Query         psy15848
Match_columns 158
No_of_seqs    21 out of 23
Neff          2.2 
Searched_HMMs 46136
Date          Fri Aug 16 22:54:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15848.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15848hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4542|consensus               25.7      18 0.00039   27.8  -0.5   11  135-145    76-86  (96)
  2 KOG0608|consensus               17.1   4E+02  0.0086   27.6   6.4   47   49-98    438-484 (1034)
  3 PF10161 DDDD:  Putative mitoch  11.9      36 0.00078   25.3  -1.7   10  135-144    59-68  (79)
  4 COG5567 Predicted small peripl  11.1      91   0.002   22.2   0.2    9  135-143    23-31  (58)
  5 PF06553 BNIP3:  BNIP3;  InterP   9.4   1E+02  0.0022   26.0   0.0   24  112-135    64-88  (197)
  6 PF15429 DUF4628:  Domain of un   8.3 3.3E+02  0.0072   24.4   2.6   30   95-124   117-157 (273)
  7 PHA01076 putative encapsidatio   4.8 3.2E+02   0.007   25.2   0.7   12   72-83    159-170 (378)
  8 PF12441 DUF3680:  Protein of u   4.7 2.8E+02  0.0061   18.0   0.2    8   70-77     31-38  (42)
  9 PF06566 Chon_Sulph_att:  Chond   4.7 8.5E+02   0.018   21.7   3.1   33   48-80    114-149 (253)
 10 PF12431 CitT:  Transcriptional   4.6 3.8E+02  0.0082   16.0   0.7    7  131-137    21-27  (30)

No 1  
>KOG4542|consensus
Probab=25.73  E-value=18  Score=27.84  Aligned_cols=11  Identities=36%  Similarity=0.135  Sum_probs=9.4

Q ss_pred             CCcccCCCCCh
Q psy15848        135 KGASYLEPNMP  145 (158)
Q Consensus       135 kGaayle~~~~  145 (158)
                      +||+|||||+-
T Consensus        76 n~A~~LEENdi   86 (96)
T KOG4542|consen   76 NFAALLEENDI   86 (96)
T ss_pred             hHHHhhhhccc
Confidence            68999999963


No 2  
>KOG0608|consensus
Probab=17.08  E-value=4e+02  Score=27.65  Aligned_cols=47  Identities=23%  Similarity=0.487  Sum_probs=30.8

Q ss_pred             CCCCCCcccCCCCCCCcccccccccccCCCCCCCCCccCCCCCCCCCCCC
Q psy15848         49 SEPPVPVWTPKSAPSSPSAQRKFQPVNFKSPTLPRKATGTPNAARKPESP   98 (158)
Q Consensus        49 ~~P~~PVWTP~sA~~SP~~eREFRPV~FESPtLsRr~~~~~~~~~~~~~p   98 (158)
                      --|..|.|-|+.   +.+.++.|||+.|.+=.+---..+....-.+++++
T Consensus       438 ~~p~hp~~ipq~---~~a~~~d~rp~~~~~r~~e~~~la~~p~~~~PPp~  484 (1034)
T KOG0608|consen  438 QQPLHPRWIPQP---SDANHPDPRPILFKPRNLEITMLARAPSEQPPPPP  484 (1034)
T ss_pred             ccccCccccCCc---cccCCCCccccccccchhhhhhhhcCCccCCCCCC
Confidence            457789999998   88888899999997755443333333322334433


No 3  
>PF10161 DDDD:  Putative mitochondrial precursor protein;  InterPro: IPR018782 This entry represents a family of small conserved proteins found from nematodes to humans. The C-terminal region is rich in asparagine. These proteins have been putatively designated as mitochondrial precursor proteins but this has not been confirmed. 
Probab=11.90  E-value=36  Score=25.26  Aligned_cols=10  Identities=50%  Similarity=0.767  Sum_probs=7.9

Q ss_pred             CCcccCCCCC
Q psy15848        135 KGASYLEPNM  144 (158)
Q Consensus       135 kGaayle~~~  144 (158)
                      +||+|||+|+
T Consensus        59 ~~A~fLEe~d   68 (79)
T PF10161_consen   59 NGAQFLEEND   68 (79)
T ss_pred             HHHHHHHHhc
Confidence            5788888875


No 4  
>COG5567 Predicted small periplasmic lipoprotein [Cell motility and secretion]
Probab=11.13  E-value=91  Score=22.22  Aligned_cols=9  Identities=44%  Similarity=0.910  Sum_probs=7.0

Q ss_pred             CCcccCCCC
Q psy15848        135 KGASYLEPN  143 (158)
Q Consensus       135 kGaayle~~  143 (158)
                      ||..||-..
T Consensus        23 KGPLy~Ppa   31 (58)
T COG5567          23 KGPLYFPPA   31 (58)
T ss_pred             CCCccCChh
Confidence            899998653


No 5  
>PF06553 BNIP3:  BNIP3;  InterPro: IPR010548 This family consists of several mammalian specific BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 or BNIP3 sequences. BNIP3 belongs to the Bcl-2 homology 3 (BH3)-only family, a Bcl-2-related family possessing an atypical Bcl-2 homology 3 (BH3) domain, which regulates PCD from mitochondrial sites by selective Bcl-2/Bcl-XL interactions. BNIP3 family members contain a C-terminal transmembrane domain that is required for their mitochondrial localisation, homodimerisation, as well as regulation of their pro-apoptotic activities. BNIP3-mediated apoptosis has been reported to be independent of caspase activation and cytochrome c release and is characterised by early plasma membrane and mitochondrial damage, prior to the appearance of chromatin condensation or DNA fragmentation [].; GO: 0043065 positive regulation of apoptosis, 0005740 mitochondrial envelope, 0016021 integral to membrane; PDB: 2KA1_B 2KA2_A 2J5D_A.
Probab=9.44  E-value=1e+02  Score=26.05  Aligned_cols=24  Identities=33%  Similarity=0.527  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCC-CCCCCCCC
Q psy15848        112 SPAPSHCNVIPPPTPP-PSQGQIPK  135 (158)
Q Consensus       112 ~s~~s~~~~lp~~qnP-areGQlPk  135 (158)
                      +.++|+||..++++.| ...||+.-
T Consensus        64 sr~sS~~dSP~~s~~p~~~~~~~~~   88 (197)
T PF06553_consen   64 SRGSSHCDSPPRSPSPPQNSPQIEF   88 (197)
T ss_dssp             -------------------------
T ss_pred             cCCCCcCCCCCCCCCCCCcCCCccc
Confidence            3377999999988877 55777754


No 6  
>PF15429 DUF4628:  Domain of unknown function (DUF4628)
Probab=8.35  E-value=3.3e+02  Score=24.43  Aligned_cols=30  Identities=33%  Similarity=0.411  Sum_probs=18.9

Q ss_pred             CCCCCCCCCCCCc-----------ccCCCCCCCCCCCCCCC
Q psy15848         95 PESPTVTKPPTPR-----------SLPVSPAPSHCNVIPPP  124 (158)
Q Consensus        95 ~~~p~~t~~~t~~-----------s~p~~s~~s~~~~lp~~  124 (158)
                      -++|+.|+++|+|           +-||+|+.-+...++..
T Consensus       117 DPPPP~tkKRtPRALKTTQDMlISsqPVlSS~E~~~e~~~~  157 (273)
T PF15429_consen  117 DPPPPITKKRTPRALKTTQDMLISSQPVLSSLEYGTESSPG  157 (273)
T ss_pred             CCCCCcccccCcchhcchhhheeccCccccccccCCcCCcC
Confidence            4577788888777           44567666555444433


No 7  
>PHA01076 putative encapsidation protein
Probab=4.75  E-value=3.2e+02  Score=25.16  Aligned_cols=12  Identities=50%  Similarity=0.811  Sum_probs=10.2

Q ss_pred             ccccCCCCCCCC
Q psy15848         72 QPVNFKSPTLPR   83 (158)
Q Consensus        72 RPV~FESPtLsR   83 (158)
                      -||+|.||.|+-
T Consensus       159 N~VNF~SPIL~~  170 (378)
T PHA01076        159 NAVNFSSPILSN  170 (378)
T ss_pred             CcccCCCcccch
Confidence            489999999984


No 8  
>PF12441 DUF3680:  Protein of unknown function (DUF3680) ;  InterPro: IPR022148  This domain family is found in bacteria and archaea, and is approximately 40 amino acids in length. 
Probab=4.74  E-value=2.8e+02  Score=18.04  Aligned_cols=8  Identities=50%  Similarity=0.837  Sum_probs=5.0

Q ss_pred             ccccccCC
Q psy15848         70 KFQPVNFK   77 (158)
Q Consensus        70 EFRPV~FE   77 (158)
                      +|++|+|+
T Consensus        31 ~~~~v~f~   38 (42)
T PF12441_consen   31 KAKPVRFP   38 (42)
T ss_pred             cCeeeecc
Confidence            46666665


No 9  
>PF06566 Chon_Sulph_att:  Chondroitin sulphate attachment domain;  InterPro: IPR010555 This family represents the chondroitin sulphate attachment domain of vertebrate neural transmembrane proteoglycans that contain EGF modules. Evidence has been accumulated to support the idea that neural proteoglycans are involved in various cellular events including mitogenesis, differentiation, axonal outgrowth and synaptogenesis []. This domain contains several potential sites of chondroitin sulphate attachment, as well as potential sites of N-linked glycosylation [].
Probab=4.70  E-value=8.5e+02  Score=21.66  Aligned_cols=33  Identities=33%  Similarity=0.435  Sum_probs=24.2

Q ss_pred             CCCCCCCcccCCCCCCCccccc--cccc-ccCCCCC
Q psy15848         48 SSEPPVPVWTPKSAPSSPSAQR--KFQP-VNFKSPT   80 (158)
Q Consensus        48 ~~~P~~PVWTP~sA~~SP~~eR--EFRP-V~FESPt   80 (158)
                      ..++.-|-||..|.++||.+.-  .-.| |.=|||.
T Consensus       114 ~~pp~~pe~~eas~PPSpt~g~~~s~~Pelpkespl  149 (253)
T PF06566_consen  114 SVPPATPEATEASEPPSPTPGDKPSPGPELPKESPL  149 (253)
T ss_pred             CCCCCCCCccccCCCCCCCCCCCCCccccCcccCce
Confidence            4788899999999999998873  4444 4444443


No 10 
>PF12431 CitT:  Transcriptional regulator 
Probab=4.58  E-value=3.8e+02  Score=16.04  Aligned_cols=7  Identities=43%  Similarity=0.956  Sum_probs=5.6

Q ss_pred             CCCCCCc
Q psy15848        131 GQIPKGA  137 (158)
Q Consensus       131 GQlPkGa  137 (158)
                      +.||||.
T Consensus        21 ~~LPKGI   27 (30)
T PF12431_consen   21 ERLPKGI   27 (30)
T ss_pred             cCCCCCc
Confidence            6699996


Done!