in labyrinthine layer
            morphogenesis" evidence=ISS] [GO:0060687 "regulation of branching
            involved in prostate gland morphogenesis" evidence=ISS] [GO:0060688
            "regulation of morphogenesis of a branching structure"
            evidence=ISS] [GO:0060915 "mesenchymal cell differentiation
            involved in lung development" evidence=ISS] [GO:0060916
            "mesenchymal cell proliferation involved in lung development"
            evidence=ISS] [GO:0070372 "regulation of ERK1 and ERK2 cascade"
            evidence=ISS] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=ISS] [GO:0090263 "positive regulation of
            canonical Wnt receptor signaling pathway" evidence=ISS] [GO:0021769
            "orbitofrontal cortex development" evidence=ISS] [GO:0021847
            "ventricular zone neuroblast division" evidence=ISS] [GO:0021860
            "pyramidal neuron development" evidence=ISS] [GO:0045787 "positive
            regulation of cell cycle" evidence=ISS] [GO:0060076 "excitatory
            synapse" evidence=ISS] [GO:0035602 "fibroblast growth factor
            receptor signaling pathway involved in negative regulation of
            apoptotic process in bone marrow" evidence=ISS] [GO:0035603
            "fibroblast growth factor receptor signaling pathway involved in
            hemopoiesis" evidence=ISS] [GO:0035604 "fibroblast growth factor
            receptor signaling pathway involved in positive regulation of cell
            proliferation in bone marrow" evidence=ISS] [GO:0035607 "fibroblast
            growth factor receptor signaling pathway involved in orbitofrontal
            cortex development" evidence=ISS] [GO:0031012 "extracellular
            matrix" evidence=IDA] [GO:0005737 "cytoplasm" evidence=IDA]
            [GO:0001525 "angiogenesis" evidence=ISS] [GO:0001657 "ureteric bud
            development" evidence=ISS] [GO:0001701 "in utero embryonic
            development" evidence=ISS] [GO:0002053 "positive regulation of
            mesenchymal cell proliferation" evidence=ISS] [GO:0003148 "outflow
            tract septum morphogenesis" evidence=ISS] [GO:0003149 "membranous
            septum morphogenesis" evidence=ISS] [GO:0007267 "cell-cell
            signaling" evidence=ISS] [GO:0007409 "axonogenesis" evidence=ISS]
            [GO:0008589 "regulation of smoothened signaling pathway"
            evidence=ISS] [GO:0032808 "lacrimal gland development"
            evidence=ISS] [GO:0035264 "multicellular organism growth"
            evidence=ISS] [GO:0035265 "organ growth" evidence=ISS] [GO:0040014
            "regulation of multicellular organism growth" evidence=ISS]
            [GO:0040036 "regulation of fibroblast growth factor receptor
            signaling pathway" evidence=ISS] [GO:0042472 "inner ear
            morphogenesis" evidence=ISS] [GO:0042476 "odontogenesis"
            evidence=ISS] [GO:0045165 "cell fate commitment" evidence=ISS]
            [GO:0048286 "lung alveolus development" evidence=ISS] [GO:0048557
            "embryonic digestive tract morphogenesis" evidence=ISS] [GO:0048562
            "embryonic organ morphogenesis" evidence=ISS] [GO:0048565
            "digestive tract development" evidence=ISS] [GO:0016020 "membrane"
            evidence=NAS] [GO:0005938 "cell cortex" evidence=IDA] [GO:0005634
            "nucleus" evidence=IDA] [GO:0017134 "fibroblast growth factor
            binding" evidence=IDA;IPI] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IGI;IMP;IDA] [GO:0008543 "fibroblast growth
            factor receptor signaling pathway" evidence=IGI;IDA;TAS;IPI]
            [GO:0046777 "protein autophosphorylation" evidence=IDA] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=IDA] [GO:0043410
            "positive regulation of MAPK cascade" evidence=IMP] [GO:0005887
            "integral to plasma membrane" evidence=IDA] [GO:0010518 "positive
            regulation of phospholipase activity" evidence=IMP] [GO:0042803
            "protein homodimerization activity" evidence=IPI] [GO:0033688
            "regulation of osteoblast proliferation" evidence=TAS] [GO:0048705
            "skeletal system morphogenesis" evidence=TAS] [GO:0045667
            "regulation of osteoblast differentiation" evidence=TAS]
            [GO:0009791 "post-embryonic development" evidence=ISS] [GO:0009880
            "embryonic pattern specification" evidence=ISS] [GO:0009887 "organ
            morphogenesis" evidence=ISS] [GO:0010453 "regulation of cell fate
            commitment" evidence=ISS] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=ISS]
            [GO:0000122 "negative regulation of transcription from RNA
            polymerase II promoter" evidence=ISS] [GO:0016331 "morphogenesis of
            embryonic epithelium" evidence=ISS] [GO:0022612 "gland
            morphogenesis" evidence=ISS] [GO:0030177 "positive regulation of
            Wnt receptor signaling pathway" evidence=ISS] [GO:0030282 "bone
            mineralization" evidence=ISS] [GO:0030324 "lung development"
            evidence=ISS] [GO:0030855 "epithelial cell differentiation"
            evidence=ISS] [GO:0030901 "midbrain development" evidence=ISS]
            [GO:0030916 "otic vesicle formation" evidence=ISS] [GO:0031069
            "hair follicle morphogenesis" evidence=ISS] [GO:0005886 "plasma
            membrane" evidence=IDA;TAS] [GO:0008286 "insulin receptor signaling
            pathway" evidence=TAS] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0042802 "identical protein binding" evidence=IPI] [GO:0048701
            "embryonic cranial skeleton morphogenesis" evidence=IMP]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0005524
            GO:GO:0005938 GO:GO:0005634 GO:GO:0005794 Reactome:REACT_111102
            Reactome:REACT_116125 Reactome:REACT_6900 GO:GO:0006915
            GO:GO:0008286 GO:GO:0005576 GO:GO:0008285 GO:GO:0009986
            GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783 eggNOG:COG0515
            GO:GO:0051781 GO:GO:0007528 BRENDA:2.7.10.1 GO:GO:0018108
            SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408 GO:GO:0070374
            GO:GO:0045944 GO:GO:0040014 GO:GO:0008201 GO:GO:0007267
            GO:GO:0046777 GO:GO:0001525 GO:GO:0016023 GO:GO:0000122
            GO:GO:0009791 GO:GO:0048286 GO:GO:0007409 GO:GO:0030901
            GO:GO:0035265 GO:GO:0035264 GO:GO:0060670 GO:GO:0048489
            GO:GO:0045839 Pathway_Interaction_DB:fgf_pathway InterPro:IPR013098
            Pfam:PF07679 GO:GO:0030282 GO:GO:0042476 GO:GO:0090263
            GO:GO:0009880 GO:GO:0033688 GO:GO:0060349 GO:GO:0045667
            GO:GO:0017134 GO:GO:0010518 GO:GO:0045165 GO:GO:0001657
            GO:GO:0060076 GO:GO:0045787 GO:GO:0021860 GO:GO:0031069
            GO:GO:0002053 MEROPS:I43.001 GO:GO:0070307 GO:GO:0060045
            GO:GO:0055010 GO:GO:0060449 GO:GO:0060687 GO:GO:0051150
            GO:GO:0008589 GO:GO:0030916 DrugBank:DB00039 GO:GO:0060174
            GO:GO:0060484 GO:GO:0060916 GO:GO:0048755 GO:GO:0040036
            GO:GO:0003148 GO:GO:0060527 GO:GO:0060523 PDB:1NUN PDBsum:1NUN
            MIM:149730 Orphanet:2363 GO:GO:0060667 GO:GO:0048557 GO:GO:0060664
            GO:GO:0060595 GO:GO:0032808 GO:GO:0060615 GO:GO:0060915 PDB:1DJS
            PDB:1E0O PDB:3CU1 PDB:3OJ2 PDB:3OJM PDBsum:1DJS PDBsum:1E0O
            PDBsum:3CU1 PDBsum:3OJ2 PDBsum:3OJM PDB:1EV2 PDB:1II4 PDB:1IIL
            PDBsum:1EV2 PDBsum:1II4 PDBsum:1IIL GO:GO:0060501 PDB:2FDB
            PDBsum:2FDB HOVERGEN:HBG000345 GO:GO:0005007 MIM:101600
            Orphanet:93258 HOGENOM:HOG000263410 GO:GO:0035607 GO:GO:0021847
            CTD:2263 KO:K05093 EMBL:X52832 EMBL:M55614 EMBL:X56191 EMBL:M35718
            EMBL:M87770 EMBL:M87771 EMBL:M87772 EMBL:M97193 EMBL:U11814
            EMBL:M80634 EMBL:Z71929 EMBL:AB030073 EMBL:AB030074 EMBL:AB030075
            EMBL:AB030076 EMBL:AB030077 EMBL:AB030078 EMBL:AF360695
            EMBL:AF410480 EMBL:AF487553 EMBL:AB084153 EMBL:DQ493927
            EMBL:AK294026 EMBL:AC009988 EMBL:BC039243 EMBL:AF169399
            EMBL:AF097353 EMBL:AF097341 EMBL:AF097342 EMBL:AF097343
            EMBL:AF097345 EMBL:AF097346 EMBL:AF097347 EMBL:AF097348
            EMBL:AF097349 EMBL:AF097350 EMBL:AF097351 EMBL:AF097352
            EMBL:AF097344 EMBL:AF097340 EMBL:AF097337 EMBL:AF097338
            EMBL:AF097339 EMBL:AF097354 EMBL:S82438 EMBL:Y17131 EMBL:L49237
            EMBL:L49242 EMBL:L49238 EMBL:L49239 EMBL:L49240 EMBL:L49241
            IPI:IPI00216602 IPI:IPI00216603 IPI:IPI00216604 IPI:IPI00216605
            IPI:IPI00218416 IPI:IPI00218417 IPI:IPI00218418 IPI:IPI00218419
            IPI:IPI00218420 IPI:IPI00218421 IPI:IPI00218422 IPI:IPI00218423
            IPI:IPI00218424 IPI:IPI00218425 IPI:IPI00384713 IPI:IPI00386650
            IPI:IPI00647907 IPI:IPI00759837 IPI:IPI00873362 IPI:IPI00942110
            PIR:A35969 PIR:A42691 PIR:A45081 PIR:C42691 PIR:S16236
            RefSeq:NP_000132.3 RefSeq:NP_001138385.1 RefSeq:NP_001138386.1
            RefSeq:NP_001138387.1 RefSeq:NP_001138388.1 RefSeq:NP_001138389.1
            RefSeq:NP_001138390.1 RefSeq:NP_001138391.1 RefSeq:NP_075259.4
            RefSeq:NP_075418.1 UniGene:Hs.533683 PDB:1GJO PDB:1OEC PDB:1WVZ
            PDB:2PSQ PDB:2PVF PDB:2PVY PDB:2PWL PDB:2PY3 PDB:2PZ5 PDB:2PZP
            PDB:2PZR PDB:2Q0B PDB:3B2T PDB:3CAF PDB:3CLY PDB:3DAR PDB:3EUU
            PDB:3RI1 PDBsum:1GJO PDBsum:1OEC PDBsum:1WVZ PDBsum:2PSQ
            PDBsum:2PVF PDBsum:2PVY PDBsum:2PWL PDBsum:2PY3 PDBsum:2PZ5
            PDBsum:2PZP PDBsum:2PZR PDBsum:2Q0B PDBsum:3B2T PDBsum:3CAF
            PDBsum:3CLY PDBsum:3DAR PDBsum:3EUU PDBsum:3RI1
            ProteinModelPortal:P21802 SMR:P21802 DIP:DIP-3788N IntAct:P21802
            MINT:MINT-118359 STRING:P21802 PhosphoSite:P21802 DMDM:120049
            PaxDb:P21802 PRIDE:P21802 Ensembl:ENST00000346997
            Ensembl:ENST00000351936 Ensembl:ENST00000356226
            Ensembl:ENST00000357555 Ensembl:ENST00000358487
            Ensembl:ENST00000359354 Ensembl:ENST00000360144
            Ensembl:ENST00000369056 Ensembl:ENST00000369058
            Ensembl:ENST00000369060 Ensembl:ENST00000369061
            Ensembl:ENST00000457416 GeneID:2263 KEGG:hsa:2263 UCSC:uc001lfg.4
            UCSC:uc010qtl.2 UCSC:uc021pzw.1 UCSC:uc021pzy.1 UCSC:uc021qaa.1
            GeneCards:GC10M123223 HGNC:HGNC:3689 HPA:CAB010886 HPA:HPA035305
            MIM:101200 MIM:123150 MIM:123500 MIM:123790 MIM:176943 MIM:207410
            MIM:609579 MIM:614592 neXtProt:NX_P21802 Orphanet:263476
            Orphanet:87 Orphanet:207 Orphanet:1555 Orphanet:168624
            Orphanet:1540 Orphanet:93259 Orphanet:93260 Orphanet:794
            PharmGKB:PA28128 OMA:YEPCLPK OrthoDB:EOG4640BC BindingDB:P21802
            ChEMBL:CHEMBL4142 EvolutionaryTrace:P21802 GenomeRNAi:2263
            NextBio:9189 ArrayExpress:P21802 Bgee:P21802 Genevestigator:P21802
            GermOnline:ENSG00000066468 GO:GO:0061031 GO:GO:0035603
            GO:GO:0035602 GO:GO:0035604 GO:GO:0060601 GO:GO:0060463
            GO:GO:0003149 GO:GO:0010453 GO:GO:0060529 Uniprot:P21802
        Length = 821

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   471 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 504


