Diaphorina citri psyllid: psy15830

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MNVPMNIVIMYMAGNSISIFPIMMVGMLIVRPIKALFTLSSSFKMIEGHQVLGQKFIYFIGNIVNIVLALYKCQSMGLLPSHSSDWLSFVLPQTRIEYSSGGVVYS
cccHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECccccccc
*NVPMNIVIMYMAGNSISIFPIMMVGMLIVRPIKALFTLSSSFKMIEGHQVLGQKFIYFIGNIVNIVLALYKCQSMGLLPSHSSDWLSFVLPQTRIEYSSGGVVYS
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVPMNIVIMYMAGNSISIFPIMMVGMLIVRPIKALFTLSSSFKMIEGHQVLGQKFIYFIGNIVNIVLALYKCQSMGLLPSHSSDWLSFVLPQTRIEYSSGGVVYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ER membrane protein complex subunit 4 May mediate anti-apoptotic activity.confidentQ6PBF7
ER membrane protein complex subunit 4 May mediate anti-apoptotic activity.confidentQ5J8M3
ER membrane protein complex subunit 4 May mediate anti-apoptotic activity.confidentQ9CZX9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0072546 [CC]ER membrane protein complexprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0030176, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted