Diaphorina citri psyllid: psy15829

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---

MQSGTLNAPWSYMTAERAVEIARKLLDDVGCNGTTNLEDNPERVMSCLGAVDSKTISSMQWNSYTAILGFTSAPTIDGELVPKHPLAMIEDMSKDDNLTEIIIGSNQDEGTYFLLYDFIDYFEKDGPSTLPREKFLILVNQIFKVKPESEQAAAIIHEKHTSFTSRELTFLILVNQIFKVKPESEQAAAIIHE

ccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccHHHHHHccccccccccEEEEEccccccHHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHcEEEcccHHHHHHHHHcc

******N*PWSYMTAERAVEIARKLLDDVGCNGTTNLEDNPERVMSCLGAVDSKTISSMQWNSYTAILGFTSAPTIDGELVPKHPLAMIEDMSKDDNLTEIIIGSNQDEGTYFLLYDFIDYFEKDGPSTLPREKFLILVNQIFKVKPESEQAAAIIHEKHTSFTSRELTFLILVNQIFKVKPESEQAAAII**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQSGTLNAPWSYMTAERAVEIARKLLDDVGCNGTTNLEDNPERVMSCLGAVDSKTISSMQWNSYTAILGFTSAPTIDGELVPKHPLAMIEDMSKDDNLTEIIIGSNQDEGTYFLLYDFIDYFEKDGPSTLPREKFLILVNQIFKVKPESEQAAAIIHEKHTSFTSRELTFLILVNQIFKVKPESEQAAAIIHE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0042426 [BP]	choline catabolic process	probable	GO:0009310, GO:0042402, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0071704, GO:0009987, GO:0009308, GO:0046164, GO:0044710, GO:0044106, GO:0042439, GO:0008152, GO:0009056, GO:1901564, GO:1901565, GO:0006576, GO:0019695, GO:0034641, GO:0044237, GO:0006066, GO:0008150, GO:1901616, GO:1901615
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DX4, chain A
Confidence level:very confident
Coverage over the Query: 1-192
View the alignment between query and template
View the model in PyMOL