>MGI|MGI:95523 [details] [associations]
            symbol:Fgfr2 "fibroblast growth factor receptor 2"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IMP]
            [GO:0000166 "nucleotide binding" evidence=IEA] [GO:0001525
            "angiogenesis" evidence=IGI] [GO:0001657 "ureteric bud development"
            evidence=IGI] [GO:0001701 "in utero embryonic development"
            evidence=IGI;IMP] [GO:0001837 "epithelial to mesenchymal
            transition" evidence=ISO] [GO:0002053 "positive regulation of
            mesenchymal cell proliferation" evidence=IGI] [GO:0003148 "outflow
            tract septum morphogenesis" evidence=IMP] [GO:0003149 "membranous
            septum morphogenesis" evidence=IMP] [GO:0004672 "protein kinase
            activity" evidence=IEA] [GO:0004713 "protein tyrosine kinase
            activity" evidence=IEA] [GO:0004714 "transmembrane receptor protein
            tyrosine kinase activity" evidence=IEA] [GO:0005007 "fibroblast
            growth factor-activated receptor activity" evidence=ISO]
            [GO:0005515 "protein binding" evidence=IPI] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0005576 "extracellular region"
            evidence=TAS] [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737
            "cytoplasm" evidence=ISO] [GO:0005794 "Golgi apparatus"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005887 "integral to plasma membrane" evidence=ISO] [GO:0005938
            "cell cortex" evidence=ISO] [GO:0006468 "protein phosphorylation"
            evidence=IEA] [GO:0006915 "apoptotic process" evidence=IEA]
            [GO:0007267 "cell-cell signaling" evidence=IMP] [GO:0007409
            "axonogenesis" evidence=IMP] [GO:0007528 "neuromuscular junction
            development" evidence=IMP] [GO:0008201 "heparin binding"
            evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IGI;ISO;IMP] [GO:0008285 "negative
            regulation of cell proliferation" evidence=IGI] [GO:0008543
            "fibroblast growth factor receptor signaling pathway"
            evidence=IGI;ISO;IMP] [GO:0008589 "regulation of smoothened
            signaling pathway" evidence=IMP] [GO:0009791 "post-embryonic
            development" evidence=IMP] [GO:0009880 "embryonic pattern
            specification" evidence=IMP] [GO:0009887 "organ morphogenesis"
            evidence=IMP] [GO:0009986 "cell surface" evidence=ISO] [GO:0010453
            "regulation of cell fate commitment" evidence=IMP] [GO:0010518
            "positive regulation of phospholipase activity" evidence=ISO]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0016301 "kinase activity" evidence=IEA]
            [GO:0016310 "phosphorylation" evidence=IEA] [GO:0016331
            "morphogenesis of embryonic epithelium" evidence=IMP] [GO:0016740
            "transferase activity" evidence=IEA] [GO:0016772 "transferase
            activity, transferring phosphorus-containing groups" evidence=IEA]
            [GO:0017134 "fibroblast growth factor binding" evidence=ISO;IDA]
            [GO:0018108 "peptidyl-tyrosine phosphorylation" evidence=ISO]
            [GO:0021769 "orbitofrontal cortex development" evidence=IMP]
            [GO:0021847 "ventricular zone neuroblast division" evidence=IMP]
            [GO:0021860 "pyramidal neuron development" evidence=IMP]
            [GO:0022612 "gland morphogenesis" evidence=IMP] [GO:0030177
            "positive regulation of Wnt receptor signaling pathway"
            evidence=IMP] [GO:0030282 "bone mineralization" evidence=IMP]
            [GO:0030324 "lung development" evidence=IGI;IMP] [GO:0030855
            "epithelial cell differentiation" evidence=IMP] [GO:0030901
            "midbrain development" evidence=IGI] [GO:0030916 "otic vesicle
            formation" evidence=IMP] [GO:0031069 "hair follicle morphogenesis"
            evidence=IMP] [GO:0031410 "cytoplasmic vesicle" evidence=IEA]
            [GO:0032808 "lacrimal gland development" evidence=IMP] [GO:0035264
            "multicellular organism growth" evidence=IMP] [GO:0035265 "organ
            growth" evidence=IMP] [GO:0035602 "fibroblast growth factor
            receptor signaling pathway involved in negative regulation of
            apoptotic process in bone marrow" evidence=IMP] [GO:0035603
            "fibroblast growth factor receptor signaling pathway involved in
            hemopoiesis" evidence=IMP] [GO:0035604 "fibroblast growth factor
            receptor signaling pathway involved in positive regulation of cell
            proliferation in bone marrow" evidence=IMP] [GO:0035607 "fibroblast
            growth factor receptor signaling pathway involved in orbitofrontal
            cortex development" evidence=IMP] [GO:0040014 "regulation of
            multicellular organism growth" evidence=IMP] [GO:0040036
            "regulation of fibroblast growth factor receptor signaling pathway"
            evidence=IMP] [GO:0042127 "regulation of cell proliferation"
            evidence=IMP] [GO:0042472 "inner ear morphogenesis" evidence=IMP]
            [GO:0042476 "odontogenesis" evidence=IMP] [GO:0042802 "identical
            protein binding" evidence=ISO] [GO:0042803 "protein
            homodimerization activity" evidence=ISO] [GO:0043410 "positive
            regulation of MAPK cascade" evidence=ISO] [GO:0045165 "cell fate
            commitment" evidence=IDA] [GO:0045787 "positive regulation of cell
            cycle" evidence=IMP] [GO:0045839 "negative regulation of mitosis"
            evidence=IGI] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IMP] [GO:0046777 "protein
            autophosphorylation" evidence=ISO] [GO:0048286 "lung alveolus
            development" evidence=IGI;IMP] [GO:0048489 "synaptic vesicle
            transport" evidence=IMP] [GO:0048557 "embryonic digestive tract
            morphogenesis" evidence=IMP] [GO:0048562 "embryonic organ
            morphogenesis" evidence=IMP] [GO:0048565 "digestive tract
            development" evidence=IMP] [GO:0048568 "embryonic organ
            development" evidence=IMP] [GO:0048608 "reproductive structure
            development" evidence=IMP] [GO:0048661 "positive regulation of
            smooth muscle cell proliferation" evidence=ISO] [GO:0048701
            "embryonic cranial skeleton morphogenesis" evidence=ISO]
            [GO:0048730 "epidermis morphogenesis" evidence=IMP] [GO:0048755
            "branching morphogenesis of a nerve" evidence=IMP] [GO:0048762
            "mesenchymal cell differentiation" evidence=IGI] [GO:0050673
            "epithelial cell proliferation" evidence=IMP] [GO:0050678
            "regulation of epithelial cell proliferation" evidence=IMP]
            [GO:0050679 "positive regulation of epithelial cell proliferation"
            evidence=IGI] [GO:0050680 "negative regulation of epithelial cell
            proliferation" evidence=ISO] [GO:0051150 "regulation of smooth
            muscle cell differentiation" evidence=IMP] [GO:0051781 "positive
            regulation of cell division" evidence=IMP] [GO:0055010 "ventricular
            cardiac muscle tissue morphogenesis" evidence=IMP] [GO:0060045
            "positive regulation of cardiac muscle cell proliferation"
            evidence=IGI] [GO:0060076 "excitatory synapse" evidence=IMP]
            [GO:0060174 "limb bud formation" evidence=IMP] [GO:0060348 "bone
            development" evidence=IMP] [GO:0060349 "bone morphogenesis"
            evidence=IMP] [GO:0060365 "coronal suture morphogenesis"
            evidence=IMP] [GO:0060442 "branching involved in prostate gland
            morphogenesis" evidence=IMP] [GO:0060445 "branching involved in
            salivary gland morphogenesis" evidence=IMP] [GO:0060449 "bud
            elongation involved in lung branching" evidence=IMP] [GO:0060463
            "lung lobe morphogenesis" evidence=IMP] [GO:0060484
            "lung-associated mesenchyme development" evidence=IGI;IMP]
            [GO:0060501 "positive regulation of epithelial cell proliferation
            involved in lung morphogenesis" evidence=IMP] [GO:0060512 "prostate
            gland morphogenesis" evidence=IMP] [GO:0060523 "prostate epithelial
            cord elongation" evidence=IMP] [GO:0060527 "prostate epithelial
            cord arborization involved in prostate glandular acinus
            morphogenesis" evidence=IMP] [GO:0060529 "squamous basal epithelial
            stem cell differentiation involved in prostate gland acinus
            development" evidence=IMP] [GO:0060595 "fibroblast growth factor
            receptor signaling pathway involved in mammary gland specification"
            evidence=IMP] [GO:0060601 "lateral sprouting from an epithelium"
            evidence=IMP] [GO:0060615 "mammary gland bud formation"
            evidence=IMP] [GO:0060664 "epithelial cell proliferation involved
            in salivary gland morphogenesis" evidence=IGI;IMP] [GO:0060667
            "branch elongation involved in salivary gland morphogenesis"
            evidence=IGI;IMP] [GO:0060670 "branching involved in labyrinthine
            layer morphogenesis" evidence=IMP] [GO:0060687 "regulation of
            branching involved in prostate gland morphogenesis" evidence=IMP]
            [GO:0060688 "regulation of morphogenesis of a branching structure"
            evidence=IMP] [GO:0060915 "mesenchymal cell differentiation
            involved in lung development" evidence=IGI] [GO:0060916
            "mesenchymal cell proliferation involved in lung development"
            evidence=IMP] [GO:0060979 "vasculogenesis involved in coronary
            vascular morphogenesis" evidence=TAS] [GO:0061031 "endodermal
            digestive tract morphogenesis" evidence=IMP] [GO:0070307 "lens
            fiber cell development" evidence=IGI] [GO:0070372 "regulation of
            ERK1 and ERK2 cascade" evidence=IMP] [GO:0070374 "positive
            regulation of ERK1 and ERK2 cascade" evidence=IGI] [GO:0090263
            "positive regulation of canonical Wnt receptor signaling pathway"
            evidence=IGI;IMP] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            MGI:MGI:95523 GO:GO:0016021 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005794 GO:GO:0006915 GO:GO:0005576
            GO:GO:0008285 Gene3D:2.60.40.10 InterPro:IPR013783 eggNOG:COG0515
            GO:GO:0051781 GO:GO:0007528 BRENDA:2.7.10.1 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 GO:GO:0070374 GO:GO:0045944
            GO:GO:0040014 GO:GO:0008201 GO:GO:0001525 GO:GO:0016023
            GO:GO:0000122 GO:GO:0009791 GO:GO:0048286 GO:GO:0007409
            GO:GO:0030901 GO:GO:0035265 GO:GO:0035264 GO:GO:0060670
            GO:GO:0048489 GO:GO:0045839 InterPro:IPR013098 Pfam:PF07679
            GO:GO:0030282 GO:GO:0042476 GO:GO:0090263 GO:GO:0009880
            GO:GO:0060979 GO:GO:0017134 GO:GO:0045165 GO:GO:0001657
            GO:GO:0060076 GO:GO:0045787 GO:GO:0021860 GO:GO:0031069
            GO:GO:0002053 GO:GO:0070307 GO:GO:0060045 GO:GO:0055010
            GO:GO:0060449 GO:GO:0060687 GO:GO:0051150 GO:GO:0008589
            GO:GO:0030916 GO:GO:0060174 GO:GO:0060365 GO:GO:0060484
            GO:GO:0060916 GO:GO:0048755 GO:GO:0040036 GO:GO:0003148
            GO:GO:0060527 GO:GO:0060523 GO:GO:0060667 GO:GO:0048557
            GO:GO:0060664 GO:GO:0060595 GO:GO:0032808 GO:GO:0060615
            GO:GO:0060915 GO:GO:0060501 HOVERGEN:HBG000345 GO:GO:0005007
            HOGENOM:HOG000263410 GO:GO:0035607 GO:GO:0021847 CTD:2263 KO:K05093
            GO:GO:0061031 GO:GO:0035603 GO:GO:0035602 GO:GO:0035604
            GO:GO:0060601 GO:GO:0060463 GO:GO:0003149 GO:GO:0010453
            GO:GO:0060529 EMBL:X55441 EMBL:M63503 EMBL:M86441 EMBL:Y16152
            EMBL:Y16167 EMBL:M23362 IPI:IPI00128462 IPI:IPI00989007 PIR:A38429
            PIR:A44142 PIR:S17295 RefSeq:NP_034337.2 RefSeq:NP_963895.2
            UniGene:Mm.16340 PDB:4HWU PDBsum:4HWU ProteinModelPortal:P21803
            SMR:P21803 DIP:DIP-6038N IntAct:P21803 STRING:P21803
            PhosphoSite:P21803 PaxDb:P21803 PRIDE:P21803 GeneID:14183
            KEGG:mmu:14183 InParanoid:P21803 ChEMBL:CHEMBL3648 ChiTaRS:FGFR2
            NextBio:285386 CleanEx:MM_FGFR2 Genevestigator:P21803
            GermOnline:ENSMUSG00000030849 Uniprot:P21803
        Length = 821

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   471 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 504


>UNIPROTKB|F1PPD8 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9615 "Canis lupus familiaris" [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 EMBL:AAEX03015597
            EMBL:AAEX03015596 Ensembl:ENSCAFT00000019669 Uniprot:F1PPD8
        Length = 822

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   472 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 505


>UNIPROTKB|F1LSD0 [details] [associations]
            symbol:Fgfr2 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:2611 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007
            IPI:IPI00947656 Ensembl:ENSRNOT00000065207 ArrayExpress:F1LSD0
            Uniprot:F1LSD0
        Length = 822

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   472 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 505


>UNIPROTKB|P18461 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor 2"
            species:9031 "Gallus gallus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0006915 "apoptotic
            process" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA]
            [GO:0005886 "plasma membrane" evidence=IEA] [GO:0016023
            "cytoplasmic membrane-bounded vesicle" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0016021
            GO:GO:0005886 GO:GO:0005524 GO:GO:0005794 GO:GO:0006915
            Gene3D:2.60.40.10 InterPro:IPR013783 eggNOG:COG0515 GO:GO:0008284
            BRENDA:2.7.10.1 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            GO:GO:0016023 InterPro:IPR013098 Pfam:PF07679 HOVERGEN:HBG000345
            GO:GO:0005007 HOGENOM:HOG000263410 EMBL:M35196 IPI:IPI00823302
            PIR:B35963 RefSeq:NP_990650.1 UniGene:Gga.1680
            ProteinModelPortal:P18461 SMR:P18461 STRING:P18461 GeneID:396259
            KEGG:gga:396259 CTD:2263 KO:K05093 NextBio:20816311 Uniprot:P18461
        Length = 823

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   473 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 506


>UNIPROTKB|F1NV76 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9031 "Gallus gallus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GeneTree:ENSGT00670000097694
            GO:GO:0005007 EMBL:AADN02030993 IPI:IPI00597294
            Ensembl:ENSGALT00000015458 Uniprot:F1NV76
        Length = 824

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   474 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 507


>UNIPROTKB|Q91286 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor 2"
            species:8319 "Pleurodeles waltl" [GO:0000122 "negative regulation
            of transcription from RNA polymerase II promoter" evidence=ISS]
            [GO:0001525 "angiogenesis" evidence=ISS] [GO:0001657 "ureteric bud
            development" evidence=ISS] [GO:0002053 "positive regulation of
            mesenchymal cell proliferation" evidence=ISS] [GO:0003148 "outflow
            tract septum morphogenesis" evidence=ISS] [GO:0003149 "membranous
            septum morphogenesis" evidence=ISS] [GO:0005634 "nucleus"
            evidence=ISS] [GO:0007267 "cell-cell signaling" evidence=ISS]
            [GO:0007409 "axonogenesis" evidence=ISS] [GO:0008589 "regulation of
            smoothened signaling pathway" evidence=ISS] [GO:0009791
            "post-embryonic development" evidence=ISS] [GO:0009880 "embryonic
            pattern specification" evidence=ISS] [GO:0009887 "organ
            morphogenesis" evidence=ISS] [GO:0010453 "regulation of cell fate
            commitment" evidence=ISS] [GO:0016331 "morphogenesis of embryonic
            epithelium" evidence=ISS] [GO:0017134 "fibroblast growth factor
            binding" evidence=ISS] [GO:0022612 "gland morphogenesis"
            evidence=ISS] [GO:0030177 "positive regulation of Wnt receptor
            signaling pathway" evidence=ISS] [GO:0030282 "bone mineralization"
            evidence=ISS] [GO:0030324 "lung development" evidence=ISS]
            [GO:0030855 "epithelial cell differentiation" evidence=ISS]
            [GO:0030901 "midbrain development" evidence=ISS] [GO:0030916 "otic
            vesicle formation" evidence=ISS] [GO:0032808 "lacrimal gland
            development" evidence=ISS] [GO:0035264 "multicellular organism
            growth" evidence=ISS] [GO:0035265 "organ growth" evidence=ISS]
            [GO:0040014 "regulation of multicellular organism growth"
            evidence=ISS] [GO:0040036 "regulation of fibroblast growth factor
            receptor signaling pathway" evidence=ISS] [GO:0042472 "inner ear
            morphogenesis" evidence=ISS] [GO:0042476 "odontogenesis"
            evidence=ISS] [GO:0045165 "cell fate commitment" evidence=ISS]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=ISS] [GO:0048286 "lung alveolus
            development" evidence=ISS] [GO:0048557 "embryonic digestive tract
            morphogenesis" evidence=ISS] [GO:0048562 "embryonic organ
            morphogenesis" evidence=ISS] [GO:0048565 "digestive tract
            development" evidence=ISS] [GO:0048568 "embryonic organ
            development" evidence=ISS] [GO:0048608 "reproductive structure
            development" evidence=ISS] [GO:0048730 "epidermis morphogenesis"
            evidence=ISS] [GO:0048755 "branching morphogenesis of a nerve"
            evidence=ISS] [GO:0048762 "mesenchymal cell differentiation"
            evidence=ISS] [GO:0050679 "positive regulation of epithelial cell
            proliferation" evidence=ISS] [GO:0051150 "regulation of smooth
            muscle cell differentiation" evidence=ISS] [GO:0051781 "positive
            regulation of cell division" evidence=ISS] [GO:0055010 "ventricular
            cardiac muscle tissue morphogenesis" evidence=ISS] [GO:0060045
            "positive regulation of cardiac muscle cell proliferation"
            evidence=ISS] [GO:0060174 "limb bud formation" evidence=ISS]
            [GO:0060348 "bone development" evidence=ISS] [GO:0060349 "bone
            morphogenesis" evidence=ISS] [GO:0060442 "branching involved in
            prostate gland morphogenesis" evidence=ISS] [GO:0060445 "branching
            involved in salivary gland morphogenesis" evidence=ISS] [GO:0060449
            "bud elongation involved in lung branching" evidence=ISS]
            [GO:0060463 "lung lobe morphogenesis" evidence=ISS] [GO:0060484
            "lung-associated mesenchyme development" evidence=ISS] [GO:0060501
            "positive regulation of epithelial cell proliferation involved in
            lung morphogenesis" evidence=ISS] [GO:0060512 "prostate gland
            morphogenesis" evidence=ISS] [GO:0060523 "prostate epithelial cord
            elongation" evidence=ISS] [GO:0060527 "prostate epithelial cord
            arborization involved in prostate glandular acinus morphogenesis"
            evidence=ISS] [GO:0060529 "squamous basal epithelial stem cell
            differentiation involved in prostate gland acinus development"
            evidence=ISS] [GO:0060601 "lateral sprouting from an epithelium"
            evidence=ISS] [GO:0060664 "epithelial cell proliferation involved
            in salivary gland morphogenesis" evidence=ISS] [GO:0060667 "branch
            elongation involved in salivary gland morphogenesis" evidence=ISS]
            [GO:0060687 "regulation of branching involved in prostate gland
            morphogenesis" evidence=ISS] [GO:0060688 "regulation of
            morphogenesis of a branching structure" evidence=ISS] [GO:0060915
            "mesenchymal cell differentiation involved in lung development"
            evidence=ISS] [GO:0060916 "mesenchymal cell proliferation involved
            in lung development" evidence=ISS] [GO:0070372 "regulation of ERK1
            and ERK2 cascade" evidence=ISS] [GO:0070374 "positive regulation of
            ERK1 and ERK2 cascade" evidence=ISS] [GO:0090263 "positive
            regulation of canonical Wnt receptor signaling pathway"
            evidence=ISS] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005886 GO:GO:0005524 GO:GO:0005634
            GO:GO:0005794 GO:GO:0006915 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0051781 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            GO:GO:0070374 GO:GO:0045944 GO:GO:0040014 GO:GO:0007267
            GO:GO:0001525 GO:GO:0016023 GO:GO:0000122 GO:GO:0009791
            GO:GO:0048286 GO:GO:0007409 GO:GO:0030901 GO:GO:0035265
            GO:GO:0035264 GO:GO:0016331 InterPro:IPR013098 Pfam:PF07679
            GO:GO:0030282 GO:GO:0042476 GO:GO:0090263 GO:GO:0009880
            GO:GO:0060349 GO:GO:0048730 GO:GO:0017134 GO:GO:0045165
            GO:GO:0001657 GO:GO:0002053 GO:GO:0060045 GO:GO:0055010
            GO:GO:0060449 GO:GO:0060687 GO:GO:0051150 GO:GO:0008589
            GO:GO:0030916 GO:GO:0060174 GO:GO:0060484 GO:GO:0060916
            GO:GO:0048755 GO:GO:0040036 GO:GO:0003148 GO:GO:0060527
            GO:GO:0060523 GO:GO:0060667 GO:GO:0048557 GO:GO:0060664
            GO:GO:0032808 GO:GO:0060915 GO:GO:0060501 HOVERGEN:HBG000345
            GO:GO:0005007 HSSP:P11362 GO:GO:0060601 GO:GO:0060463 GO:GO:0003149
            GO:GO:0010453 GO:GO:0060529 EMBL:X74332 PIR:I51127
            ProteinModelPortal:Q91286 SMR:Q91286 Uniprot:Q91286
        Length = 824

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   468 DPKWEYPRDKLTLGKPLGEGCFGQVVMAEAVGID 501


>UNIPROTKB|F1NV77 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9031 "Gallus gallus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GeneTree:ENSGT00670000097694
            GO:GO:0005007 EMBL:AADN02030993 IPI:IPI00601186
            Ensembl:ENSGALT00000015457 Uniprot:F1NV77
        Length = 825

 Score = 104 (41.7 bits), Expect = 0.00014, P = 0.00014
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   475 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 508


