Diaphorina citri psyllid: psy15892

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MGMSESDSSSLGSMELEGEGAGGVYIDSDTGLESMSSAETPSKPCGLCMDGNASDLYRQEVTQLKCDKLDLLRQNVVSRL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHccccc
*********************************************GLCMDGNASDLYRQEVTQLKCDKLDLLRQNVVSR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMSESDSSSLGSMELEGEGAGGVYIDSDTGLESMSSAETPSKPCGLCMDGNASDLYRQEVTQLKCDKLDLLRQNVVSRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032861 [BP]activation of Rap GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0046578, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0032317, GO:0030811, GO:0008150, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0032854, GO:0032856, GO:0032487, GO:0051171, GO:0009118, GO:0051336, GO:0051174, GO:1900542, GO:0032320, GO:0031329, GO:0006140
GO:0046582 [MF]Rap GTPase activator activityprobableGO:0005099, GO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted