Query         psy15836
Match_columns 74
No_of_seqs    105 out of 185
Neff          5.0 
Searched_HMMs 46136
Date          Fri Aug 16 22:37:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15836.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15836hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3318|consensus              100.0 1.5E-31 3.2E-36  186.7   3.8   73    2-74      9-89  (178)
  2 PF06417 DUF1077:  Protein of u  99.9 7.3E-26 1.6E-30  151.4   3.0   39   36-74      7-45  (124)
  3 KOG0527|consensus               72.4     1.2 2.7E-05   34.1   0.1    8   57-64     66-73  (331)
  4 KOG3248|consensus               51.8     7.5 0.00016   30.8   1.0   15   52-66    190-204 (421)
  5 KOG0528|consensus               44.0     6.7 0.00015   32.0  -0.3    9   56-64    328-336 (511)
  6 KOG2601|consensus               32.2      34 0.00073   27.9   1.9   22   42-71     42-63  (503)
  7 PF06753 Bradykinin:  Bradykini  31.0      25 0.00054   16.5   0.6   11   17-27      4-14  (19)
  8 PHA00728 hypothetical protein   30.2      11 0.00024   25.9  -0.9   13   61-73     62-74  (151)
  9 PF13072 DUF3936:  Protein of u  25.2      37  0.0008   18.6   0.8   10   40-49     11-20  (38)
 10 PF04244 DPRP:  Deoxyribodipyri  18.5      54  0.0012   23.5   0.7   24    1-24    171-198 (224)

No 1  
>KOG3318|consensus
Probab=99.97  E-value=1.5e-31  Score=186.68  Aligned_cols=73  Identities=41%  Similarity=0.906  Sum_probs=61.3

Q ss_pred             ccceecCCc----CCCCCCCCCCCCCCCCCCCCc--ccccchh--hHHHHHHHHHhhccccchhhHHHHHHhcCCccccc
Q psy15836          2 KWSVDFTSR----AKSDLPAPPGYCPINNSVQSD--VTNQTDG--NLLIKKCWEVALAPIKQVPMNIVIMYMAGNSISIF   73 (74)
Q Consensus         2 kW~~dl~~~----~~~~lp~PpGy~~~~~~~~~~--~~~~~~~--~L~~kkaWeiA~~P~K~ipMn~fMmyMsGnsiqIF   73 (74)
                      +|+++|.+.    ++.++|+||||.++....++.  +.+++|+  +|+.|||||+|++|+||||||+|||||+|||||||
T Consensus         9 ~Wa~~~~~~~~~~nsd~~~~PpGf~~~s~~~~~s~~a~r~~d~~~~L~~kkaWdiAl~P~K~iPMN~FmmYMaGnsvsIF   88 (178)
T KOG3318|consen    9 DWAVEFSDQSTVPNSDSIPSPPGFSRKSLVQQTSAEADRKKDQEATLVLKKAWDIALGPLKNIPMNLFMMYMAGNSVSIF   88 (178)
T ss_pred             chHHHhCCcccCCcccCCCCCCCccccccccchHHHHhhhhhHHHHHHHHHHHHHhhChHhhccHHHHHHHHcCCceEEe
Confidence            799999995    467789999999887655432  2233333  59999999999999999999999999999999999


Q ss_pred             C
Q psy15836         74 W   74 (74)
Q Consensus        74 ~   74 (74)
                      |
T Consensus        89 p   89 (178)
T KOG3318|consen   89 P   89 (178)
T ss_pred             H
Confidence            7


No 2  
>PF06417 DUF1077:  Protein of unknown function (DUF1077);  InterPro: IPR009445 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=99.92  E-value=7.3e-26  Score=151.38  Aligned_cols=39  Identities=54%  Similarity=0.997  Sum_probs=36.7

Q ss_pred             chhhHHHHHHHHHhhccccchhhHHHHHHhcCCcccccC
Q psy15836         36 TDGNLLIKKCWEVALAPIKQVPMNIVIMYMAGNSISIFW   74 (74)
Q Consensus        36 ~~~~L~~kkaWeiA~~P~K~ipMn~fMmyMsGnsiqIF~   74 (74)
                      ++.+|+.|||||+|++|+||||||+||||||||||||||
T Consensus         7 ~~~~L~~KkAWeiA~~P~K~ipMn~FMmyMsGnsi~IFs   45 (124)
T PF06417_consen    7 QQDALKVKKAWEIALGPAKSIPMNLFMMYMSGNSIQIFS   45 (124)
T ss_pred             HHHHHHHHHHHHHHhhHHHhhhHHHHHHHHhCCcchhhh
Confidence            344699999999999999999999999999999999997


No 3  
>KOG0527|consensus
Probab=72.39  E-value=1.2  Score=34.12  Aligned_cols=8  Identities=38%  Similarity=0.966  Sum_probs=7.7

Q ss_pred             hhHHHHHH
Q psy15836         57 PMNIVIMY   64 (74)
Q Consensus        57 pMn~fMmy   64 (74)
                      |||+||.|
T Consensus        66 PMNAFMVW   73 (331)
T KOG0527|consen   66 PMNAFMVW   73 (331)
T ss_pred             Ccchhhhh
Confidence            99999998


No 4  
>KOG3248|consensus
Probab=51.83  E-value=7.5  Score=30.77  Aligned_cols=15  Identities=33%  Similarity=0.747  Sum_probs=11.2

Q ss_pred             cccchhhHHHHHHhc
Q psy15836         52 PIKQVPMNIVIMYMA   66 (74)
Q Consensus        52 P~K~ipMn~fMmyMs   66 (74)
                      |---=|.|+||.||-
T Consensus       190 phiKKPLNAFmlyMK  204 (421)
T KOG3248|consen  190 PHIKKPLNAFMLYMK  204 (421)
T ss_pred             ccccccHHHHHHHHH
Confidence            333448999999994


No 5  
>KOG0528|consensus
Probab=43.95  E-value=6.7  Score=31.99  Aligned_cols=9  Identities=33%  Similarity=0.785  Sum_probs=7.6

Q ss_pred             hhhHHHHHH
Q psy15836         56 VPMNIVIMY   64 (74)
Q Consensus        56 ipMn~fMmy   64 (74)
                      =|||+||.|
T Consensus       328 RPMNAFMVW  336 (511)
T KOG0528|consen  328 RPMNAFMVW  336 (511)
T ss_pred             CCcchhhcc
Confidence            389999988


No 6  
>KOG2601|consensus
Probab=32.25  E-value=34  Score=27.92  Aligned_cols=22  Identities=23%  Similarity=0.670  Sum_probs=19.4

Q ss_pred             HHHHHHHhhccccchhhHHHHHHhcCCccc
Q psy15836         42 IKKCWEVALAPIKQVPMNIVIMYMAGNSIS   71 (74)
Q Consensus        42 ~kkaWeiA~~P~K~ipMn~fMmyMsGnsiq   71 (74)
                      ..|.|+.+.+        +||-+|-|||+-
T Consensus        42 gdR~W~F~Vs--------L~M~~L~gnsl~   63 (503)
T KOG2601|consen   42 GDRMWEFSVS--------LFMILLGGNSLL   63 (503)
T ss_pred             hHhHHHHHHH--------HHHHHHcCceeh
Confidence            6799999986        899999999973


No 7  
>PF06753 Bradykinin:  Bradykinin;  InterPro: IPR009608 This family consists of several bradykinin sequences. The skins of anuran amphibians, in addition to mucus glands, contain highly specialised poison glands, which, in reaction to stress or attack, exude a complex noxious cocktail of biologically active molecules. These secretions often contain a plethora of peptides among which bradykinin or structural variants have been identified [].; GO: 0005179 hormone activity, 0006950 response to stress, 0005576 extracellular region
Probab=31.03  E-value=25  Score=16.46  Aligned_cols=11  Identities=36%  Similarity=1.066  Sum_probs=7.9

Q ss_pred             CCCCCCCCCCC
Q psy15836         17 APPGYCPINNS   27 (74)
Q Consensus        17 ~PpGy~~~~~~   27 (74)
                      .||||++-.++
T Consensus         4 ~p~gftpfrgk   14 (19)
T PF06753_consen    4 RPPGFTPFRGK   14 (19)
T ss_pred             cCCCCCccccc
Confidence            59999875443


No 8  
>PHA00728 hypothetical protein
Probab=30.24  E-value=11  Score=25.95  Aligned_cols=13  Identities=38%  Similarity=0.933  Sum_probs=10.5

Q ss_pred             HHHHhcCCccccc
Q psy15836         61 VIMYMAGNSISIF   73 (74)
Q Consensus        61 fMmyMsGnsiqIF   73 (74)
                      -|.|.|||.|+++
T Consensus        62 TMfYLsgnqisLI   74 (151)
T PHA00728         62 TMFYLSGNQISLI   74 (151)
T ss_pred             ceEEecCCchhhH
Confidence            3789999998864


No 9  
>PF13072 DUF3936:  Protein of unknown function (DUF3936)
Probab=25.19  E-value=37  Score=18.61  Aligned_cols=10  Identities=40%  Similarity=1.092  Sum_probs=7.4

Q ss_pred             HHHHHHHHHh
Q psy15836         40 LLIKKCWEVA   49 (74)
Q Consensus        40 L~~kkaWeiA   49 (74)
                      ..+-|||||-
T Consensus        11 ~lvGKAWeIr   20 (38)
T PF13072_consen   11 ILVGKAWEIR   20 (38)
T ss_pred             EEEehHHHHH
Confidence            4466999985


No 10 
>PF04244 DPRP:  Deoxyribodipyrimidine photo-lyase-related protein;  InterPro: IPR007357 This family appears to be related to DNA photolyases.; PDB: 3ZXS_A.
Probab=18.51  E-value=54  Score=23.55  Aligned_cols=24  Identities=33%  Similarity=0.685  Sum_probs=8.1

Q ss_pred             CccceecCCc----CCCCCCCCCCCCCC
Q psy15836          1 MKWSVDFTSR----AKSDLPAPPGYCPI   24 (74)
Q Consensus         1 ~kW~~dl~~~----~~~~lp~PpGy~~~   24 (74)
                      .||++|-.++    +...+|.|+-|.+.
T Consensus       171 GkWnfD~eNRk~~p~~~~~P~~~~~~~d  198 (224)
T PF04244_consen  171 GKWNFDAENRKKLPKGIPIPEPPRFEPD  198 (224)
T ss_dssp             GSS--GGGS-------TTS---------
T ss_pred             CcCCCChhhccCCCCCCCCCCCCCCCCC
Confidence            3899999997    35578888877654


Done!