>UNIPROTKB|F1NEE9 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9031 "Gallus gallus" [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0000122 "negative regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0001525
            "angiogenesis" evidence=IEA] [GO:0001657 "ureteric bud development"
            evidence=IEA] [GO:0002053 "positive regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0003148 "outflow tract septum
            morphogenesis" evidence=IEA] [GO:0003149 "membranous septum
            morphogenesis" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005634
            "nucleus" evidence=IEA] [GO:0005887 "integral to plasma membrane"
            evidence=IEA] [GO:0005938 "cell cortex" evidence=IEA] [GO:0007409
            "axonogenesis" evidence=IEA] [GO:0007528 "neuromuscular junction
            development" evidence=IEA] [GO:0008285 "negative regulation of cell
            proliferation" evidence=IEA] [GO:0008589 "regulation of smoothened
            signaling pathway" evidence=IEA] [GO:0009791 "post-embryonic
            development" evidence=IEA] [GO:0009880 "embryonic pattern
            specification" evidence=IEA] [GO:0009986 "cell surface"
            evidence=IEA] [GO:0010453 "regulation of cell fate commitment"
            evidence=IEA] [GO:0010518 "positive regulation of phospholipase
            activity" evidence=IEA] [GO:0017134 "fibroblast growth factor
            binding" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0030282 "bone mineralization"
            evidence=IEA] [GO:0030901 "midbrain development" evidence=IEA]
            [GO:0030916 "otic vesicle formation" evidence=IEA] [GO:0031012
            "extracellular matrix" evidence=IEA] [GO:0031069 "hair follicle
            morphogenesis" evidence=IEA] [GO:0032808 "lacrimal gland
            development" evidence=IEA] [GO:0035264 "multicellular organism
            growth" evidence=IEA] [GO:0035265 "organ growth" evidence=IEA]
            [GO:0040014 "regulation of multicellular organism growth"
            evidence=IEA] [GO:0040036 "regulation of fibroblast growth factor
            receptor signaling pathway" evidence=IEA] [GO:0042476
            "odontogenesis" evidence=IEA] [GO:0042803 "protein homodimerization
            activity" evidence=IEA] [GO:0045165 "cell fate commitment"
            evidence=IEA] [GO:0045839 "negative regulation of mitosis"
            evidence=IEA] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0046777 "protein
            autophosphorylation" evidence=IEA] [GO:0048286 "lung alveolus
            development" evidence=IEA] [GO:0048489 "synaptic vesicle transport"
            evidence=IEA] [GO:0048557 "embryonic digestive tract morphogenesis"
            evidence=IEA] [GO:0048755 "branching morphogenesis of a nerve"
            evidence=IEA] [GO:0051150 "regulation of smooth muscle cell
            differentiation" evidence=IEA] [GO:0051781 "positive regulation of
            cell division" evidence=IEA] [GO:0055010 "ventricular cardiac
            muscle tissue morphogenesis" evidence=IEA] [GO:0060045 "positive
            regulation of cardiac muscle cell proliferation" evidence=IEA]
            [GO:0060174 "limb bud formation" evidence=IEA] [GO:0060365 "coronal
            suture morphogenesis" evidence=IEA] [GO:0060449 "bud elongation
            involved in lung branching" evidence=IEA] [GO:0060463 "lung lobe
            morphogenesis" evidence=IEA] [GO:0060484 "lung-associated
            mesenchyme development" evidence=IEA] [GO:0060501 "positive
            regulation of epithelial cell proliferation involved in lung
            morphogenesis" evidence=IEA] [GO:0060523 "prostate epithelial cord
            elongation" evidence=IEA] [GO:0060527 "prostate epithelial cord
            arborization involved in prostate glandular acinus morphogenesis"
            evidence=IEA] [GO:0060529 "squamous basal epithelial stem cell
            differentiation involved in prostate gland acinus development"
            evidence=IEA] [GO:0060595 "fibroblast growth factor receptor
            signaling pathway involved in mammary gland specification"
            evidence=IEA] [GO:0060601 "lateral sprouting from an epithelium"
            evidence=IEA] [GO:0060615 "mammary gland bud formation"
            evidence=IEA] [GO:0060664 "epithelial cell proliferation involved
            in salivary gland morphogenesis" evidence=IEA] [GO:0060667 "branch
            elongation involved in salivary gland morphogenesis" evidence=IEA]
            [GO:0060670 "branching involved in labyrinthine layer
            morphogenesis" evidence=IEA] [GO:0060687 "regulation of branching
            involved in prostate gland morphogenesis" evidence=IEA] [GO:0060915
            "mesenchymal cell differentiation involved in lung development"
            evidence=IEA] [GO:0060916 "mesenchymal cell proliferation involved
            in lung development" evidence=IEA] [GO:0061031 "endodermal
            digestive tract morphogenesis" evidence=IEA] [GO:0070307 "lens
            fiber cell development" evidence=IEA] [GO:0070374 "positive
            regulation of ERK1 and ERK2 cascade" evidence=IEA] [GO:0090263
            "positive regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0005524 GO:GO:0005938 GO:GO:0005634 GO:GO:0008285
            GO:GO:0009986 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0051781 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0045944 GO:GO:0040014
            GO:GO:0007267 GO:GO:0046777 GO:GO:0000122 GO:GO:0035265
            GO:GO:0031012 GO:GO:0045839 GO:GO:0050673 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0090263 GO:GO:0010518 GO:GO:0045165
            GO:GO:0002053 GO:GO:0060045 GO:GO:0060687 GO:GO:0051150
            GO:GO:0008589 GeneTree:ENSGT00670000097694 GO:GO:0040036
            GO:GO:0060501 GO:GO:0005007 IPI:IPI00823302 OMA:YEPCLPK
            GO:GO:0010453 EMBL:AADN02030993 ProteinModelPortal:F1NEE9
            Ensembl:ENSGALT00000038732 Uniprot:F1NEE9
        Length = 830

 Score = 104 (41.7 bits), Expect = 0.00015, P = 0.00015
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   478 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 511


>UNIPROTKB|F1MNW2 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9913 "Bos taurus" [GO:0090263 "positive regulation of
            canonical Wnt receptor signaling pathway" evidence=IEA] [GO:0070374
            "positive regulation of ERK1 and ERK2 cascade" evidence=IEA]
            [GO:0070307 "lens fiber cell development" evidence=IEA] [GO:0061031
            "endodermal digestive tract morphogenesis" evidence=IEA]
            [GO:0060916 "mesenchymal cell proliferation involved in lung
            development" evidence=IEA] [GO:0060915 "mesenchymal cell
            differentiation involved in lung development" evidence=IEA]
            [GO:0060687 "regulation of branching involved in prostate gland
            morphogenesis" evidence=IEA] [GO:0060670 "branching involved in
            labyrinthine layer morphogenesis" evidence=IEA] [GO:0060667 "branch
            elongation involved in salivary gland morphogenesis" evidence=IEA]
            [GO:0060664 "epithelial cell proliferation involved in salivary
            gland morphogenesis" evidence=IEA] [GO:0060615 "mammary gland bud
            formation" evidence=IEA] [GO:0060601 "lateral sprouting from an
            epithelium" evidence=IEA] [GO:0060595 "fibroblast growth factor
            receptor signaling pathway involved in mammary gland specification"
            evidence=IEA] [GO:0060529 "squamous basal epithelial stem cell
            differentiation involved in prostate gland acinus development"
            evidence=IEA] [GO:0060527 "prostate epithelial cord arborization
            involved in prostate glandular acinus morphogenesis" evidence=IEA]
            [GO:0060523 "prostate epithelial cord elongation" evidence=IEA]
            [GO:0060501 "positive regulation of epithelial cell proliferation
            involved in lung morphogenesis" evidence=IEA] [GO:0060484
            "lung-associated mesenchyme development" evidence=IEA] [GO:0060463
            "lung lobe morphogenesis" evidence=IEA] [GO:0060449 "bud elongation
            involved in lung branching" evidence=IEA] [GO:0060365 "coronal
            suture morphogenesis" evidence=IEA] [GO:0060174 "limb bud
            formation" evidence=IEA] [GO:0060045 "positive regulation of
            cardiac muscle cell proliferation" evidence=IEA] [GO:0055010
            "ventricular cardiac muscle tissue morphogenesis" evidence=IEA]
            [GO:0051781 "positive regulation of cell division" evidence=IEA]
            [GO:0051150 "regulation of smooth muscle cell differentiation"
            evidence=IEA] [GO:0048755 "branching morphogenesis of a nerve"
            evidence=IEA] [GO:0048557 "embryonic digestive tract morphogenesis"
            evidence=IEA] [GO:0048489 "synaptic vesicle transport"
            evidence=IEA] [GO:0048286 "lung alveolus development" evidence=IEA]
            [GO:0046777 "protein autophosphorylation" evidence=IEA] [GO:0045944
            "positive regulation of transcription from RNA polymerase II
            promoter" evidence=IEA] [GO:0045839 "negative regulation of
            mitosis" evidence=IEA] [GO:0045165 "cell fate commitment"
            evidence=IEA] [GO:0042803 "protein homodimerization activity"
            evidence=IEA] [GO:0042476 "odontogenesis" evidence=IEA] [GO:0040036
            "regulation of fibroblast growth factor receptor signaling pathway"
            evidence=IEA] [GO:0040014 "regulation of multicellular organism
            growth" evidence=IEA] [GO:0035265 "organ growth" evidence=IEA]
            [GO:0035264 "multicellular organism growth" evidence=IEA]
            [GO:0032808 "lacrimal gland development" evidence=IEA] [GO:0031069
            "hair follicle morphogenesis" evidence=IEA] [GO:0031012
            "extracellular matrix" evidence=IEA] [GO:0030916 "otic vesicle
            formation" evidence=IEA] [GO:0030901 "midbrain development"
            evidence=IEA] [GO:0030282 "bone mineralization" evidence=IEA]
            [GO:0018108 "peptidyl-tyrosine phosphorylation" evidence=IEA]
            [GO:0017134 "fibroblast growth factor binding" evidence=IEA]
            [GO:0010518 "positive regulation of phospholipase activity"
            evidence=IEA] [GO:0010453 "regulation of cell fate commitment"
            evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0009880
            "embryonic pattern specification" evidence=IEA] [GO:0009791
            "post-embryonic development" evidence=IEA] [GO:0008589 "regulation
            of smoothened signaling pathway" evidence=IEA] [GO:0008285
            "negative regulation of cell proliferation" evidence=IEA]
            [GO:0007528 "neuromuscular junction development" evidence=IEA]
            [GO:0007409 "axonogenesis" evidence=IEA] [GO:0005938 "cell cortex"
            evidence=IEA] [GO:0005887 "integral to plasma membrane"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005007
            "fibroblast growth factor-activated receptor activity"
            evidence=IEA] [GO:0003149 "membranous septum morphogenesis"
            evidence=IEA] [GO:0003148 "outflow tract septum morphogenesis"
            evidence=IEA] [GO:0002053 "positive regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0001657 "ureteric bud development"
            evidence=IEA] [GO:0001525 "angiogenesis" evidence=IEA] [GO:0000122
            "negative regulation of transcription from RNA polymerase II
            promoter" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0005524
            GO:GO:0005938 GO:GO:0005634 GO:GO:0008285 GO:GO:0009986
            GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0051781
            GO:GO:0007528 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0045944 GO:GO:0040014
            GO:GO:0046777 GO:GO:0001525 GO:GO:0000122 GO:GO:0009791
            GO:GO:0048286 GO:GO:0007409 GO:GO:0030901 GO:GO:0035265
            GO:GO:0035264 GO:GO:0060670 GO:GO:0048489 GO:GO:0031012
            GO:GO:0045839 InterPro:IPR013098 Pfam:PF07679 GO:GO:0030282
            GO:GO:0042476 GO:GO:0090263 GO:GO:0009880 GO:GO:0060349
            GO:GO:0010518 GO:GO:0045165 GO:GO:0001657 GO:GO:0031069
            GO:GO:0002053 GO:GO:0070307 GO:GO:0060045 GO:GO:0055010
            GO:GO:0060449 GO:GO:0060687 GO:GO:0051150 GO:GO:0008589
            GeneTree:ENSGT00670000097694 GO:GO:0030916 GO:GO:0060174
            GO:GO:0060484 GO:GO:0060916 GO:GO:0048755 GO:GO:0040036
            GO:GO:0003148 GO:GO:0060527 GO:GO:0060523 GO:GO:0060667
            GO:GO:0048557 GO:GO:0060664 GO:GO:0060595 GO:GO:0032808
            GO:GO:0060615 GO:GO:0060915 GO:GO:0060501 GO:GO:0005007 OMA:YEPCLPK
            GO:GO:0061031 GO:GO:0060601 GO:GO:0060463 GO:GO:0003149
            GO:GO:0010453 GO:GO:0060529 EMBL:DAAA02059441 IPI:IPI00690469
            Ensembl:ENSBTAT00000018708 ArrayExpress:F1MNW2 Uniprot:F1MNW2
        Length = 840

 Score = 104 (41.7 bits), Expect = 0.00015, P = 0.00015
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   488 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 521


>UNIPROTKB|F1LNW0 [details] [associations]
            symbol:Fgfr2 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:2611 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 CTD:2263 KO:K05093
            UniGene:Rn.12732 GeneID:25022 KEGG:rno:25022 NextBio:605119
            IPI:IPI00876631 RefSeq:NP_001103362.1 Ensembl:ENSRNOT00000022253
            ArrayExpress:F1LNW0 Uniprot:F1LNW0
        Length = 840

 Score = 104 (41.7 bits), Expect = 0.00015, P = 0.00015
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   490 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 523


>UNIPROTKB|F1Q2E3 [details] [associations]
            symbol:FGFR2 "Fibroblast growth factor receptor"
            species:9615 "Canis lupus familiaris" [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 OMA:YEPCLPK
            EMBL:AAEX03015597 EMBL:AAEX03015596 Ensembl:ENSCAFT00000009748
            Uniprot:F1Q2E3
        Length = 841

 Score = 104 (41.7 bits), Expect = 0.00015, P = 0.00015
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   491 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 524


>UNIPROTKB|F1LSG7 [details] [associations]
            symbol:Fgfr2 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation
            of transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0001525 "angiogenesis" evidence=IEA] [GO:0001657 "ureteric bud
            development" evidence=IEA] [GO:0002053 "positive regulation of
            mesenchymal cell proliferation" evidence=IEA] [GO:0003148 "outflow
            tract septum morphogenesis" evidence=IEA] [GO:0003149 "membranous
            septum morphogenesis" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA]
            [GO:0005887 "integral to plasma membrane" evidence=IEA] [GO:0005938
            "cell cortex" evidence=IEA] [GO:0007409 "axonogenesis"
            evidence=IEA] [GO:0007528 "neuromuscular junction development"
            evidence=IEA] [GO:0008285 "negative regulation of cell
            proliferation" evidence=IEA] [GO:0008589 "regulation of smoothened
            signaling pathway" evidence=IEA] [GO:0009791 "post-embryonic
            development" evidence=IEA] [GO:0009880 "embryonic pattern
            specification" evidence=IEA] [GO:0009986 "cell surface"
            evidence=IEA] [GO:0010453 "regulation of cell fate commitment"
            evidence=IEA] [GO:0010518 "positive regulation of phospholipase
            activity" evidence=IEA] [GO:0017134 "fibroblast growth factor
            binding" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0030282 "bone mineralization"
            evidence=IEA] [GO:0030901 "midbrain development" evidence=IEA]
            [GO:0030916 "otic vesicle formation" evidence=IEA] [GO:0031012
            "extracellular matrix" evidence=IEA] [GO:0031069 "hair follicle
            morphogenesis" evidence=IEA] [GO:0032808 "lacrimal gland
            development" evidence=IEA] [GO:0035264 "multicellular organism
            growth" evidence=IEA] [GO:0035265 "organ growth" evidence=IEA]
            [GO:0040014 "regulation of multicellular organism growth"
            evidence=IEA] [GO:0040036 "regulation of fibroblast growth factor
            receptor signaling pathway" evidence=IEA] [GO:0042476
            "odontogenesis" evidence=IEA] [GO:0042803 "protein homodimerization
            activity" evidence=IEA] [GO:0045165 "cell fate commitment"
            evidence=IEA] [GO:0045839 "negative regulation of mitosis"
            evidence=IEA] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0046777 "protein
            autophosphorylation" evidence=IEA] [GO:0048286 "lung alveolus
            development" evidence=IEA] [GO:0048489 "synaptic vesicle transport"
            evidence=IEA] [GO:0048557 "embryonic digestive tract morphogenesis"
            evidence=IEA] [GO:0048755 "branching morphogenesis of a nerve"
            evidence=IEA] [GO:0051150 "regulation of smooth muscle cell
            differentiation" evidence=IEA] [GO:0051781 "positive regulation of
            cell division" evidence=IEA] [GO:0055010 "ventricular cardiac
            muscle tissue morphogenesis" evidence=IEA] [GO:0060045 "positive
            regulation of cardiac muscle cell proliferation" evidence=IEA]
            [GO:0060174 "limb bud formation" evidence=IEA] [GO:0060365 "coronal
            suture morphogenesis" evidence=IEA] [GO:0060449 "bud elongation
            involved in lung branching" evidence=IEA] [GO:0060463 "lung lobe
            morphogenesis" evidence=IEA] [GO:0060484 "lung-associated
            mesenchyme development" evidence=IEA] [GO:0060501 "positive
            regulation of epithelial cell proliferation involved in lung
            morphogenesis" evidence=IEA] [GO:0060523 "prostate epithelial cord
            elongation" evidence=IEA] [GO:0060527 "prostate epithelial cord
            arborization involved in prostate glandular acinus morphogenesis"
            evidence=IEA] [GO:0060529 "squamous basal epithelial stem cell
            differentiation involved in prostate gland acinus development"
            evidence=IEA] [GO:0060595 "fibroblast growth factor receptor
            signaling pathway involved in mammary gland specification"
            evidence=IEA] [GO:0060601 "lateral sprouting from an epithelium"
            evidence=IEA] [GO:0060615 "mammary gland bud formation"
            evidence=IEA] [GO:0060664 "epithelial cell proliferation involved
            in salivary gland morphogenesis" evidence=IEA] [GO:0060667 "branch
            elongation involved in salivary gland morphogenesis" evidence=IEA]
            [GO:0060670 "branching involved in labyrinthine layer
            morphogenesis" evidence=IEA] [GO:0060687 "regulation of branching
            involved in prostate gland morphogenesis" evidence=IEA] [GO:0060915
            "mesenchymal cell differentiation involved in lung development"
            evidence=IEA] [GO:0060916 "mesenchymal cell proliferation involved
            in lung development" evidence=IEA] [GO:0061031 "endodermal
            digestive tract morphogenesis" evidence=IEA] [GO:0070307 "lens
            fiber cell development" evidence=IEA] [GO:0070374 "positive
            regulation of ERK1 and ERK2 cascade" evidence=IEA] [GO:0090263
            "positive regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:2611 GO:GO:0005524 GO:GO:0005938 GO:GO:0005634 GO:GO:0008285
            GO:GO:0009986 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0051781 GO:GO:0007528 GO:GO:0018108 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 GO:GO:0070374 GO:GO:0045944
            GO:GO:0040014 GO:GO:0046777 GO:GO:0001525 GO:GO:0000122
            GO:GO:0009791 GO:GO:0048286 GO:GO:0007409 GO:GO:0030901
            GO:GO:0035265 GO:GO:0035264 GO:GO:0060670 GO:GO:0048489
            GO:GO:0031012 GO:GO:0045839 InterPro:IPR013098 Pfam:PF07679
            GO:GO:0030282 GO:GO:0042476 GO:GO:0090263 GO:GO:0009880
            GO:GO:0060349 GO:GO:0010518 GO:GO:0045165 GO:GO:0001657
            GO:GO:0031069 GO:GO:0002053 GO:GO:0070307 GO:GO:0060045
            GO:GO:0055010 GO:GO:0060449 GO:GO:0060687 GO:GO:0051150
            GO:GO:0008589 GeneTree:ENSGT00670000097694 GO:GO:0030916
            GO:GO:0060174 GO:GO:0060484 GO:GO:0060916 GO:GO:0048755
            GO:GO:0040036 GO:GO:0003148 GO:GO:0060527 GO:GO:0060523
            GO:GO:0060667 GO:GO:0048557 GO:GO:0060664 GO:GO:0060595
            GO:GO:0032808 GO:GO:0060615 GO:GO:0060915 GO:GO:0060501
            GO:GO:0005007 CTD:2263 KO:K05093 GO:GO:0061031 GO:GO:0060601
            GO:GO:0060463 GO:GO:0003149 GO:GO:0010453 GO:GO:0060529
            UniGene:Rn.12732 GeneID:25022 KEGG:rno:25022 NextBio:605119
            IPI:IPI00876616 RefSeq:NP_036844.1 Ensembl:ENSRNOT00000068183
            ArrayExpress:F1LSG7 Uniprot:F1LSG7
        Length = 841

 Score = 104 (41.7 bits), Expect = 0.00015, P = 0.00015
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D KWE PR  + +   LGEGCFGQV   EA+GID
Sbjct:   491 DPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGID 524


>UNIPROTKB|F1NW21 [details] [associations]
            symbol:KDR "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0005524 "ATP binding" evidence=IEA] [GO:0001541
            "ovarian follicle development" evidence=IEA] [GO:0001570
            "vasculogenesis" evidence=IEA] [GO:0001938 "positive regulation of
            endothelial cell proliferation" evidence=IEA] [GO:0001945 "lymph
            vessel development" evidence=IEA] [GO:0002053 "positive regulation
            of mesenchymal cell proliferation" evidence=IEA] [GO:0005021
            "vascular endothelial growth factor-activated receptor activity"
            evidence=IEA] [GO:0005178 "integrin binding" evidence=IEA]
            [GO:0005887 "integral to plasma membrane" evidence=IEA] [GO:0008360
            "regulation of cell shape" evidence=IEA] [GO:0009897 "external side
            of plasma membrane" evidence=IEA] [GO:0010595 "positive regulation
            of endothelial cell migration" evidence=IEA] [GO:0014068 "positive
            regulation of phosphatidylinositol 3-kinase cascade" evidence=IEA]
            [GO:0016477 "cell migration" evidence=IEA] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0030097
            "hemopoiesis" evidence=IEA] [GO:0035584 "calcium-mediated signaling
            using intracellular calcium source" evidence=IEA] [GO:0038085
            "vascular endothelial growth factor binding" evidence=IEA]
            [GO:0043129 "surfactant homeostasis" evidence=IEA] [GO:0045165
            "cell fate commitment" evidence=IEA] [GO:0045446 "endothelial cell
            differentiation" evidence=IEA] [GO:0045766 "positive regulation of
            angiogenesis" evidence=IEA] [GO:0046777 "protein
            autophosphorylation" evidence=IEA] [GO:0048010 "vascular
            endothelial growth factor receptor signaling pathway" evidence=IEA]
            [GO:0048286 "lung alveolus development" evidence=IEA] [GO:0048469
            "cell maturation" evidence=IEA] [GO:0048754 "branching
            morphogenesis of an epithelial tube" evidence=IEA] [GO:0050927
            "positive regulation of positive chemotaxis" evidence=IEA]
            [GO:0051770 "positive regulation of nitric-oxide synthase
            biosynthetic process" evidence=IEA] [GO:0051894 "positive
            regulation of focal adhesion assembly" evidence=IEA] [GO:0055074
            "calcium ion homeostasis" evidence=IEA] [GO:0070374 "positive
            regulation of ERK1 and ERK2 cascade" evidence=IEA] [GO:2000352
            "negative regulation of endothelial cell apoptotic process"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR001824 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR009134 InterPro:IPR009136 InterPro:IPR011009
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714 PRINTS:PR01832
            PRINTS:PR01834 PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS00240
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0005524
            GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0016477
            GO:GO:0008360 GO:GO:0009897 GO:GO:0001938 GO:GO:0018108
            SUPFAM:SSF56112 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0014068 GO:GO:0046777
            GO:GO:0045766 GO:GO:0010595 GO:GO:0050927 InterPro:IPR013098
            Pfam:PF07679 GO:GO:2000352 GO:GO:0055074 GO:GO:0045165
            GO:GO:0035584 GO:GO:0002053 GO:GO:0048010 GO:GO:0051770
            GO:GO:0005021 GO:GO:0051894 GeneTree:ENSGT00660000095441
            OMA:QDYRSPF EMBL:AADN02031311 IPI:IPI00578882
            Ensembl:ENSGALT00000022562 ArrayExpress:F1NW21 Uniprot:F1NW21
        Length = 1348

 Score = 90 (36.7 bits), Expect = 0.00017, Sum P(2) = 0.00017
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query:    70 KWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             KWE PR  +K+   LG G FGQV + +A GID
Sbjct:   817 KWEFPRDRLKLGKPLGRGAFGQVIEADAFGID 848

 Score = 41 (19.5 bits), Expect = 0.00017, Sum P(2) = 0.00017
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query:    43 YYNMVSLSGEKLSNIMNDPV---LNQKSDDKWEVP 74
             +Y +    GEKL  ++N  V   LN   D KW+ P
Sbjct:   226 HYQVELAVGEKL--VLNCTVRTELNVGIDFKWDYP 258


>UNIPROTKB|Q90ZF0 [details] [associations]
            symbol:KDR "Flk-1 receptor" species:9031 "Gallus gallus"
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0001541 "ovarian
            follicle development" evidence=IEA] [GO:0001570 "vasculogenesis"
            evidence=IEA] [GO:0001938 "positive regulation of endothelial cell
            proliferation" evidence=IEA] [GO:0001945 "lymph vessel development"
            evidence=IEA] [GO:0002053 "positive regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0005021 "vascular endothelial
            growth factor-activated receptor activity" evidence=IEA]
            [GO:0005178 "integrin binding" evidence=IEA] [GO:0005887 "integral
            to plasma membrane" evidence=IEA] [GO:0008360 "regulation of cell
            shape" evidence=IEA] [GO:0009897 "external side of plasma membrane"
            evidence=IEA] [GO:0010595 "positive regulation of endothelial cell
            migration" evidence=IEA] [GO:0014068 "positive regulation of
            phosphatidylinositol 3-kinase cascade" evidence=IEA] [GO:0016477
            "cell migration" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0030097 "hemopoiesis"
            evidence=IEA] [GO:0035584 "calcium-mediated signaling using
            intracellular calcium source" evidence=IEA] [GO:0038085 "vascular
            endothelial growth factor binding" evidence=IEA] [GO:0043129
            "surfactant homeostasis" evidence=IEA] [GO:0045165 "cell fate
            commitment" evidence=IEA] [GO:0045446 "endothelial cell
            differentiation" evidence=IEA] [GO:0045766 "positive regulation of
            angiogenesis" evidence=IEA] [GO:0046777 "protein
            autophosphorylation" evidence=IEA] [GO:0048010 "vascular
            endothelial growth factor receptor signaling pathway" evidence=IEA]
            [GO:0048286 "lung alveolus development" evidence=IEA] [GO:0048469
            "cell maturation" evidence=IEA] [GO:0048754 "branching
            morphogenesis of an epithelial tube" evidence=IEA] [GO:0050927
            "positive regulation of positive chemotaxis" evidence=IEA]
            [GO:0051770 "positive regulation of nitric-oxide synthase
            biosynthetic process" evidence=IEA] [GO:0051894 "positive
            regulation of focal adhesion assembly" evidence=IEA] [GO:0055074
            "calcium ion homeostasis" evidence=IEA] [GO:0070374 "positive
            regulation of ERK1 and ERK2 cascade" evidence=IEA] [GO:2000352
            "negative regulation of endothelial cell apoptotic process"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR001824 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF07714 PROSITE:PS00107 PROSITE:PS00240 PROSITE:PS50011
            GO:GO:0005524 GO:GO:0005887 GO:GO:0016477 GO:GO:0008360
            GO:GO:0009897 GO:GO:0001938 GO:GO:0018108 SUPFAM:SSF56112
            GO:GO:0070374 GO:GO:0014068 GO:GO:0046777 GO:GO:0045766
            GO:GO:0010595 GO:GO:0050927 GO:GO:2000352 GO:GO:0055074
            GO:GO:0045165 GO:GO:0035584 GO:GO:0002053 GO:GO:0048010
            GO:GO:0051770 HSSP:P35968 GO:GO:0005021 GO:GO:0051894
            GeneTree:ENSGT00660000095441 EMBL:AADN02031311 UniGene:Gga.807
            EMBL:AB066660 IPI:IPI00818721 STRING:Q90ZF0
            Ensembl:ENSGALT00000037533 InParanoid:Q90ZF0 Uniprot:Q90ZF0
        Length = 94

 Score = 90 (36.7 bits), Expect = 0.00021, P = 0.00021
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query:    70 KWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             KWE PR  +K+   LG G FGQV + +A GID
Sbjct:     3 KWEFPRDRLKLGKPLGRGAFGQVIEADAFGID 34


>UNIPROTKB|H0Y9P2 [details] [associations]
            symbol:FGFR4 "Fibroblast growth factor receptor 4"
            species:9606 "Homo sapiens" [GO:0004713 "protein tyrosine kinase
            activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR017441 Pfam:PF07714 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 GO:GO:0005524
            SUPFAM:SSF56112 GO:GO:0004713 EMBL:AC027314 HGNC:HGNC:3691
            ChiTaRS:FGFR4 Ensembl:ENST00000511076 Uniprot:H0Y9P2
        Length = 280

 Score = 96 (38.9 bits), Expect = 0.00022, P = 0.00022
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D  WE PR  + +   LGEGCFGQV + EA G+D
Sbjct:    89 DPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD 122


>ZFIN|ZDB-GENE-980526-255 [details] [associations]
            symbol:fgfr1a "fibroblast growth factor receptor
            1a" species:7955 "Danio rerio" [GO:0048010 "vascular endothelial
            growth factor receptor signaling pathway" evidence=IEA] [GO:0004713
            "protein tyrosine kinase activity" evidence=IEA] [GO:0005021
            "vascular endothelial growth factor-activated receptor activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0008284 "positive
            regulation of cell proliferation" evidence=IEA] [GO:0004672
            "protein kinase activity" evidence=IEA] [GO:0008543 "fibroblast
            growth factor receptor signaling pathway" evidence=IEA;IDA]
            [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0005007 "fibroblast
            growth factor-activated receptor activity" evidence=IEA;IDA]
            [GO:0005887 "integral to plasma membrane" evidence=IEA;ISS]
            [GO:0016021 "integral to membrane" evidence=IEA] [GO:0043589 "skin
            morphogenesis" evidence=IMP] [GO:0036342 "post-anal tail
            morphogenesis" evidence=IGI] [GO:0001889 "liver development"
            evidence=IMP] [GO:0004714 "transmembrane receptor protein tyrosine
            kinase activity" evidence=IEA] [GO:0042664 "negative regulation of
            endodermal cell fate specification" evidence=IGI] [GO:0048738
            "cardiac muscle tissue development" evidence=IMP] [GO:0009953
            "dorsal/ventral pattern formation" evidence=IMP] [GO:0048916
            "posterior lateral line development" evidence=IMP] [GO:0008201
            "heparin binding" evidence=ISS] [GO:0043406 "positive regulation of
            MAP kinase activity" evidence=ISS] [GO:0005886 "plasma membrane"
            evidence=IEA;ISS] [GO:0010863 "positive regulation of phospholipase
            C activity" evidence=ISS] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=ISS] [GO:0017134 "fibroblast growth
            factor binding" evidence=ISS] [GO:0016740 "transferase activity"
            evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0016301
            "kinase activity" evidence=IEA] [GO:0000166 "nucleotide binding"
            evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA]
            [GO:0031410 "cytoplasmic vesicle" evidence=IEA] [GO:0005634
            "nucleus" evidence=IEA] [GO:0016020 "membrane" evidence=IEA]
            [GO:0060249 "anatomical structure homeostasis" evidence=IMP]
            [GO:0031101 "fin regeneration" evidence=IMP] [GO:0016023
            "cytoplasmic membrane-bounded vesicle" evidence=IEA] [GO:0005829
            "cytosol" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            ZFIN:ZDB-GENE-980526-255 GO:GO:0005829 GO:GO:0005524 GO:GO:0005634
            GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783 eggNOG:COG0515
            GO:GO:0008284 GO:GO:0043406 GO:GO:0018108 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 GO:GO:0008201 GO:GO:0001889
            GO:GO:0016023 GO:GO:0048738 GO:GO:0009953 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0017134 GO:GO:0031101 GO:GO:0036342
            GeneTree:ENSGT00670000097694 GO:GO:0043589 GO:GO:0042664
            GO:GO:0010863 KO:K04362 GO:GO:0005007 HSSP:P11362 EMBL:AF389400
            EMBL:AY197498 EMBL:AY197499 EMBL:AY197500 EMBL:AY197501
            EMBL:BX247873 EMBL:CR376860 EMBL:BC162342 EMBL:CU458752
            IPI:IPI00484543 IPI:IPI00500275 IPI:IPI00504101 IPI:IPI00817710
            IPI:IPI00939066 RefSeq:NP_694494.1 UniGene:Dr.78806
            UniGene:Dr.83393 ProteinModelPortal:Q90Z00 IntAct:Q90Z00
            STRING:Q90Z00 PRIDE:Q90Z00 Ensembl:ENSDART00000024882
            Ensembl:ENSDART00000074774 Ensembl:ENSDART00000135166
            Ensembl:ENSDART00000147742 GeneID:30705 KEGG:dre:30705 CTD:30705
            InParanoid:A4JYD6 OMA:TEYFNIS NextBio:20807055 ArrayExpress:Q90Z00
            Bgee:Q90Z00 GO:GO:0060249 GO:GO:0048916 Uniprot:Q90Z00
        Length = 810

 Score = 102 (41.0 bits), Expect = 0.00023, P = 0.00023
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query:    47 VSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             +S SG  + + +++  L Q  D +WEV R  + +   LGEGCFGQV   EA+G+D
Sbjct:   436 LSSSGSPMLSGVSEYELPQ--DPRWEVQRDRLVLGKPLGEGCFGQVMMAEAMGMD 488


>UNIPROTKB|K7GQJ1 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9823 "Sus scrofa" [GO:0016021 "integral to membrane"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 EMBL:CU571183
            Ensembl:ENSSSCT00000033078 Uniprot:K7GQJ1
        Length = 731

 Score = 101 (40.6 bits), Expect = 0.00026, P = 0.00026
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   377 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 410


>UNIPROTKB|E7EU09 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9606 "Homo sapiens" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007 EMBL:AC087623
            IPI:IPI00954560 HGNC:HGNC:3688 ChiTaRS:FGFR1
            ProteinModelPortal:E7EU09 SMR:E7EU09 Ensembl:ENST00000397103
            ArrayExpress:E7EU09 Bgee:E7EU09 Uniprot:E7EU09
        Length = 733

 Score = 101 (40.6 bits), Expect = 0.00026, P = 0.00026
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   379 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 412


>UNIPROTKB|K7GL40 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9823 "Sus scrofa" [GO:0016021 "integral to membrane"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 EMBL:CU571183
            Ensembl:ENSSSCT00000036664 Uniprot:K7GL40
        Length = 733

 Score = 101 (40.6 bits), Expect = 0.00026, P = 0.00026
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   379 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 412


>UNIPROTKB|K7GL48 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9823 "Sus scrofa" [GO:0016021 "integral to membrane"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 EMBL:CU571183
            Ensembl:ENSSSCT00000034595 Uniprot:K7GL48
        Length = 733

 Score = 101 (40.6 bits), Expect = 0.00026, P = 0.00026
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   379 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 412


>UNIPROTKB|F1LPM6 [details] [associations]
            symbol:Fgfr1 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:620713 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 IPI:IPI00565454
            Ensembl:ENSRNOT00000050980 ArrayExpress:F1LPM6 Uniprot:F1LPM6
        Length = 733

 Score = 101 (40.6 bits), Expect = 0.00026, P = 0.00026
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   379 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 412


>UNIPROTKB|F1SV94 [details] [associations]
            symbol:LCK "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0051209 "release of sequestered calcium ion into
            cytosol" evidence=IEA] [GO:0051117 "ATPase binding" evidence=IEA]
            [GO:0050856 "regulation of T cell receptor signaling pathway"
            evidence=IEA] [GO:0050853 "B cell receptor signaling pathway"
            evidence=IEA] [GO:0046777 "protein autophosphorylation"
            evidence=IEA] [GO:0045588 "positive regulation of gamma-delta T
            cell differentiation" evidence=IEA] [GO:0043548
            "phosphatidylinositol 3-kinase binding" evidence=IEA] [GO:0042610
            "CD8 receptor binding" evidence=IEA] [GO:0042609 "CD4 receptor
            binding" evidence=IEA] [GO:0042523 "positive regulation of tyrosine
            phosphorylation of Stat5 protein" evidence=IEA] [GO:0019901
            "protein kinase binding" evidence=IEA] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0010628
            "positive regulation of gene expression" evidence=IEA] [GO:0008022
            "protein C-terminus binding" evidence=IEA] [GO:0004713 "protein
            tyrosine kinase activity" evidence=IEA] [GO:0001948 "glycoprotein
            binding" evidence=IEA] [GO:0001772 "immunological synapse"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] Pfam:PF00018
            Pfam:PF00017 InterPro:IPR000719 InterPro:IPR000980
            InterPro:IPR001245 InterPro:IPR001452 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PRINTS:PR00109 PRINTS:PR00401 PRINTS:PR00452
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50001 PROSITE:PS50002
            PROSITE:PS50011 SMART:SM00219 SMART:SM00252 SMART:SM00326
            GO:GO:0005524 GO:GO:0005794 Gene3D:3.30.505.10 GO:GO:0051209
            GO:GO:0018108 SUPFAM:SSF56112 GO:GO:0046777 SUPFAM:SSF50044
            GO:GO:0004713 GO:GO:0010628 GO:GO:0050853 GO:GO:0050856
            GeneTree:ENSGT00620000087866 GO:GO:0042523 GO:GO:0045588
            OMA:GHTKVAI EMBL:FP326680 Ensembl:ENSSSCT00000004003 Uniprot:F1SV94
        Length = 509

 Score = 99 (39.9 bits), Expect = 0.00027, P = 0.00027
 Identities = 23/62 (37%), Positives = 34/62 (54%)

Query:    38 FPD-HSYYNMVSLSGEKLSNIMNDPVLNQKS-----DDKWEVPRQHIKVFDILGEGCFGQ 91
             FP  H   +  + S + L   +N P   QK      +D+WEVPR+ +K+ + LG G FG+
Sbjct:   199 FPGLHELVHHYTNSSDGLCTRLNRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGE 258

Query:    92 VW 93
             VW
Sbjct:   259 VW 260


>UNIPROTKB|F1M7N5 [details] [associations]
            symbol:Fgfr1 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0016021 "integral to membrane"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:620713 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007
            IPI:IPI00211497 Ensembl:ENSRNOT00000048089 ArrayExpress:F1M7N5
            Uniprot:F1M7N5
        Length = 801

 Score = 101 (40.6 bits), Expect = 0.00029, P = 0.00029
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   447 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 480


>UNIPROTKB|A4IFL5 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9913 "Bos taurus" [GO:0090080 "positive regulation of
            MAPKKK cascade by fibroblast growth factor receptor signaling
            pathway" evidence=IEA] [GO:0060665 "regulation of branching
            involved in salivary gland morphogenesis by mesenchymal-epithelial
            signaling" evidence=IEA] [GO:0060484 "lung-associated mesenchyme
            development" evidence=IEA] [GO:0060445 "branching involved in
            salivary gland morphogenesis" evidence=IEA] [GO:0060117 "auditory
            receptor cell development" evidence=IEA] [GO:0060045 "positive
            regulation of cardiac muscle cell proliferation" evidence=IEA]
            [GO:0048762 "mesenchymal cell differentiation" evidence=IEA]
            [GO:0048469 "cell maturation" evidence=IEA] [GO:0048378 "regulation
            of lateral mesodermal cell fate specification" evidence=IEA]
            [GO:0048339 "paraxial mesoderm development" evidence=IEA]
            [GO:0046777 "protein autophosphorylation" evidence=IEA] [GO:0045787
            "positive regulation of cell cycle" evidence=IEA] [GO:0045666
            "positive regulation of neuron differentiation" evidence=IEA]
            [GO:0043406 "positive regulation of MAP kinase activity"
            evidence=IEA] [GO:0043066 "negative regulation of apoptotic
            process" evidence=IEA] [GO:0042803 "protein homodimerization
            activity" evidence=IEA] [GO:0042474 "middle ear morphogenesis"
            evidence=IEA] [GO:0042473 "outer ear morphogenesis" evidence=IEA]
            [GO:0042472 "inner ear morphogenesis" evidence=IEA] [GO:0035607
            "fibroblast growth factor receptor signaling pathway involved in
            orbitofrontal cortex development" evidence=IEA] [GO:0030901
            "midbrain development" evidence=IEA] [GO:0030326 "embryonic limb
            morphogenesis" evidence=IEA] [GO:0021847 "ventricular zone
            neuroblast division" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0017134 "fibroblast growth
            factor binding" evidence=IEA] [GO:0010976 "positive regulation of
            neuron projection development" evidence=IEA] [GO:0010863 "positive
            regulation of phospholipase C activity" evidence=IEA] [GO:0008201
            "heparin binding" evidence=IEA] [GO:0007605 "sensory perception of
            sound" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] [GO:0002062 "chondrocyte differentiation"
            evidence=IEA] [GO:0002053 "positive regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0001759 "organ induction"
            evidence=IEA] [GO:0001701 "in utero embryonic development"
            evidence=IEA] [GO:0001657 "ureteric bud development" evidence=IEA]
            [GO:0001525 "angiogenesis" evidence=IEA] [GO:0000122 "negative
            regulation of transcription from RNA polymerase II promoter"
            evidence=IEA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005886 GO:GO:0005524
            GO:GO:0043066 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0010976
            eggNOG:COG0515 GO:GO:0043406 GO:GO:0018108 SUPFAM:SSF56112
            GO:GO:0001701 InterPro:IPR003598 SMART:SM00408 GO:GO:0008201
            GO:GO:0046777 GO:GO:0001525 GO:GO:0000122 GO:GO:0042472
            GO:GO:0030326 GO:GO:0007605 GO:GO:0030901 GO:GO:0045666
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0002062 GO:GO:0001657
            GO:GO:0045787 GO:GO:0002053 GO:GO:0048469 GO:GO:0060045
            GO:GO:0048762 GO:GO:0001759 GO:GO:0060445 GO:GO:0048378
            GeneTree:ENSGT00670000097694 GO:GO:0060484 GO:GO:0048339
            GO:GO:0042474 GO:GO:0042473 GO:GO:0060665 GO:GO:0090080
            GO:GO:0010863 CTD:2260 HOVERGEN:HBG000345 KO:K04362 GO:GO:0005007
            HOGENOM:HOG000263410 OMA:VIVYKMK OrthoDB:EOG4BCDMC GO:GO:0060117
            GO:GO:0035607 GO:GO:0021847 EMBL:DAAA02060851 EMBL:DAAA02060852
            EMBL:BC134637 IPI:IPI00717840 RefSeq:NP_001103677.1
            UniGene:Bt.32941 SMR:A4IFL5 STRING:A4IFL5
            Ensembl:ENSBTAT00000020550 GeneID:281768 KEGG:bta:281768
            InParanoid:A4IFL5 NextBio:20805684 Uniprot:A4IFL5
        Length = 820

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   466 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 499


>UNIPROTKB|F1RZJ8 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9823 "Sus scrofa" [GO:0016021 "integral to membrane"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007 OMA:VIVYKMK
            EMBL:CU571183 Ensembl:ENSSSCT00000017223 ArrayExpress:F1RZJ8
            Uniprot:F1RZJ8
        Length = 820

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   466 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 499


>UNIPROTKB|E2R186 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9615 "Canis lupus familiaris" [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 OMA:VIVYKMK
            EMBL:AAEX03010392 Ensembl:ENSCAFT00000009709 Uniprot:E2R186
        Length = 822

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 501


>UNIPROTKB|J3KNT4 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9606 "Homo sapiens" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0005007 EMBL:AC087623
            HGNC:HGNC:3688 ChiTaRS:FGFR1 ProteinModelPortal:J3KNT4
            Ensembl:ENST00000341462 Uniprot:J3KNT4
        Length = 822

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 501


>UNIPROTKB|P11362 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor 1"
            species:9606 "Homo sapiens" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0006351 "transcription, DNA-dependent" evidence=IEA]
            [GO:0001759 "organ induction" evidence=IEA] [GO:0002053 "positive
            regulation of mesenchymal cell proliferation" evidence=IEA]
            [GO:0002062 "chondrocyte differentiation" evidence=IEA] [GO:0007605
            "sensory perception of sound" evidence=IEA] [GO:0010976 "positive
            regulation of neuron projection development" evidence=IEA]
            [GO:0021847 "ventricular zone neuroblast division" evidence=IEA]
            [GO:0030326 "embryonic limb morphogenesis" evidence=IEA]
            [GO:0030901 "midbrain development" evidence=IEA] [GO:0035607
            "fibroblast growth factor receptor signaling pathway involved in
            orbitofrontal cortex development" evidence=IEA] [GO:0042472 "inner
            ear morphogenesis" evidence=IEA] [GO:0042473 "outer ear
            morphogenesis" evidence=IEA] [GO:0042474 "middle ear morphogenesis"
            evidence=IEA] [GO:0043066 "negative regulation of apoptotic
            process" evidence=IEA] [GO:0045787 "positive regulation of cell
            cycle" evidence=IEA] [GO:0048339 "paraxial mesoderm development"
            evidence=IEA] [GO:0048378 "regulation of lateral mesodermal cell
            fate specification" evidence=IEA] [GO:0048469 "cell maturation"
            evidence=IEA] [GO:0048762 "mesenchymal cell differentiation"
            evidence=IEA] [GO:0060045 "positive regulation of cardiac muscle
            cell proliferation" evidence=IEA] [GO:0060117 "auditory receptor
            cell development" evidence=IEA] [GO:0060445 "branching involved in
            salivary gland morphogenesis" evidence=IEA] [GO:0060484
            "lung-associated mesenchyme development" evidence=IEA] [GO:0060665
            "regulation of branching involved in salivary gland morphogenesis
            by mesenchymal-epithelial signaling" evidence=IEA] [GO:0090080
            "positive regulation of MAPKKK cascade by fibroblast growth factor
            receptor signaling pathway" evidence=IEA] [GO:0000122 "negative
            regulation of transcription from RNA polymerase II promoter"
            evidence=IEA] [GO:0001525 "angiogenesis" evidence=IEA] [GO:0001657
            "ureteric bud development" evidence=IEA] [GO:0001701 "in utero
            embryonic development" evidence=IEA] [GO:0005634 "nucleus"
            evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0016023
            "cytoplasmic membrane-bounded vesicle" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=NAS] [GO:0006468 "protein
            phosphorylation" evidence=NAS] [GO:0008201 "heparin binding"
            evidence=IDA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IDA;TAS] [GO:0005576 "extracellular
            region" evidence=NAS] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0042803 "protein homodimerization activity" evidence=IPI]
            [GO:0046777 "protein autophosphorylation" evidence=IDA] [GO:0004713
            "protein tyrosine kinase activity" evidence=IDA] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=IDA] [GO:0045666
            "positive regulation of neuron differentiation" evidence=IMP]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IGI;IDA;IMP] [GO:0043410 "positive regulation of MAPK
            cascade" evidence=IMP] [GO:0043406 "positive regulation of MAP
            kinase activity" evidence=IDA] [GO:0014068 "positive regulation of
            phosphatidylinositol 3-kinase cascade" evidence=TAS] [GO:0008543
            "fibroblast growth factor receptor signaling pathway"
            evidence=IGI;IDA;TAS;IPI] [GO:0017134 "fibroblast growth factor
            binding" evidence=IDA] [GO:0043009 "chordate embryonic development"
            evidence=TAS] [GO:0016477 "cell migration" evidence=TAS]
            [GO:0048705 "skeletal system morphogenesis" evidence=TAS]
            [GO:0001764 "neuron migration" evidence=TAS] [GO:0010518 "positive
            regulation of phospholipase activity" evidence=TAS] [GO:0048015
            "phosphatidylinositol-mediated signaling" evidence=TAS] [GO:0045595
            "regulation of cell differentiation" evidence=TAS] [GO:0005886
            "plasma membrane" evidence=IDA;TAS] [GO:0010863 "positive
            regulation of phospholipase C activity" evidence=IDA] [GO:0001501
            "skeletal system development" evidence=TAS] [GO:0000165 "MAPK
            cascade" evidence=TAS] [GO:0005887 "integral to plasma membrane"
            evidence=TAS] [GO:0007411 "axon guidance" evidence=TAS] [GO:0008286
            "insulin receptor signaling pathway" evidence=TAS] [GO:0042802
            "identical protein binding" evidence=IPI] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 EMBL:M34186 GO:GO:0005829 GO:GO:0005524 GO:GO:0005634
            Reactome:REACT_111045 Reactome:REACT_111102 Reactome:REACT_116125
            Reactome:REACT_6900 GO:GO:0007411 GO:GO:0008286 GO:GO:0000165
            GO:GO:0001764 GO:GO:0043066 GO:GO:0005576 GO:GO:0005887
            Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0010976 eggNOG:COG0515
            GO:GO:0008284 GO:GO:0043406 GO:GO:0051930 BRENDA:2.7.10.1
            GO:GO:0018108 SUPFAM:SSF56112 GO:GO:0001701 InterPro:IPR003598
            SMART:SM00408 GO:GO:0008201
            Pathway_Interaction_DB:glypican_1pathway GO:GO:0014068
            GO:GO:0046777 GO:GO:0006351 GO:GO:0001525 GO:GO:0016023
            GO:GO:0000122 GO:GO:0042472 GO:GO:0030326 GO:GO:0007605
            Pathway_Interaction_DB:syndecan_4_pathway GO:GO:0030901
            GO:GO:0045666 GO:GO:0048015 Pathway_Interaction_DB:fgf_pathway
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0002062 GO:GO:0048705
            GO:GO:0017134 GO:GO:0045668 GO:GO:0001657 GO:GO:0019827
            GO:GO:0021954 GO:GO:0045787 GO:GO:0002053 GO:GO:0048469
            GO:GO:0060045 GO:GO:0048762 GO:GO:0001759 GO:GO:0060445
            GO:GO:0048378 GO:GO:0043009 Orphanet:478 Orphanet:432
            DrugBank:DB00039 PDB:3KRJ PDB:3KRL PDBsum:3KRJ PDBsum:3KRL
            GO:GO:0060484 GO:GO:0048339 GO:GO:0042474 GO:GO:0042473
            GO:GO:0060665 PDB:1EVT PDB:3OJV PDBsum:1EVT PDBsum:3OJV
            GO:GO:0090080 GO:GO:0010863 PDB:1CVS PDB:1FQ9 PDBsum:1CVS
            PDBsum:1FQ9 CTD:2260 HOVERGEN:HBG000345 KO:K04362 GO:GO:0005007
            EMBL:M37722 EMBL:X52833 EMBL:M34185 EMBL:M34187 EMBL:M34188
            EMBL:X51803 EMBL:M34641 EMBL:M60485 EMBL:X57118 EMBL:X57119
            EMBL:X57120 EMBL:X57121 EMBL:X57122 EMBL:M63887 EMBL:M63888
            EMBL:M63889 EMBL:X66945 EMBL:FJ809917 EMBL:AK291754 EMBL:AK292470
            EMBL:AK309947 EMBL:AB208919 EMBL:AK222718 EMBL:AY585209
            EMBL:AC087623 EMBL:BC015035 EMBL:BC018128 EMBL:BC091494 EMBL:Y00665
            IPI:IPI00005142 IPI:IPI00012036 IPI:IPI00012039 IPI:IPI00012042
            IPI:IPI00165947 IPI:IPI00216859 IPI:IPI00220983 IPI:IPI00328245
            IPI:IPI00332838 IPI:IPI00410124 IPI:IPI00410125 IPI:IPI00410216
            IPI:IPI00410217 IPI:IPI00410218 IPI:IPI00410219 IPI:IPI00410220
            IPI:IPI00410223 IPI:IPI00455176 IPI:IPI00954560 PIR:A41266
            PIR:C36464 PIR:C40862 PIR:S11692 PIR:S19167 RefSeq:NP_001167534.1
            RefSeq:NP_001167535.1 RefSeq:NP_001167536.1 RefSeq:NP_001167537.1
            RefSeq:NP_001167538.1 RefSeq:NP_056934.2 RefSeq:NP_075593.1
            RefSeq:NP_075594.1 RefSeq:NP_075598.2 UniGene:Hs.264887 PDB:1AGW
            PDB:1FGI PDB:1FGK PDB:1XR0 PDB:2CR3 PDB:2FGI PDB:3C4F PDB:3GQI
            PDB:3GQL PDB:3JS2 PDB:3KXX PDB:3KY2 PDB:3RHX PDB:3TT0 PDB:4F63
            PDB:4F64 PDB:4F65 PDBsum:1AGW PDBsum:1FGI PDBsum:1FGK PDBsum:1XR0
            PDBsum:2CR3 PDBsum:2FGI PDBsum:3C4F PDBsum:3GQI PDBsum:3GQL
            PDBsum:3JS2 PDBsum:3KXX PDBsum:3KY2 PDBsum:3RHX PDBsum:3TT0
            PDBsum:4F63 PDBsum:4F64 PDBsum:4F65 ProteinModelPortal:P11362
            SMR:P11362 DIP:DIP-4019N IntAct:P11362 MINT:MINT-1499363
            STRING:P11362 PhosphoSite:P11362 DMDM:120046 PaxDb:P11362
            PRIDE:P11362 DNASU:2260 Ensembl:ENST00000326324
            Ensembl:ENST00000335922 Ensembl:ENST00000356207
            Ensembl:ENST00000397091 Ensembl:ENST00000397108
            Ensembl:ENST00000397113 Ensembl:ENST00000425967
            Ensembl:ENST00000447712 Ensembl:ENST00000484370
            Ensembl:ENST00000532791 GeneID:2260 KEGG:hsa:2260 UCSC:uc003xlp.3
            UCSC:uc003xlu.3 UCSC:uc003xlv.3 UCSC:uc011lbu.2 UCSC:uc011lbw.2
            UCSC:uc022aua.1 UCSC:uc022aud.1 GeneCards:GC08M038268
            HGNC:HGNC:3688 HPA:CAB033614 MIM:101600 MIM:136350 MIM:147950
            MIM:166250 MIM:190440 neXtProt:NX_P11362 Orphanet:3366
            Orphanet:168953 Orphanet:2645 Orphanet:93258 PharmGKB:PA28127
            HOGENOM:HOG000263410 InParanoid:P11362 OMA:VIVYKMK
            OrthoDB:EOG4BCDMC BindingDB:P11362 ChEMBL:CHEMBL3650 ChiTaRS:FGFR1
            EvolutionaryTrace:P11362 GenomeRNAi:2260 NextBio:9163
            PMAP-CutDB:P11362 ArrayExpress:P11362 Bgee:P11362 CleanEx:HS_FGFR1
            CleanEx:HS_FLG Genevestigator:P11362 GermOnline:ENSG00000077782
            GO:GO:0060117 GO:GO:0035607 GO:GO:0021837 GO:GO:0072091
            GO:GO:0021847 Uniprot:P11362
        Length = 822

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 501


>UNIPROTKB|K7GKU3 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor"
            species:9823 "Sus scrofa" [GO:0016021 "integral to membrane"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005007 "fibroblast growth factor-activated receptor activity"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 EMBL:CU571183
            Ensembl:ENSSSCT00000034063 Uniprot:K7GKU3
        Length = 822

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 501


>MGI|MGI:95522 [details] [associations]
            symbol:Fgfr1 "fibroblast growth factor receptor 1"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IMP]
            [GO:0000166 "nucleotide binding" evidence=IEA] [GO:0001525
            "angiogenesis" evidence=IGI] [GO:0001657 "ureteric bud development"
            evidence=IGI] [GO:0001701 "in utero embryonic development"
            evidence=IGI] [GO:0001759 "organ induction" evidence=IMP]
            [GO:0001948 "glycoprotein binding" evidence=ISO] [GO:0002053
            "positive regulation of mesenchymal cell proliferation"
            evidence=ISO;IGI;IMP] [GO:0002062 "chondrocyte differentiation"
            evidence=IGI] [GO:0004672 "protein kinase activity" evidence=IEA]
            [GO:0004713 "protein tyrosine kinase activity" evidence=ISO]
            [GO:0004714 "transmembrane receptor protein tyrosine kinase
            activity" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=ISO;IDA] [GO:0005515
            "protein binding" evidence=IPI] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737
            "cytoplasm" evidence=IEA] [GO:0005886 "plasma membrane"
            evidence=ISO] [GO:0006468 "protein phosphorylation" evidence=IDA]
            [GO:0007420 "brain development" evidence=IMP] [GO:0007435 "salivary
            gland morphogenesis" evidence=IMP] [GO:0007605 "sensory perception
            of sound" evidence=IMP] [GO:0008201 "heparin binding" evidence=ISO]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IGI;ISO;IMP;IDA] [GO:0008543 "fibroblast growth factor
            receptor signaling pathway" evidence=ISO;IGI;IDA] [GO:0010468
            "regulation of gene expression" evidence=IMP] [GO:0010629 "negative
            regulation of gene expression" evidence=IMP] [GO:0010863 "positive
            regulation of phospholipase C activity" evidence=ISO] [GO:0010976
            "positive regulation of neuron projection development"
            evidence=IGI;ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=IEA] [GO:0016301 "kinase activity"
            evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA]
            [GO:0016740 "transferase activity" evidence=IEA] [GO:0016772
            "transferase activity, transferring phosphorus-containing groups"
            evidence=IEA] [GO:0017134 "fibroblast growth factor binding"
            evidence=ISO;IPI] [GO:0018108 "peptidyl-tyrosine phosphorylation"
            evidence=ISO] [GO:0019827 "stem cell maintenance" evidence=ISO]
            [GO:0021769 "orbitofrontal cortex development" evidence=IMP]
            [GO:0021837 "motogenic signaling involved in postnatal olfactory
            bulb interneuron migration" evidence=ISO] [GO:0021847 "ventricular
            zone neuroblast division" evidence=IMP] [GO:0021954 "central
            nervous system neuron development" evidence=ISO] [GO:0030324 "lung
            development" evidence=IGI;IMP] [GO:0030326 "embryonic limb
            morphogenesis" evidence=IMP] [GO:0030901 "midbrain development"
            evidence=IGI;IMP] [GO:0031175 "neuron projection development"
            evidence=ISO] [GO:0031410 "cytoplasmic vesicle" evidence=IEA]
            [GO:0032403 "protein complex binding" evidence=ISO] [GO:0035607
            "fibroblast growth factor receptor signaling pathway involved in
            orbitofrontal cortex development" evidence=IMP] [GO:0042127
            "regulation of cell proliferation" evidence=ISO;IMP] [GO:0042472
            "inner ear morphogenesis" evidence=IMP] [GO:0042473 "outer ear
            morphogenesis" evidence=IMP] [GO:0042474 "middle ear morphogenesis"
            evidence=IMP] [GO:0042802 "identical protein binding" evidence=ISO]
            [GO:0042803 "protein homodimerization activity" evidence=ISO]
            [GO:0043066 "negative regulation of apoptotic process"
            evidence=IMP] [GO:0043406 "positive regulation of MAP kinase
            activity" evidence=ISO] [GO:0043410 "positive regulation of MAPK
            cascade" evidence=ISO] [GO:0045666 "positive regulation of neuron
            differentiation" evidence=ISO] [GO:0045668 "negative regulation of
            osteoblast differentiation" evidence=ISO] [GO:0045787 "positive
            regulation of cell cycle" evidence=IMP] [GO:0045944 "positive
            regulation of transcription from RNA polymerase II promoter"
            evidence=ISO] [GO:0046777 "protein autophosphorylation"
            evidence=ISO] [GO:0048339 "paraxial mesoderm development"
            evidence=IGI] [GO:0048378 "regulation of lateral mesodermal cell
            fate specification" evidence=IGI] [GO:0048469 "cell maturation"
            evidence=IMP] [GO:0048514 "blood vessel morphogenesis"
            evidence=IMP] [GO:0048699 "generation of neurons" evidence=IMP]
            [GO:0048762 "mesenchymal cell differentiation" evidence=IGI]
            [GO:0050839 "cell adhesion molecule binding" evidence=ISO]
            [GO:0051930 "regulation of sensory perception of pain"
            evidence=ISO] [GO:0060045 "positive regulation of cardiac muscle
            cell proliferation" evidence=IGI] [GO:0060117 "auditory receptor
            cell development" evidence=IMP] [GO:0060445 "branching involved in
            salivary gland morphogenesis" evidence=IMP] [GO:0060484
            "lung-associated mesenchyme development" evidence=IGI] [GO:0060665
            "regulation of branching involved in salivary gland morphogenesis
            by mesenchymal-epithelial signaling" evidence=IDA] [GO:0060979
            "vasculogenesis involved in coronary vascular morphogenesis"
            evidence=TAS] [GO:0072091 "regulation of stem cell proliferation"
            evidence=ISO] [GO:0090080 "positive regulation of MAPKKK cascade by
            fibroblast growth factor receptor signaling pathway" evidence=IGI]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 MGI:MGI:95522
            EMBL:M28998 GO:GO:0016021 GO:GO:0005829 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0043066 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0010976 eggNOG:COG0515 GO:GO:0043406 GO:GO:0051930
            BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112 GO:GO:0001701
            InterPro:IPR003598 SMART:SM00408 GO:GO:0008201 GO:GO:0046777
            GO:GO:0001525 GO:GO:0016023 GO:GO:0000122 Reactome:REACT_127416
            GO:GO:0042472 GO:GO:0030326 GO:GO:0007605 GO:GO:0030901
            GO:GO:0045666 GO:GO:0031175 InterPro:IPR013098 Pfam:PF07679
            GO:GO:0002062 GO:GO:0060979 GO:GO:0017134 GO:GO:0045668
            GO:GO:0001657 GO:GO:0019827 GO:GO:0021954 GO:GO:0045787
            GO:GO:0002053 MEROPS:I43.001 GO:GO:0048469 GO:GO:0060045
            GO:GO:0048762 GO:GO:0001759 GO:GO:0060445 GO:GO:0048378
            GeneTree:ENSGT00670000097694 GO:GO:0060484 GO:GO:0048339
            GO:GO:0042474 GO:GO:0042473 GO:GO:0060665 GO:GO:0090080
            GO:GO:0010863 CTD:2260 HOVERGEN:HBG000345 KO:K04362 GO:GO:0005007
            HOGENOM:HOG000263410 OrthoDB:EOG4BCDMC ChiTaRS:FGFR1 GO:GO:0060117
            GO:GO:0035607 GO:GO:0021837 GO:GO:0072091 GO:GO:0021847 EMBL:X51893
            EMBL:M65053 EMBL:M33760 EMBL:U23445 EMBL:AF176552 EMBL:AK028354
            EMBL:S74765 EMBL:AC160526 EMBL:BC033447 IPI:IPI00130549
            IPI:IPI00399479 IPI:IPI00466590 PIR:A34849 PIR:B42057 PIR:I49293
            PIR:JH0393 RefSeq:NP_001073377.1 RefSeq:NP_001073378.1
            RefSeq:NP_034336.2 UniGene:Mm.265716 PDB:2CKN PDBsum:2CKN
            ProteinModelPortal:P16092 SMR:P16092 DIP:DIP-6033N
            MINT:MINT-2635590 STRING:P16092 PhosphoSite:P16092 PaxDb:P16092
            PRIDE:P16092 Ensembl:ENSMUST00000084027 Ensembl:ENSMUST00000117179
            Ensembl:ENSMUST00000119398 Ensembl:ENSMUST00000167764
            Ensembl:ENSMUST00000178276 GeneID:14182 KEGG:mmu:14182
            UCSC:uc009lfy.1 UCSC:uc009lga.1 BindingDB:P16092 ChEMBL:CHEMBL3960
            EvolutionaryTrace:P16092 NextBio:285378 Bgee:P16092
            CleanEx:MM_FGFR1 CleanEx:MM_FLG Genevestigator:P16092
            GermOnline:ENSMUSG00000031565 Uniprot:P16092
        Length = 822

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 501


>RGD|620713 [details] [associations]
            symbol:Fgfr1 "Fibroblast growth factor receptor 1" species:10116
            "Rattus norvegicus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=ISO]
            [GO:0001525 "angiogenesis" evidence=ISO] [GO:0001657 "ureteric bud
            development" evidence=ISO] [GO:0001701 "in utero embryonic
            development" evidence=ISO] [GO:0001759 "organ induction"
            evidence=ISO] [GO:0001948 "glycoprotein binding" evidence=IDA]
            [GO:0002053 "positive regulation of mesenchymal cell proliferation"
            evidence=ISO;IMP] [GO:0002062 "chondrocyte differentiation"
            evidence=ISO] [GO:0004713 "protein tyrosine kinase activity"
            evidence=ISO] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=ISO;ISS;TAS] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0005634 "nucleus" evidence=IEA] [GO:0005829 "cytosol"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=ISO;ISS]
            [GO:0006468 "protein phosphorylation" evidence=ISO] [GO:0007420
            "brain development" evidence=ISO] [GO:0007435 "salivary gland
            morphogenesis" evidence=ISO] [GO:0007605 "sensory perception of
            sound" evidence=ISO] [GO:0008201 "heparin binding"
            evidence=ISO;ISS] [GO:0008284 "positive regulation of cell
            proliferation" evidence=ISO;ISS] [GO:0008543 "fibroblast growth
            factor receptor signaling pathway" evidence=ISO;ISS] [GO:0010468
            "regulation of gene expression" evidence=ISO] [GO:0010629 "negative
            regulation of gene expression" evidence=ISO] [GO:0010863 "positive
            regulation of phospholipase C activity" evidence=ISO;ISS]
            [GO:0010976 "positive regulation of neuron projection development"
            evidence=ISO;IDA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0016023 "cytoplasmic membrane-bounded vesicle" evidence=IEA]
            [GO:0017134 "fibroblast growth factor binding" evidence=ISO;ISS]
            [GO:0018108 "peptidyl-tyrosine phosphorylation" evidence=ISO;ISS]
            [GO:0019827 "stem cell maintenance" evidence=IMP] [GO:0021769
            "orbitofrontal cortex development" evidence=ISO] [GO:0021837
            "motogenic signaling involved in postnatal olfactory bulb
            interneuron migration" evidence=IMP] [GO:0021847 "ventricular zone
            neuroblast division" evidence=ISO] [GO:0021954 "central nervous
            system neuron development" evidence=IMP] [GO:0030324 "lung
            development" evidence=ISO] [GO:0030326 "embryonic limb
            morphogenesis" evidence=ISO] [GO:0030901 "midbrain development"
            evidence=ISO] [GO:0031175 "neuron projection development"
            evidence=IDA] [GO:0032403 "protein complex binding" evidence=IPI]
            [GO:0035607 "fibroblast growth factor receptor signaling pathway
            involved in orbitofrontal cortex development" evidence=ISO]
            [GO:0042127 "regulation of cell proliferation" evidence=ISO;IDA]
            [GO:0042472 "inner ear morphogenesis" evidence=ISO] [GO:0042473
            "outer ear morphogenesis" evidence=ISO] [GO:0042474 "middle ear
            morphogenesis" evidence=ISO] [GO:0042802 "identical protein
            binding" evidence=ISO] [GO:0042803 "protein homodimerization
            activity" evidence=ISO] [GO:0043066 "negative regulation of
            apoptotic process" evidence=ISO] [GO:0043406 "positive regulation
            of MAP kinase activity" evidence=ISO;ISS] [GO:0043410 "positive
            regulation of MAPK cascade" evidence=ISO] [GO:0045666 "positive
            regulation of neuron differentiation" evidence=ISO;ISS] [GO:0045668
            "negative regulation of osteoblast differentiation" evidence=IMP]
            [GO:0045787 "positive regulation of cell cycle" evidence=ISO]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=IMP] [GO:0046777 "protein
            autophosphorylation" evidence=ISO;ISS] [GO:0048339 "paraxial
            mesoderm development" evidence=ISO] [GO:0048378 "regulation of
            lateral mesodermal cell fate specification" evidence=ISO]
            [GO:0048469 "cell maturation" evidence=ISO] [GO:0048514 "blood
            vessel morphogenesis" evidence=ISO] [GO:0048699 "generation of
            neurons" evidence=ISO] [GO:0048762 "mesenchymal cell
            differentiation" evidence=ISO] [GO:0050839 "cell adhesion molecule
            binding" evidence=IPI] [GO:0051930 "regulation of sensory
            perception of pain" evidence=IMP] [GO:0060045 "positive regulation
            of cardiac muscle cell proliferation" evidence=ISO] [GO:0060117
            "auditory receptor cell development" evidence=ISO] [GO:0060445
            "branching involved in salivary gland morphogenesis" evidence=ISO]
            [GO:0060484 "lung-associated mesenchyme development" evidence=ISO]
            [GO:0060665 "regulation of branching involved in salivary gland
            morphogenesis by mesenchymal-epithelial signaling" evidence=ISO]
            [GO:0072091 "regulation of stem cell proliferation" evidence=IMP]
            [GO:0090080 "positive regulation of MAPKKK cascade by fibroblast
            growth factor receptor signaling pathway" evidence=ISO]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 RGD:620713
            GO:GO:0016021 GO:GO:0005829 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0043066 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0010976 eggNOG:COG0515 GO:GO:0043406 GO:GO:0051930
            BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112 GO:GO:0001701
            InterPro:IPR003598 SMART:SM00408 GO:GO:0045944 GO:GO:0008201
            GO:GO:0046777 GO:GO:0001525 GO:GO:0016023 GO:GO:0000122
            GO:GO:0042472 GO:GO:0030326 GO:GO:0007605 GO:GO:0030901
            GO:GO:0045666 GO:GO:0031175 InterPro:IPR013098 Pfam:PF07679
            GO:GO:0002062 GO:GO:0017134 GO:GO:0045668 GO:GO:0001657
            GO:GO:0019827 GO:GO:0021954 GO:GO:0045787 GO:GO:0002053
            GO:GO:0048469 GO:GO:0060045 GO:GO:0048762 GO:GO:0001759
            GO:GO:0060445 GO:GO:0048378 GO:GO:0001948 GO:GO:0060484
            GO:GO:0048339 GO:GO:0042474 GO:GO:0042473 GO:GO:0060665
            GO:GO:0090080 GO:GO:0010863 CTD:2260 HOVERGEN:HBG000345 KO:K04362
            GO:GO:0005007 HOGENOM:HOG000263410 OrthoDB:EOG4BCDMC GO:GO:0060117
            GO:GO:0035607 GO:GO:0021837 GO:GO:0072091 GO:GO:0021847 EMBL:D12498
            IPI:IPI00215356 PIR:S29840 RefSeq:NP_077060.1 UniGene:Rn.207203
            UniGene:Rn.9797 ProteinModelPortal:Q04589 SMR:Q04589 IntAct:Q04589
            STRING:Q04589 PRIDE:Q04589 GeneID:79114 KEGG:rno:79114
            UCSC:RGD:620713 NextBio:614518 ArrayExpress:Q04589
            Genevestigator:Q04589 GermOnline:ENSRNOG00000016050 Uniprot:Q04589
        Length = 822

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 501


>UNIPROTKB|F1LM54 [details] [associations]
            symbol:Fgfr1 "Fibroblast growth factor receptor"
            species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation
            of transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0001525 "angiogenesis" evidence=IEA] [GO:0001657 "ureteric bud
            development" evidence=IEA] [GO:0001701 "in utero embryonic
            development" evidence=IEA] [GO:0001759 "organ induction"
            evidence=IEA] [GO:0002053 "positive regulation of mesenchymal cell
            proliferation" evidence=IEA] [GO:0002062 "chondrocyte
            differentiation" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0007605 "sensory perception of sound" evidence=IEA] [GO:0008201
            "heparin binding" evidence=IEA] [GO:0010863 "positive regulation of
            phospholipase C activity" evidence=IEA] [GO:0010976 "positive
            regulation of neuron projection development" evidence=IEA]
            [GO:0016021 "integral to membrane" evidence=IEA] [GO:0017134
            "fibroblast growth factor binding" evidence=IEA] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0021847
            "ventricular zone neuroblast division" evidence=IEA] [GO:0030326
            "embryonic limb morphogenesis" evidence=IEA] [GO:0030901 "midbrain
            development" evidence=IEA] [GO:0035607 "fibroblast growth factor
            receptor signaling pathway involved in orbitofrontal cortex
            development" evidence=IEA] [GO:0042472 "inner ear morphogenesis"
            evidence=IEA] [GO:0042473 "outer ear morphogenesis" evidence=IEA]
            [GO:0042474 "middle ear morphogenesis" evidence=IEA] [GO:0042803
            "protein homodimerization activity" evidence=IEA] [GO:0043066
            "negative regulation of apoptotic process" evidence=IEA]
            [GO:0043406 "positive regulation of MAP kinase activity"
            evidence=IEA] [GO:0045666 "positive regulation of neuron
            differentiation" evidence=IEA] [GO:0045787 "positive regulation of
            cell cycle" evidence=IEA] [GO:0046777 "protein autophosphorylation"
            evidence=IEA] [GO:0048339 "paraxial mesoderm development"
            evidence=IEA] [GO:0048378 "regulation of lateral mesodermal cell
            fate specification" evidence=IEA] [GO:0048469 "cell maturation"
            evidence=IEA] [GO:0048762 "mesenchymal cell differentiation"
            evidence=IEA] [GO:0060045 "positive regulation of cardiac muscle
            cell proliferation" evidence=IEA] [GO:0060117 "auditory receptor
            cell development" evidence=IEA] [GO:0060445 "branching involved in
            salivary gland morphogenesis" evidence=IEA] [GO:0060484
            "lung-associated mesenchyme development" evidence=IEA] [GO:0060665
            "regulation of branching involved in salivary gland morphogenesis
            by mesenchymal-epithelial signaling" evidence=IEA] [GO:0090080
            "positive regulation of MAPKKK cascade by fibroblast growth factor
            receptor signaling pathway" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 RGD:620713 GO:GO:0016021 GO:GO:0005886 GO:GO:0005524
            GO:GO:0043066 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0010976
            GO:GO:0043406 GO:GO:0018108 SUPFAM:SSF56112 GO:GO:0001701
            InterPro:IPR003598 SMART:SM00408 GO:GO:0008201 GO:GO:0046777
            GO:GO:0001525 GO:GO:0000122 GO:GO:0042472 GO:GO:0030326
            GO:GO:0007605 GO:GO:0030901 GO:GO:0045666 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0002062 GO:GO:0001657 GO:GO:0045787
            GO:GO:0002053 GO:GO:0048469 GO:GO:0060045 GO:GO:0048762
            GO:GO:0001759 GO:GO:0060445 GO:GO:0048378
            GeneTree:ENSGT00670000097694 GO:GO:0060484 GO:GO:0048339
            GO:GO:0042474 GO:GO:0042473 GO:GO:0060665 GO:GO:0090080
            GO:GO:0010863 GO:GO:0005007 GO:GO:0060117 GO:GO:0035607
            GO:GO:0021847 IPI:IPI00215356 Ensembl:ENSRNOT00000029284
            ArrayExpress:F1LM54 Uniprot:F1LM54
        Length = 822

 Score = 101 (40.6 bits), Expect = 0.00030, P = 0.00030
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   468 DPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD 501


>ZFIN|ZDB-GENE-030323-1 [details] [associations]
            symbol:fgfr2 "fibroblast growth factor receptor 2"
            species:7955 "Danio rerio" [GO:0016772 "transferase activity,
            transferring phosphorus-containing groups" evidence=IEA]
            [GO:0004713 "protein tyrosine kinase activity" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468 "protein
            phosphorylation" evidence=IEA] [GO:0008543 "fibroblast growth
            factor receptor signaling pathway" evidence=IEA] [GO:0004672
            "protein kinase activity" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0005515 "protein binding" evidence=IPI] [GO:0017134 "fibroblast
            growth factor binding" evidence=IDA] [GO:0003146 "heart jogging"
            evidence=IMP] [GO:0001947 "heart looping" evidence=IMP] [GO:0004714
            "transmembrane receptor protein tyrosine kinase activity"
            evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA]
            [GO:0031410 "cytoplasmic vesicle" evidence=IEA] [GO:0005794 "Golgi
            apparatus" evidence=IEA] [GO:0016020 "membrane" evidence=IEA]
            [GO:0016740 "transferase activity" evidence=IEA] [GO:0005886
            "plasma membrane" evidence=IEA] [GO:0016301 "kinase activity"
            evidence=IEA] [GO:0000166 "nucleotide binding" evidence=IEA]
            [GO:0006915 "apoptotic process" evidence=IEA] [GO:0016023
            "cytoplasmic membrane-bounded vesicle" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            ZFIN:ZDB-GENE-030323-1 GO:GO:0016021 GO:GO:0005524
            Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 GO:GO:0001947 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0017134 GeneTree:ENSGT00670000097694
            GO:GO:0003146 GO:GO:0005007 EMBL:CU639430 EMBL:CU862017
            EMBL:FP102866 IPI:IPI00834696 Ensembl:ENSDART00000080916
            Ensembl:ENSDART00000149125 Uniprot:F1RBS5
        Length = 840

 Score = 101 (40.6 bits), Expect = 0.00031, P = 0.00031
 Identities = 22/49 (44%), Positives = 29/49 (59%)

Query:    55 SNIMNDPV--LNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             S+  +DP+   +   D +WE  R  + +   LGEGCFGQV   EALGID
Sbjct:   475 SSAHDDPIPEYDLPEDPRWEFSRDKLTLGKPLGEGCFGQVVMAEALGID 523


>RGD|2612 [details] [associations]
            symbol:Fgfr4 "fibroblast growth factor receptor 4" species:10116
          "Rattus norvegicus" [GO:0001759 "organ induction" evidence=IEA;ISO]
          [GO:0005007 "fibroblast growth factor-activated receptor activity"
          evidence=IEA;ISO;IPI] [GO:0005524 "ATP binding" evidence=IEA]
          [GO:0005634 "nucleus" evidence=IEA;ISO] [GO:0005737 "cytoplasm"
          evidence=ISO] [GO:0005768 "endosome" evidence=IEA] [GO:0005783
          "endoplasmic reticulum" evidence=ISO;ISS] [GO:0005887 "integral to
          plasma membrane" evidence=ISO;ISS] [GO:0005911 "cell-cell junction"
          evidence=ISO;ISS] [GO:0008201 "heparin binding" evidence=ISO;ISS]
          [GO:0008284 "positive regulation of cell proliferation"
          evidence=IEA;ISO;ISS] [GO:0008543 "fibroblast growth factor receptor
          signaling pathway" evidence=ISO;IPI] [GO:0010715 "regulation of
          extracellular matrix disassembly" evidence=ISO;ISS] [GO:0016021
          "integral to membrane" evidence=IEA] [GO:0016477 "cell migration"
          evidence=ISO;ISS] [GO:0017134 "fibroblast growth factor binding"
          evidence=ISO;ISS] [GO:0018108 "peptidyl-tyrosine phosphorylation"
          evidence=ISO;ISS] [GO:0019216 "regulation of lipid metabolic process"
          evidence=ISO;ISS] [GO:0030324 "lung development" evidence=ISO]
          [GO:0042593 "glucose homeostasis" evidence=ISO;ISS] [GO:0045862
          "positive regulation of proteolysis" evidence=ISO;ISS] [GO:0046777
          "protein autophosphorylation" evidence=ISO;ISS] [GO:0048554 "positive
          regulation of metalloenzyme activity" evidence=ISO;ISS] [GO:0055062
          "phosphate ion homeostasis" evidence=ISO;ISS] [GO:0061144 "alveolar
          secondary septum development" evidence=IEA;ISO] [GO:0070374 "positive
          regulation of ERK1 and ERK2 cascade" evidence=ISO;ISS] [GO:0070857
          "regulation of bile acid biosynthetic process" evidence=ISO;ISS]
          [GO:2000188 "regulation of cholesterol homeostasis" evidence=ISO;ISS]
          [GO:2000573 "positive regulation of DNA biosynthetic process"
          evidence=ISO;ISS] [GO:0005730 "nucleolus" evidence=ISO]
          InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
          InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
          InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628
          PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011
          PROSITE:PS50835 SMART:SM00219 RGD:2612 GO:GO:0005783 GO:GO:0005524
          GO:GO:0005634 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
          GO:GO:0016477 eggNOG:COG0515 GO:GO:0008284 GO:GO:0005768
          GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408
          GO:GO:0070374 GO:GO:0008201 GO:GO:0046777 GO:GO:0042593 GO:GO:0005911
          GO:GO:0045862 InterPro:IPR013098 Pfam:PF07679 GO:GO:0055062
          GO:GO:0017134 GO:GO:0048554 GO:GO:0001759
          GeneTree:ENSGT00670000097694 GO:GO:0070857 GO:GO:0010715
          HOVERGEN:HBG000345 GO:GO:0005007 HOGENOM:HOG000263410 GO:GO:0061144
          CTD:2264 KO:K05095 OrthoDB:EOG490789 GO:GO:2000573 GO:GO:2000188
          EMBL:BC100260 IPI:IPI00360029 RefSeq:NP_001103374.1 UniGene:Rn.24104
          ProteinModelPortal:Q498D6 SMR:Q498D6 STRING:Q498D6
          Ensembl:ENSRNOT00000042394 GeneID:25114 KEGG:rno:25114 UCSC:RGD:2612
          InParanoid:Q498D6 OMA:QDFHGEH NextBio:605473 ArrayExpress:Q498D6
          Genevestigator:Q498D6 GermOnline:ENSRNOG00000016763 Uniprot:Q498D6
        Length = 800

 Score = 100 (40.3 bits), Expect = 0.00037, P = 0.00037
 Identities = 19/34 (55%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D  WE PR  + +   LGEGCFGQV + EALG+D
Sbjct:   455 DPLWEFPRDRLVLGKPLGEGCFGQVVRAEALGMD 488


>UNIPROTKB|Q498D6 [details] [associations]
            symbol:Fgfr4 "Fibroblast growth factor receptor 4"
            species:10116 "Rattus norvegicus" [GO:0005524 "ATP binding"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR016248 InterPro:IPR017441 InterPro:IPR020635
            Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            RGD:2612 GO:GO:0005783 GO:GO:0005524 GO:GO:0005634 GO:GO:0005887
            Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0016477 eggNOG:COG0515
            GO:GO:0008284 GO:GO:0005768 GO:GO:0018108 SUPFAM:SSF56112
            InterPro:IPR003598 SMART:SM00408 GO:GO:0070374 GO:GO:0008201
            GO:GO:0046777 GO:GO:0042593 GO:GO:0005911 GO:GO:0045862
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0055062 GO:GO:0017134
            GO:GO:0048554 GO:GO:0001759 GeneTree:ENSGT00670000097694
            GO:GO:0070857 GO:GO:0010715 HOVERGEN:HBG000345 GO:GO:0005007
            HOGENOM:HOG000263410 GO:GO:0061144 CTD:2264 KO:K05095
            OrthoDB:EOG490789 GO:GO:2000573 GO:GO:2000188 EMBL:BC100260
            IPI:IPI00360029 RefSeq:NP_001103374.1 UniGene:Rn.24104
            ProteinModelPortal:Q498D6 SMR:Q498D6 STRING:Q498D6
            Ensembl:ENSRNOT00000042394 GeneID:25114 KEGG:rno:25114
            UCSC:RGD:2612 InParanoid:Q498D6 OMA:QDFHGEH NextBio:605473
            ArrayExpress:Q498D6 Genevestigator:Q498D6
            GermOnline:ENSRNOG00000016763 Uniprot:Q498D6
        Length = 800

 Score = 100 (40.3 bits), Expect = 0.00037, P = 0.00037
 Identities = 19/34 (55%), Positives = 23/34 (67%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D  WE PR  + +   LGEGCFGQV + EALG+D
Sbjct:   455 DPLWEFPRDRLVLGKPLGEGCFGQVVRAEALGMD 488


>UNIPROTKB|F1NJ92 [details] [associations]
            symbol:F1NJ92 "Fibroblast growth factor receptor"
            species:9031 "Gallus gallus" [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0000122 "negative regulation of transcription from RNA
            polymerase II promoter" evidence=IEA] [GO:0001525 "angiogenesis"
            evidence=IEA] [GO:0001657 "ureteric bud development" evidence=IEA]
            [GO:0001701 "in utero embryonic development" evidence=IEA]
            [GO:0001759 "organ induction" evidence=IEA] [GO:0002053 "positive
            regulation of mesenchymal cell proliferation" evidence=IEA]
            [GO:0002062 "chondrocyte differentiation" evidence=IEA] [GO:0005007
            "fibroblast growth factor-activated receptor activity"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0007605 "sensory perception of sound" evidence=IEA] [GO:0008201
            "heparin binding" evidence=IEA] [GO:0010863 "positive regulation of
            phospholipase C activity" evidence=IEA] [GO:0010976 "positive
            regulation of neuron projection development" evidence=IEA]
            [GO:0017134 "fibroblast growth factor binding" evidence=IEA]
            [GO:0018108 "peptidyl-tyrosine phosphorylation" evidence=IEA]
            [GO:0021847 "ventricular zone neuroblast division" evidence=IEA]
            [GO:0030326 "embryonic limb morphogenesis" evidence=IEA]
            [GO:0030901 "midbrain development" evidence=IEA] [GO:0035607
            "fibroblast growth factor receptor signaling pathway involved in
            orbitofrontal cortex development" evidence=IEA] [GO:0042472 "inner
            ear morphogenesis" evidence=IEA] [GO:0042473 "outer ear
            morphogenesis" evidence=IEA] [GO:0042474 "middle ear morphogenesis"
            evidence=IEA] [GO:0042803 "protein homodimerization activity"
            evidence=IEA] [GO:0043066 "negative regulation of apoptotic
            process" evidence=IEA] [GO:0043406 "positive regulation of MAP
            kinase activity" evidence=IEA] [GO:0045666 "positive regulation of
            neuron differentiation" evidence=IEA] [GO:0045787 "positive
            regulation of cell cycle" evidence=IEA] [GO:0046777 "protein
            autophosphorylation" evidence=IEA] [GO:0048339 "paraxial mesoderm
            development" evidence=IEA] [GO:0048378 "regulation of lateral
            mesodermal cell fate specification" evidence=IEA] [GO:0048469 "cell
            maturation" evidence=IEA] [GO:0048762 "mesenchymal cell
            differentiation" evidence=IEA] [GO:0060045 "positive regulation of
            cardiac muscle cell proliferation" evidence=IEA] [GO:0060117
            "auditory receptor cell development" evidence=IEA] [GO:0060445
            "branching involved in salivary gland morphogenesis" evidence=IEA]
            [GO:0060484 "lung-associated mesenchyme development" evidence=IEA]
            [GO:0060665 "regulation of branching involved in salivary gland
            morphogenesis by mesenchymal-epithelial signaling" evidence=IEA]
            [GO:0090080 "positive regulation of MAPKKK cascade by fibroblast
            growth factor receptor signaling pathway" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0016021
            GO:GO:0005886 GO:GO:0005524 GO:GO:0043066 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0043406 GO:GO:0018108 SUPFAM:SSF56112
            InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408
            GO:GO:0008201 GO:GO:0046777 GO:GO:0000122 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0045787 GO:GO:0002053 GO:GO:0060045
            GO:GO:0001759 GO:GO:0048378 GeneTree:ENSGT00670000097694
            GO:GO:0060665 GO:GO:0090080 GO:GO:0010863 IPI:IPI00579815
            GO:GO:0005007 OMA:VIVYKMK EMBL:AADN02054853 EMBL:AADN02054854
            EMBL:AADN02054855 ProteinModelPortal:F1NJ92
            Ensembl:ENSGALT00000005246 Uniprot:F1NJ92
        Length = 816

 Score = 100 (40.3 bits), Expect = 0.00038, P = 0.00038
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   463 DPRWELPRDRLILGKPLGEGCFGQVVLAEAIGLD 496


>UNIPROTKB|P21804 [details] [associations]
            symbol:FGFR1 "Fibroblast growth factor receptor 1"
            species:9031 "Gallus gallus" [GO:0008284 "positive regulation of
            cell proliferation" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0003347 "epicardial cell to mesenchymal cell transition"
            evidence=TAS] [GO:0045893 "positive regulation of transcription,
            DNA-dependent" evidence=TAS] [GO:0005634 "nucleus" evidence=IEA]
            [GO:0005829 "cytosol" evidence=IEA] [GO:0016023 "cytoplasmic
            membrane-bounded vesicle" evidence=IEA] [GO:0010863 "positive
            regulation of phospholipase C activity" evidence=ISS] [GO:0018108
            "peptidyl-tyrosine phosphorylation" evidence=ISS] [GO:0043406
            "positive regulation of MAP kinase activity" evidence=ISS]
            [GO:0008201 "heparin binding" evidence=ISS] [GO:0017134 "fibroblast
            growth factor binding" evidence=ISS] [GO:0005886 "plasma membrane"
            evidence=ISS] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=ISS] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005829 GO:GO:0005886
            GO:GO:0005524 GO:GO:0005634 GO:GO:0045893 Gene3D:2.60.40.10
            InterPro:IPR013783 eggNOG:COG0515 GO:GO:0008284 GO:GO:0043406
            BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0008201 GO:GO:0016023 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0017134 InterPro:IPR013151 Pfam:PF00047
            GO:GO:0003347 GO:GO:0010863 EMBL:M24637 IPI:IPI00579815 PIR:A41345
            RefSeq:NP_990841.1 UniGene:Gga.870 ProteinModelPortal:P21804
            SMR:P21804 STRING:P21804 GeneID:396516 KEGG:gga:396516 CTD:2260
            HOVERGEN:HBG000345 InParanoid:P21804 KO:K04362 NextBio:20816553
            GO:GO:0005007 Uniprot:P21804
        Length = 819

 Score = 100 (40.3 bits), Expect = 0.00038, P = 0.00038
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D +WE+PR  + +   LGEGCFGQV   EA+G+D
Sbjct:   466 DPRWELPRDRLILGKPLGEGCFGQVVLAEAIGLD 499


>MGI|MGI:95525 [details] [associations]
            symbol:Fgfr4 "fibroblast growth factor receptor 4"
            species:10090 "Mus musculus" [GO:0000166 "nucleotide binding"
            evidence=IEA] [GO:0001759 "organ induction" evidence=IMP]
            [GO:0004672 "protein kinase activity" evidence=IEA] [GO:0004713
            "protein tyrosine kinase activity" evidence=IEA] [GO:0004714
            "transmembrane receptor protein tyrosine kinase activity"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=ISO] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005768
            "endosome" evidence=IEA] [GO:0005783 "endoplasmic reticulum"
            evidence=ISO] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005887 "integral to plasma membrane" evidence=ISO] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0008201 "heparin
            binding" evidence=ISO] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IGI;ISO] [GO:0008543 "fibroblast growth
            factor receptor signaling pathway" evidence=IGI;ISO] [GO:0010715
            "regulation of extracellular matrix disassembly" evidence=ISO]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0016301 "kinase activity" evidence=IEA]
            [GO:0016310 "phosphorylation" evidence=IEA] [GO:0016477 "cell
            migration" evidence=ISO] [GO:0016740 "transferase activity"
            evidence=IEA] [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0017134 "fibroblast
            growth factor binding" evidence=ISO] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=ISO] [GO:0019216 "regulation of lipid
            metabolic process" evidence=IMP] [GO:0030324 "lung development"
            evidence=IMP] [GO:0042593 "glucose homeostasis" evidence=IMP]
            [GO:0045862 "positive regulation of proteolysis" evidence=ISO]
            [GO:0046777 "protein autophosphorylation" evidence=ISO] [GO:0048554
            "positive regulation of metalloenzyme activity" evidence=ISO]
            [GO:0055062 "phosphate ion homeostasis" evidence=IMP] [GO:0061144
            "alveolar secondary septum development" evidence=IGI] [GO:0070374
            "positive regulation of ERK1 and ERK2 cascade" evidence=ISO]
            [GO:0070857 "regulation of bile acid biosynthetic process"
            evidence=ISO;IMP] [GO:2000188 "regulation of cholesterol
            homeostasis" evidence=IMP] [GO:2000573 "positive regulation of DNA
            biosynthetic process" evidence=ISO] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 MGI:MGI:95525 GO:GO:0005783 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0016477 eggNOG:COG0515 GO:GO:0008284 GO:GO:0005768
            BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0008201 GO:GO:0046777
            GO:GO:0042593 GO:GO:0005911 GO:GO:0045862 InterPro:IPR013098
            Pfam:PF07679 GO:GO:0055062 GO:GO:0017134 GO:GO:0048554
            MEROPS:I43.001 GO:GO:0001759 GeneTree:ENSGT00670000097694
            GO:GO:0070857 GO:GO:0010715 HOVERGEN:HBG000345 GO:GO:0005007
            HOGENOM:HOG000263410 GO:GO:0061144 CTD:2264 KO:K05095
            OrthoDB:EOG490789 GO:GO:2000573 GO:GO:2000188 EMBL:X59927
            EMBL:DQ388428 EMBL:AY493377 EMBL:AK084850 EMBL:BC033313 EMBL:X57236
            IPI:IPI00129219 IPI:IPI00742377 PIR:S18209 RefSeq:NP_032037.2
            UniGene:Mm.276715 ProteinModelPortal:Q03142 SMR:Q03142
            DIP:DIP-58508N STRING:Q03142 PhosphoSite:Q03142 PRIDE:Q03142
            Ensembl:ENSMUST00000005452 GeneID:14186 KEGG:mmu:14186
            UCSC:uc007qqb.1 UCSC:uc011yzq.1 InParanoid:Q03142 ChEMBL:CHEMBL3839
            NextBio:285398 Bgee:Q03142 CleanEx:MM_FGFR4 Genevestigator:Q03142
            GermOnline:ENSMUSG00000005320 Uniprot:Q03142
        Length = 799

 Score = 99 (39.9 bits), Expect = 0.00047, P = 0.00047
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query:    47 VSLSGEKL-SNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             +S SG  L + ++N   L+   D  WE PR  + +   LGEGCFGQV + EA G+D
Sbjct:   435 LSSSGPPLLTGLVN---LDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD 487


>UNIPROTKB|K7GKA2 [details] [associations]
            symbol:FLT3 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0016021 "integral to membrane" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0007169 "transmembrane
            receptor protein tyrosine kinase signaling pathway" evidence=IEA]
            [GO:0004714 "transmembrane receptor protein tyrosine kinase
            activity" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR001824 InterPro:IPR007110 InterPro:IPR011009
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF00069 Pfam:PF07714
            PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00240 PROSITE:PS50011
            PROSITE:PS50835 SMART:SM00219 Gene3D:2.60.40.10 InterPro:IPR013783
            SUPFAM:SSF56112 InterPro:IPR003599 SMART:SM00409 InterPro:IPR013151
            Pfam:PF00047 GeneTree:ENSGT00660000095142 EMBL:CU861636
            Ensembl:ENSSSCT00000033941 Uniprot:K7GKA2
        Length = 930

 Score = 92 (37.4 bits), Expect = 0.00061, Sum P(2) = 0.00061
 Identities = 21/65 (32%), Positives = 33/65 (50%)

Query:    36 ERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKC 95
             +RF   S   MV ++G   ++         + D KWE PR++++   +LG G FG+V   
Sbjct:   549 KRFRYESQLQMVQVTGSLDNDYFYIDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNA 608

Query:    96 EALGI 100
              A GI
Sbjct:   609 TAYGI 613

 Score = 30 (15.6 bits), Expect = 0.00061, Sum P(2) = 0.00061
 Identities = 5/7 (71%), Positives = 5/7 (71%)

Query:     4 CWDKEPN 10
             C DK PN
Sbjct:   448 CSDKSPN 454


>UNIPROTKB|K7GKB5 [details] [associations]
            symbol:FGFR4 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0005524 "ATP binding" evidence=IEA] [GO:0004672
            "protein kinase activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF07714 PROSITE:PS00107 PROSITE:PS50011 SUPFAM:SSF56112
            GeneTree:ENSGT00670000097694 EMBL:CU928685
            Ensembl:ENSSSCT00000033076 Uniprot:K7GKB5
        Length = 246

 Score = 91 (37.1 bits), Expect = 0.00061, P = 0.00061
 Identities = 18/34 (52%), Positives = 21/34 (61%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D  WE PR  + +   LGEGCFGQV   EA G+D
Sbjct:    88 DPLWEFPRDRLVLGKPLGEGCFGQVVCAEAFGMD 121


>UNIPROTKB|F1RSW2 [details] [associations]
            symbol:FLT3 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0046777 "protein autophosphorylation" evidence=IEA]
            [GO:0045578 "negative regulation of B cell differentiation"
            evidence=IEA] [GO:0043548 "phosphatidylinositol 3-kinase binding"
            evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0008285
            "negative regulation of cell proliferation" evidence=IEA]
            [GO:0002572 "pro-T cell differentiation" evidence=IEA] [GO:0002328
            "pro-B cell differentiation" evidence=IEA] [GO:0002318 "myeloid
            progenitor cell differentiation" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0007169 "transmembrane receptor protein tyrosine
            kinase signaling pathway" evidence=IEA] [GO:0004714 "transmembrane
            receptor protein tyrosine kinase activity" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR001824
            InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714 PROSITE:PS00107
            PROSITE:PS00109 PROSITE:PS00240 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 GO:GO:0008285
            GO:GO:0009986 GO:GO:0004714 SUPFAM:SSF56112 InterPro:IPR003599
            SMART:SM00409 GO:GO:0046777 GO:GO:0007169 InterPro:IPR013151
            Pfam:PF00047 GO:GO:0002328 GO:GO:0002318 GO:GO:0045578
            GO:GO:0002572 OMA:KQFRYES EMBL:CU861636 Ensembl:ENSSSCT00000010202
            Uniprot:F1RSW2
        Length = 971

 Score = 92 (37.4 bits), Expect = 0.00067, Sum P(2) = 0.00067
 Identities = 21/65 (32%), Positives = 33/65 (50%)

Query:    36 ERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKC 95
             +RF   S   MV ++G   ++         + D KWE PR++++   +LG G FG+V   
Sbjct:   549 KRFRYESQLQMVQVTGSLDNDYFYIDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNA 608

Query:    96 EALGI 100
              A GI
Sbjct:   609 TAYGI 613

 Score = 30 (15.6 bits), Expect = 0.00067, Sum P(2) = 0.00067
 Identities = 5/7 (71%), Positives = 5/7 (71%)

