Diaphorina citri psyllid: psy15840


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MHVPAITLQQVLAGEVLTELEEFDFKQTNQDPREEFDTNYDSNYDRQYCDSISNEDMLTVPREFKPILISHASSNPRRRRRNSAPSGSVPPPQVMKKRRLAANARERRRMSGLNEAFDRLREVIPCIGIEHKLSKFETLQMAQTYIHSLRDLLTSANSGCR
ccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccc
*****ITLQQVLAGEVLTELEEFD*******************YD***C******************************************************ARERRRMSGLNEAFDRLREVIPCIGIEHKLSKFETLQMAQTYIHSLRDLL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHVPAITLQQVLAGEVLTELEEFDFKQTNQDPREEFDTNYDSNYDRQYCDSISNEDMLTVPREFKPILISHASSNPRRRRRNSAPSGSVPPPQVMKKRRLAANARERRRMSGLNEAFDRLREVIPCIGIEHKLSKFETLQMAQTYIHSLRDLLTSANSGCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein atonal homolog 1 Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.confidentQ5IS79
Protein lin-32 Essential for the specification of the neuroblast cell fate in the development of peripheral sense organs.confidentQ10574
Protein atonal homolog 1 Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.confidentQ92858

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QL2, chain B
Confidence level:very confident
Coverage over the Query: 98-155
View the alignment between query and template
View the model in PyMOL