BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15830
         (106 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2YEW|C Chain C, Modeling Barmah Forest Virus Structural Proteins
 pdb|2YEW|F Chain F, Modeling Barmah Forest Virus Structural Proteins
 pdb|2YEW|I Chain I, Modeling Barmah Forest Virus Structural Proteins
 pdb|2YEW|L Chain L, Modeling Barmah Forest Virus Structural Proteins
          Length = 421

 Score = 28.1 bits (61), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 70  LYKCQSMGLLPSHSSDWLSFVLPQTRIEYSSGGVVY 105
           L+  +S+G  PSHS +W+   + +T I+  + GV Y
Sbjct: 292 LFSIRSLGKDPSHSQEWIDTPMSKT-IQVGAEGVEY 326


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.141    0.415 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,709,727
Number of Sequences: 62578
Number of extensions: 83609
Number of successful extensions: 192
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 191
Number of HSP's gapped (non-prelim): 1
length of query: 106
length of database: 14,973,337
effective HSP length: 71
effective length of query: 35
effective length of database: 10,530,299
effective search space: 368560465
effective search space used: 368560465
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)