Query:     4 CWDKEPN 10
             C DK PN
Sbjct:   448 CSDKSPN 454


>UNIPROTKB|J9NUD6 [details] [associations]
            symbol:FGFR4 "Fibroblast growth factor receptor"
            species:9615 "Canis lupus familiaris" [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 EMBL:AAEX03002971
            Ensembl:ENSCAFT00000043646 Uniprot:J9NUD6
        Length = 750

 Score = 97 (39.2 bits), Expect = 0.00072, P = 0.00072
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query:    47 VSLSGEKL-SNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             +S SG  L S +++   L+   D  WE PR  + +   LGEGCFGQV + EA G+D
Sbjct:   387 LSSSGPPLLSGLVS---LDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD 439


>ZFIN|ZDB-GENE-980526-488 [details] [associations]
            symbol:fgfr4 "fibroblast growth factor receptor 4"
            species:7955 "Danio rerio" [GO:0004672 "protein kinase activity"
            evidence=IEA] [GO:0004713 "protein tyrosine kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA;ISS]
            [GO:0006468 "protein phosphorylation" evidence=IEA] [GO:0016021
            "integral to membrane" evidence=IEA] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IEA;ISS] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0008543 "fibroblast
            growth factor receptor signaling pathway" evidence=IEA;ISS]
            [GO:0005515 "protein binding" evidence=IPI] [GO:0004714
            "transmembrane receptor protein tyrosine kinase activity"
            evidence=IEA] [GO:0016740 "transferase activity" evidence=IEA]
            [GO:0005886 "plasma membrane" evidence=IEA] [GO:0016301 "kinase
            activity" evidence=IEA] [GO:0000166 "nucleotide binding"
            evidence=IEA] [GO:0005768 "endosome" evidence=IEA] [GO:0016020
            "membrane" evidence=IEA] [GO:0016310 "phosphorylation"
            evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219
            ZFIN:ZDB-GENE-980526-488 GO:GO:0005783 GO:GO:0016021 GO:GO:0005886
            GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 eggNOG:COG0515
            GO:GO:0008284 GO:GO:0005768 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679 InterPro:IPR013151
            Pfam:PF00047 HOVERGEN:HBG000345 GO:GO:0005007 HOGENOM:HOG000263410
            HSSP:P11362 EMBL:U23839 IPI:IPI00865750 RefSeq:NP_571505.1
            UniGene:Dr.75058 ProteinModelPortal:Q90413 SMR:Q90413 IntAct:Q90413
            STRING:Q90413 PRIDE:Q90413 GeneID:100000160 KEGG:dre:100000160
            CTD:2264 InParanoid:Q90413 KO:K05095 OrthoDB:EOG490789
            NextBio:20784544 ArrayExpress:Q90413 Uniprot:Q90413
        Length = 922

 Score = 98 (39.6 bits), Expect = 0.00072, P = 0.00072
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D  WE PR+++ +   LGEGCFGQV + EA GI+
Sbjct:   568 DPDWEFPRENLTLGKPLGEGCFGQVVRAEAYGIN 601


>UNIPROTKB|E7ER61 [details] [associations]
            symbol:FLT3 "Receptor-type tyrosine-protein kinase FLT3"
            species:9606 "Homo sapiens" [GO:0004714 "transmembrane receptor
            protein tyrosine kinase activity" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0007169 "transmembrane receptor protein
            tyrosine kinase signaling pathway" evidence=IEA] [GO:0016020
            "membrane" evidence=IEA] InterPro:IPR000719 InterPro:IPR001245
            InterPro:IPR001824 InterPro:IPR007110 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF07714 PROSITE:PS00107 PROSITE:PS00240
            PROSITE:PS50011 PROSITE:PS50835 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0016020 GO:GO:0004714 SUPFAM:SSF56112
            InterPro:IPR003599 SMART:SM00409 GO:GO:0007169 EMBL:AL591024
            InterPro:IPR013151 Pfam:PF00047 EMBL:AL356915 EMBL:AL445262
            IPI:IPI00945045 HGNC:HGNC:3765 ProteinModelPortal:E7ER61 SMR:E7ER61
            Ensembl:ENST00000380987 ArrayExpress:E7ER61 Bgee:E7ER61
            Uniprot:E7ER61
        Length = 739

 Score = 89 (36.4 bits), Expect = 0.00074, Sum P(2) = 0.00074
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query:    36 ERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKC 95
             ++F   S   MV ++G   +          + D KWE PR++++   +LG G FG+V   
Sbjct:   568 KQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNA 627

Query:    96 EALGI 100
              A GI
Sbjct:   628 TAYGI 632

 Score = 30 (15.6 bits), Expect = 0.00074, Sum P(2) = 0.00074
 Identities = 5/7 (71%), Positives = 5/7 (71%)

Query:     4 CWDKEPN 10
             C DK PN
Sbjct:   467 CSDKSPN 473


>UNIPROTKB|F6XBX5 [details] [associations]
            symbol:FGFR4 "Fibroblast growth factor receptor"
            species:9615 "Canis lupus familiaris" [GO:0016021 "integral to
            membrane" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0005007 "fibroblast growth factor-activated
            receptor activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR001245 InterPro:IPR007110 InterPro:IPR008266
            InterPro:IPR011009 InterPro:IPR016248 InterPro:IPR017441
            InterPro:IPR020635 Pfam:PF07714 PIRSF:PIRSF000628 PRINTS:PR00109
            PROSITE:PS00107 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835
            SMART:SM00219 GO:GO:0016021 GO:GO:0005524 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0008284 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 InterPro:IPR013098 Pfam:PF07679
            GeneTree:ENSGT00670000097694 GO:GO:0005007 CTD:2264 KO:K05095
            OMA:QDFHGEH EMBL:AAEX03002971 Ensembl:ENSCAFT00000026179
            RefSeq:XP_546211.3 GeneID:489095 KEGG:cfa:489095 Uniprot:F6XBX5
        Length = 801

 Score = 97 (39.2 bits), Expect = 0.00078, P = 0.00078
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query:    47 VSLSGEKL-SNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             +S SG  L S +++   L+   D  WE PR  + +   LGEGCFGQV + EA G+D
Sbjct:   438 LSSSGPPLLSGLVS---LDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD 490


>UNIPROTKB|E2QYW5 [details] [associations]
            symbol:FGFR4 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:2000573 "positive regulation of DNA
            biosynthetic process" evidence=IEA] [GO:2000188 "regulation of
            cholesterol homeostasis" evidence=IEA] [GO:0070857 "regulation of
            bile acid biosynthetic process" evidence=IEA] [GO:0070374 "positive
            regulation of ERK1 and ERK2 cascade" evidence=IEA] [GO:0061144
            "alveolar secondary septum development" evidence=IEA] [GO:0055062
            "phosphate ion homeostasis" evidence=IEA] [GO:0048554 "positive
            regulation of metalloenzyme activity" evidence=IEA] [GO:0046777
            "protein autophosphorylation" evidence=IEA] [GO:0045862 "positive
            regulation of proteolysis" evidence=IEA] [GO:0042593 "glucose
            homeostasis" evidence=IEA] [GO:0018108 "peptidyl-tyrosine
            phosphorylation" evidence=IEA] [GO:0017134 "fibroblast growth
            factor binding" evidence=IEA] [GO:0016477 "cell migration"
            evidence=IEA] [GO:0010715 "regulation of extracellular matrix
            disassembly" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0008201 "heparin binding"
            evidence=IEA] [GO:0005911 "cell-cell junction" evidence=IEA]
            [GO:0005887 "integral to plasma membrane" evidence=IEA] [GO:0005783
            "endoplasmic reticulum" evidence=IEA] [GO:0005634 "nucleus"
            evidence=IEA] [GO:0001759 "organ induction" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0005007 "fibroblast
            growth factor-activated receptor activity" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0005783
            GO:GO:0005524 GO:GO:0005634 GO:GO:0005887 Gene3D:2.60.40.10
            InterPro:IPR013783 GO:GO:0016477 GO:GO:0008284 GO:GO:0018108
            SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408 GO:GO:0070374
            GO:GO:0008201 GO:GO:0046777 GO:GO:0042593 GO:GO:0005911
            GO:GO:0045862 InterPro:IPR013098 Pfam:PF07679 GO:GO:0055062
            GO:GO:0048554 GO:GO:0001759 GO:GO:0070857 GO:GO:0010715
            GO:GO:0005007 GO:GO:0061144 GO:GO:2000573 GO:GO:2000188
            ProteinModelPortal:E2QYW5 Ensembl:ENSCAFT00000026179 Uniprot:E2QYW5
        Length = 805

 Score = 97 (39.2 bits), Expect = 0.00078, P = 0.00078
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query:    47 VSLSGEKL-SNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             +S SG  L S +++   L+   D  WE PR  + +   LGEGCFGQV + EA G+D
Sbjct:   442 LSSSGPPLLSGLVS---LDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD 494


>UNIPROTKB|P22182 [details] [associations]
            symbol:fgfr1 "Fibroblast growth factor receptor 1"
            species:8355 "Xenopus laevis" [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=ISS]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0016021
            GO:GO:0005829 GO:GO:0005886 GO:GO:0005524 GO:GO:0005634
            Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0008284 BRENDA:2.7.10.1
            SUPFAM:SSF56112 InterPro:IPR003598 SMART:SM00408 GO:GO:0016023
            InterPro:IPR013098 Pfam:PF07679 HOVERGEN:HBG000345 KO:K04362
            GO:GO:0005007 EMBL:U24491 EMBL:M62322 PIR:A36477
            RefSeq:NP_001081157.1 RefSeq:NP_001081338.1 UniGene:Xl.34918
            UniGene:Xl.6480 ProteinModelPortal:P22182 SMR:P22182
            MINT:MINT-1778523 PRIDE:P22182 GeneID:394418 GeneID:397782
            KEGG:xla:394418 KEGG:xla:397782 CTD:394418 CTD:397782
            Xenbase:XB-GENE-6254218 Uniprot:P22182
        Length = 812

 Score = 97 (39.2 bits), Expect = 0.00079, P = 0.00079
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query:    47 VSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             +S SG  + + +++  L +  D +WEV R  + +   LGEGCFGQV   EA+G+D
Sbjct:   443 LSSSGTPMLSGLSEYELPE--DPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLD 495


>UNIPROTKB|P42683 [details] [associations]
            symbol:LCK "Proto-oncogene tyrosine-protein kinase LCK"
            species:9031 "Gallus gallus" [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0004715 "non-membrane spanning protein tyrosine
            kinase activity" evidence=IEA] [GO:0005886 "plasma membrane"
            evidence=IEA] [GO:0050870 "positive regulation of T cell
            activation" evidence=ISS] [GO:0006919 "activation of cysteine-type
            endopeptidase activity involved in apoptotic process" evidence=ISS]
            [GO:0000242 "pericentriolar material" evidence=ISS] [GO:0004713
            "protein tyrosine kinase activity" evidence=ISS] [GO:0004722
            "protein serine/threonine phosphatase activity" evidence=ISS]
            [GO:0006882 "cellular zinc ion homeostasis" evidence=ISS]
            [GO:0006917 "induction of apoptosis" evidence=ISS] [GO:0030217 "T
            cell differentiation" evidence=ISS] [GO:0042169 "SH2 domain
            binding" evidence=ISS] [GO:0042493 "response to drug" evidence=ISS]
            [GO:0045121 "membrane raft" evidence=ISS] Pfam:PF00018 Pfam:PF00017
            InterPro:IPR000719 InterPro:IPR000980 InterPro:IPR001245
            InterPro:IPR001452 InterPro:IPR008266 InterPro:IPR011009
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714 PRINTS:PR00109
            PRINTS:PR00401 PRINTS:PR00452 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50001 PROSITE:PS50002 PROSITE:PS50011 SMART:SM00219
            SMART:SM00252 SMART:SM00326 GO:GO:0005886 GO:GO:0005524
            GO:GO:0004722 GO:GO:0006917 GO:GO:0042493 Gene3D:3.30.505.10
            SUPFAM:SSF56112 GO:GO:0045121 SUPFAM:SSF50044 BRENDA:2.7.10.2
            GO:GO:0004715 GO:GO:0004713 GO:GO:0006919 GO:GO:0042169
            GO:GO:0006882 GO:GO:0000242 GO:GO:0030217 GO:GO:0050870
            HOVERGEN:HBG008761 EMBL:X60380 EMBL:M85043 EMBL:J03579
            IPI:IPI00587591 PIR:A42126 UniGene:Gga.11320
            ProteinModelPortal:P42683 SMR:P42683 PRIDE:P42683 Uniprot:P42683
        Length = 508

 Score = 94 (38.1 bits), Expect = 0.00092, P = 0.00092
 Identities = 21/58 (36%), Positives = 29/58 (50%)

Query:    41 HSYYNMVSLSGEKLSNIMNDPVLNQKSD-----DKWEVPRQHIKVFDILGEGCFGQVW 93
             H      S S + L   +  P   QK       D+WEVPR+ +K+ + LG G FG+VW
Sbjct:   202 HELVEYYSSSSDGLCTRLGKPCRTQKPQKPWWQDEWEVPRESLKLVEKLGAGQFGEVW 259


>UNIPROTKB|P22455 [details] [associations]
            symbol:FGFR4 "Fibroblast growth factor receptor 4"
            species:9606 "Homo sapiens" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0001759 "organ induction" evidence=IEA] [GO:0061144 "alveolar
            secondary septum development" evidence=IEA] [GO:0005576
            "extracellular region" evidence=IEA] [GO:0005768 "endosome"
            evidence=IEA] [GO:0070857 "regulation of bile acid biosynthetic
            process" evidence=IMP] [GO:0070374 "positive regulation of ERK1 and
            ERK2 cascade" evidence=IMP] [GO:0005007 "fibroblast growth
            factor-activated receptor activity" evidence=IGI;IDA] [GO:0008543
            "fibroblast growth factor receptor signaling pathway"
            evidence=IGI;IDA;TAS;IPI] [GO:2000573 "positive regulation of DNA
            biosynthetic process" evidence=IMP] [GO:0005783 "endoplasmic
            reticulum" evidence=IDA] [GO:0005887 "integral to plasma membrane"
            evidence=IDA] [GO:0018108 "peptidyl-tyrosine phosphorylation"
            evidence=IDA] [GO:0010715 "regulation of extracellular matrix
            disassembly" evidence=IMP] [GO:0016477 "cell migration"
            evidence=IMP] [GO:0046777 "protein autophosphorylation"
            evidence=IDA] [GO:0045862 "positive regulation of proteolysis"
            evidence=IMP] [GO:0048554 "positive regulation of metalloenzyme
            activity" evidence=IMP] [GO:0005911 "cell-cell junction"
            evidence=IDA] [GO:0019216 "regulation of lipid metabolic process"
            evidence=ISS] [GO:0042593 "glucose homeostasis" evidence=ISS]
            [GO:0055062 "phosphate ion homeostasis" evidence=ISS] [GO:2000188
            "regulation of cholesterol homeostasis" evidence=ISS] [GO:0017134
            "fibroblast growth factor binding" evidence=IDA;IPI] [GO:0008201
            "heparin binding" evidence=IDA] [GO:0008284 "positive regulation of
            cell proliferation" evidence=IGI;IDA] [GO:0004713 "protein tyrosine
            kinase activity" evidence=TAS] [GO:0005886 "plasma membrane"
            evidence=TAS] [GO:0008286 "insulin receptor signaling pathway"
            evidence=TAS] [GO:0005634 "nucleus" evidence=IDA] [GO:0005730
            "nucleolus" evidence=IDA] [GO:0005737 "cytoplasm" evidence=IDA]
            InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR007110
            InterPro:IPR008266 InterPro:IPR011009 InterPro:IPR016248
            InterPro:IPR017441 InterPro:IPR020635 Pfam:PF07714
            PIRSF:PIRSF000628 PRINTS:PR00109 PROSITE:PS00107 PROSITE:PS00109
            PROSITE:PS50011 PROSITE:PS50835 SMART:SM00219 GO:GO:0005783
            GO:GO:0005524 GO:GO:0005634 Reactome:REACT_111102
            Reactome:REACT_116125 Reactome:REACT_6900 GO:GO:0008286
            GO:GO:0005576 GO:GO:0005887 Gene3D:2.60.40.10 InterPro:IPR013783
            GO:GO:0016477 eggNOG:COG0515 GO:GO:0008284 GO:GO:0005768
            BRENDA:2.7.10.1 GO:GO:0018108 SUPFAM:SSF56112 InterPro:IPR003598
            SMART:SM00408 GO:GO:0070374 GO:GO:0008201 GO:GO:0046777
            GO:GO:0042593 GO:GO:0045862 Pathway_Interaction_DB:fgf_pathway
            InterPro:IPR013098 Pfam:PF07679 GO:GO:0055062 GO:GO:0017134
            GO:GO:0048554 EMBL:CH471195 MEROPS:I43.001 GO:GO:0001759
            DrugBank:DB00039 GO:GO:0070857 GO:GO:0010715 PDB:1QCT PDBsum:1QCT
            HOVERGEN:HBG000345 GO:GO:0005007 HOGENOM:HOG000263410 GO:GO:0061144
            CTD:2264 KO:K05095 OrthoDB:EOG490789 EMBL:X57205 EMBL:L03840
            EMBL:AF202063 EMBL:Y13901 EMBL:AF487555 EMBL:EF571596 EMBL:AC027314
            EMBL:BC011847 EMBL:M59373 IPI:IPI00304578 IPI:IPI00420109
            PIR:S15345 RefSeq:NP_002002.3 RefSeq:NP_075252.2 RefSeq:NP_998812.1
            UniGene:Hs.165950 ProteinModelPortal:P22455 SMR:P22455
            DIP:DIP-5149N STRING:P22455 PhosphoSite:P22455 DMDM:13432140
            PaxDb:P22455 PRIDE:P22455 DNASU:2264 Ensembl:ENST00000292408
            Ensembl:ENST00000292410 Ensembl:ENST00000393637
            Ensembl:ENST00000502906 GeneID:2264 KEGG:hsa:2264 UCSC:uc003mfl.3
            UCSC:uc003mfo.3 GeneCards:GC05P176513 HGNC:HGNC:3691 HPA:CAB005196
            HPA:HPA027273 HPA:HPA027369 HPA:HPA028251 MIM:134935
            neXtProt:NX_P22455 PharmGKB:PA28130 PhylomeDB:P22455
            BindingDB:P22455 ChEMBL:CHEMBL3973 ChiTaRS:FGFR4 GenomeRNAi:2264
            NextBio:9195 ArrayExpress:P22455 Bgee:P22455 CleanEx:HS_FGFR4
            Genevestigator:P22455 GermOnline:ENSG00000160867 GO:GO:2000573
            GO:GO:2000188 Uniprot:P22455
        Length = 802

 Score = 96 (38.9 bits), Expect = 0.0010, P = 0.0010
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query:    68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
             D  WE PR  + +   LGEGCFGQV + EA G+D
Sbjct:   457 DPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD 490


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.139   0.460    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      101        88   0.00091  102 3  11 22  0.36    30
                                                     29  0.49    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  74
  No. of states in DFA:  582 (62 KB)
  Total size of DFA:  141 KB (2087 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  9.67u 0.08s 9.75t   Elapsed:  00:00:15
  Total cpu time:  9.68u 0.09s 9.77t   Elapsed:  00:00:15
  Start:  Thu Aug 15 13:52:02 2013   End:  Thu Aug 15 13:52:17 2013

Back to top