Query         psy15893
Match_columns 80
No_of_seqs    19 out of 21
Neff          2.4 
Searched_HMMs 46136
Date          Sat Aug 17 00:19:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15893.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15893hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3686|consensus               96.5 0.00065 1.4E-08   59.0   0.0   77    2-79    597-697 (740)
  2 PF12107 VEK-30:  Plasminogen (  69.7     3.3 7.2E-05   21.0   1.3   12   59-70      3-14  (17)
  3 PF08776 VASP_tetra:  VASP tetr  65.4     7.8 0.00017   23.2   2.5   23   54-76     13-35  (40)
  4 PRK06835 DNA replication prote  61.6     7.3 0.00016   30.3   2.4   23   53-75     66-88  (329)
  5 KOG4049|consensus               56.1     4.1   9E-05   32.2   0.2   16   25-40    141-156 (248)
  6 PF11807 DUF3328:  Domain of un  51.1     7.6 0.00016   25.7   0.8   26   54-79    134-177 (217)
  7 PF04880 NUDE_C:  NUDE protein,  48.3     6.9 0.00015   28.7   0.4   17   55-71     27-43  (166)
  8 KOG1574|consensus               47.3      15 0.00032   30.5   2.1   21   22-42    347-367 (375)
  9 PHA03155 hypothetical protein;  35.7      56  0.0012   23.2   3.3   23   52-74      8-30  (115)
 10 PF14122 YokU:  YokU-like prote  33.0      31 0.00066   23.6   1.6   41   22-62     15-55  (87)
 11 PHA03162 hypothetical protein;  31.5      53  0.0012   24.0   2.7   23   52-74     13-35  (135)
 12 KOG2492|consensus               31.4      18 0.00039   31.4   0.3   35   43-77    232-277 (552)
 13 KOG3863|consensus               29.8      39 0.00085   29.6   2.1   21   54-74    513-533 (604)
 14 PF08265 YL1_C:  YL1 nuclear pr  29.8      32  0.0007   18.9   1.1   12   21-32      8-19  (30)
 15 PF08432 Vfa1:  AAA-ATPase Vps4  29.5      54  0.0012   23.4   2.4   14   54-67     64-77  (182)
 16 COG0437 HybA Fe-S-cluster-cont  28.6      30 0.00066   26.0   1.1   38   22-68    115-173 (203)
 17 PF13062 DUF3924:  Protein of u  27.8      13 0.00028   24.0  -0.9   16   60-75      7-22  (62)
 18 COG1031 Uncharacterized Fe-S o  27.7      46 0.00099   29.1   2.1   21   44-64    200-227 (560)
 19 PF05812 Herpes_BLRF2:  Herpesv  25.4      71  0.0015   22.6   2.4   22   53-74      4-25  (118)
 20 PF14738 PaaSYMP:  Solute carri  25.1      52  0.0011   23.6   1.7   18   58-75     93-110 (154)
 21 PF06005 DUF904:  Protein of un  25.1      82  0.0018   20.0   2.5   15   55-69     21-35  (72)
 22 cd07660 BAR_Arfaptin The Bin/A  24.0      59  0.0013   24.5   1.9   17   55-75    151-167 (201)
 23 PRK06921 hypothetical protein;  23.6      68  0.0015   23.9   2.1   22   55-76      4-25  (266)
 24 PF00170 bZIP_1:  bZIP transcri  22.7   1E+02  0.0023   18.1   2.5   21   55-75     43-63  (64)
 25 PF04508 Pox_A_type_inc:  Viral  22.6      53  0.0011   17.5   1.0   16   59-74      1-16  (23)
 26 PF02183 HALZ:  Homeobox associ  22.5   1E+02  0.0022   18.1   2.3   18   55-72     15-32  (45)
 27 PF11388 DotA:  Phagosome traff  22.2      38 0.00082   23.9   0.5    9   26-34      1-9   (105)
 28 PF00990 GGDEF:  GGDEF domain;   22.1      40 0.00087   20.3   0.6    8   25-32      2-9   (161)
 29 cd00011 BAR_Arfaptin_like The   21.9      71  0.0015   24.1   2.0   18   54-75    153-170 (203)
 30 PF14354 Lar_restr_allev:  Rest  21.7      39 0.00085   19.4   0.5    6   43-48      4-9   (61)
 31 PRK13922 rod shape-determining  20.6      95  0.0021   22.7   2.4   16   54-69     78-93  (276)
 32 COG0621 MiaB 2-methylthioadeni  20.6      75  0.0016   26.3   2.0   23   43-65    156-186 (437)
 33 PF04325 DUF465:  Protein of un  20.3      74  0.0016   18.2   1.4   13   59-71     27-39  (49)
 34 PRK14862 rimO ribosomal protei  20.2      85  0.0019   24.9   2.2   24   43-66    151-182 (440)
 35 PRK14332 (dimethylallyl)adenos  20.0      91   0.002   25.0   2.3   24   43-66    166-197 (449)

No 1  
>KOG3686|consensus
Probab=96.51  E-value=0.00065  Score=59.04  Aligned_cols=77  Identities=13%  Similarity=0.056  Sum_probs=59.6

Q ss_pred             CCCCCCCC-CCCcccccCCCC----CCccccCCccccccccCCCC----CCCcccccCCC---------------chHHH
Q psy15893          2 GMSESDSS-SLGSMELEGEGA----GGVYIDSDTGLESMSSAETP----SKPCGLCMDGN---------------ASDLY   57 (80)
Q Consensus         2 ~~~~sD~S-Sl~S~dl~~~~~----~~~~~DSDTGlESMSSae~~----~~~Cs~C~d~~---------------~~e~L   57 (80)
                      +++..+.. ....++.++.++    ++.++++++|+++|++.+.+    ++.|..|....               ..+.+
T Consensus       597 ~~~r~~~~~~~fhv~~e~~~~~~e~~~~~~~a~lg~~~~~~~~~~~~Tla~~~~~~l~~~s~~v~~~~~~~~d~~~~r~~  676 (740)
T KOG3686|consen  597 ALYRADAEAVGFHVSTEGNGDVQEKWKHAGNAELGSRENTRKKYTRETLATKFCDVLLVLSQVVDKMVRPPVDTASPREF  676 (740)
T ss_pred             eecccccccccceecccccceeeccccccccccccceeeeehhhhhhhhhhhhhhhhhhhhhccceeecCcccccchhhc
Confidence            45553333 344677776554    78889999999999999988    46777776432               35999


Q ss_pred             HHHHHHhhchhHHHhhhhcccc
Q psy15893         58 RQEVTQLKCDKLDLLRQNVVSR   79 (80)
Q Consensus        58 ~~eV~rLk~dKldLLrQNVscq   79 (80)
                      +.|+++|++.+++++ ||++|+
T Consensus       677 ~~e~~~l~~~e~~~~-~~~~~~  697 (740)
T KOG3686|consen  677 CPEFDGLTMSELSQL-RLTVIN  697 (740)
T ss_pred             ccccCcccccccchh-cCCccc
Confidence            999999999999999 888886


No 2  
>PF12107 VEK-30:  Plasminogen (Pg) ligand in fibrinolytic pathway;  InterPro: IPR021965  Pg is an important mediator of angiostatin production in the fibrinolytic pathway. Pg is made up of five subunit kringle molecules (Pg-K1 to Pg-K5), of which the first three make the protein angiostatin. VEK-30 is a domain of the group A streptococcal protein PAM. It binds to Pg-K2 of angiostatin and activates the molecule to mediate its anti-angiogenic effects. VEK-30 binds to angiostatin via a C-terminal lysine with argininyl and glutamyl side chain residues known as a 'through space isostere' [].; PDB: 2KJ4_B 2DOI_B 2DOH_C 1I5K_D.
Probab=69.65  E-value=3.3  Score=21.03  Aligned_cols=12  Identities=33%  Similarity=0.562  Sum_probs=10.5

Q ss_pred             HHHHHhhchhHH
Q psy15893         59 QEVTQLKCDKLD   70 (80)
Q Consensus        59 ~eV~rLk~dKld   70 (80)
                      .|+.|||+|++|
T Consensus         3 aeLerLknerH~   14 (17)
T PF12107_consen    3 AELERLKNERHD   14 (17)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHhccc
Confidence            588999999886


No 3  
>PF08776 VASP_tetra:  VASP tetramerisation domain;  InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein. This region corresponds to the tetramerisation domain which forms a right handed alpha helical coiled coil structure []. ; PDB: 1USE_A 1USD_A.
Probab=65.40  E-value=7.8  Score=23.19  Aligned_cols=23  Identities=22%  Similarity=0.430  Sum_probs=20.1

Q ss_pred             hHHHHHHHHHhhchhHHHhhhhc
Q psy15893         54 SDLYRQEVTQLKCDKLDLLRQNV   76 (80)
Q Consensus        54 ~e~L~~eV~rLk~dKldLLrQNV   76 (80)
                      ++.+|.|+.+.|.|-.|-+||-.
T Consensus        13 L~EvrkEl~K~K~EIIeA~~~eL   35 (40)
T PF08776_consen   13 LEEVRKELQKVKEEIIEAIRQEL   35 (40)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            47889999999999999999854


No 4  
>PRK06835 DNA replication protein DnaC; Validated
Probab=61.64  E-value=7.3  Score=30.27  Aligned_cols=23  Identities=26%  Similarity=0.439  Sum_probs=21.4

Q ss_pred             chHHHHHHHHHhhchhHHHhhhh
Q psy15893         53 ASDLYRQEVTQLKCDKLDLLRQN   75 (80)
Q Consensus        53 ~~e~L~~eV~rLk~dKldLLrQN   75 (80)
                      ..+.|++++..|+.+|.+||++|
T Consensus        66 ~~~~l~~~~~~l~~~~~~lL~~~   88 (329)
T PRK06835         66 TLKELKEKITDLRVKKAELLVSN   88 (329)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHc
Confidence            46999999999999999999987


No 5  
>KOG4049|consensus
Probab=56.11  E-value=4.1  Score=32.18  Aligned_cols=16  Identities=50%  Similarity=0.609  Sum_probs=13.1

Q ss_pred             cccCCccccccccCCC
Q psy15893         25 YIDSDTGLESMSSAET   40 (80)
Q Consensus        25 ~~DSDTGlESMSSae~   40 (80)
                      .-|||+|+|+||-.-.
T Consensus       141 vrDSdsGlekMsIGHh  156 (248)
T KOG4049|consen  141 VRDSDSGLEKMSIGHH  156 (248)
T ss_pred             hhccccchhhhccccc
Confidence            3599999999997654


No 6  
>PF11807 DUF3328:  Domain of unknown function (DUF3328);  InterPro: IPR021765  This family of proteins are functionally uncharacterised. This family is only found in eukaryotes. 
Probab=51.06  E-value=7.6  Score=25.67  Aligned_cols=26  Identities=23%  Similarity=0.381  Sum_probs=19.0

Q ss_pred             hHHHHHHHHHhhc------h----h--------HHHhhhhcccc
Q psy15893         54 SDLYRQEVTQLKC------D----K--------LDLLRQNVVSR   79 (80)
Q Consensus        54 ~e~L~~eV~rLk~------d----K--------ldLLrQNVscq   79 (80)
                      +..||+.+-+..-      +    .        +|.|||+|-|.
T Consensus       134 L~~lR~~~~~~~~~~~~~~~~~~~~~~~H~~HC~d~LRq~imC~  177 (217)
T PF11807_consen  134 LNMLRKAYYPDYYYYPNMTEDPPEEDREHIDHCLDYLRQSIMCH  177 (217)
T ss_pred             hHHHHHHHHHhhhccccccccccccccchhHHHHHHHHHHhhcc
Confidence            4788888855543      1    1        79999999996


No 7  
>PF04880 NUDE_C:  NUDE protein, C-terminal conserved region;  InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins. Emericella nidulans (Aspergillus nidulans) NUDE, acts in the cytoplasmic dynein/dynactin pathway and is required for distribution of nuclei []. It is a homologue of the nuclear distribution protein RO11 of Neurospora crassa. NUDE interacts with the NUDF via an N-terminal coiled coil domain; this is the only domain which is absolutely required for NUDE function.; PDB: 2V66_B 2V71_B.
Probab=48.28  E-value=6.9  Score=28.69  Aligned_cols=17  Identities=41%  Similarity=0.505  Sum_probs=6.6

Q ss_pred             HHHHHHHHHhhchhHHH
Q psy15893         55 DLYRQEVTQLKCDKLDL   71 (80)
Q Consensus        55 e~L~~eV~rLk~dKldL   71 (80)
                      |.|+.+|.|||-|--||
T Consensus        27 E~L~~~~QRLkDE~RDL   43 (166)
T PF04880_consen   27 ENLREEVQRLKDELRDL   43 (166)
T ss_dssp             HHHHHCH----------
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            88999999999997776


No 8  
>KOG1574|consensus
Probab=47.28  E-value=15  Score=30.54  Aligned_cols=21  Identities=48%  Similarity=0.596  Sum_probs=17.5

Q ss_pred             CCccccCCccccccccCCCCC
Q psy15893         22 GGVYIDSDTGLESMSSAETPS   42 (80)
Q Consensus        22 ~~~~~DSDTGlESMSSae~~~   42 (80)
                      |.+-.|||||++||+|..++.
T Consensus       347 p~~~~~~~~~~~~~~s~ds~~  367 (375)
T KOG1574|consen  347 PRNDTDSDTGLSSLHSQDSPS  367 (375)
T ss_pred             CCCCcccccchhhhcccCCcc
Confidence            455579999999999998864


No 9  
>PHA03155 hypothetical protein; Provisional
Probab=35.71  E-value=56  Score=23.25  Aligned_cols=23  Identities=17%  Similarity=0.297  Sum_probs=18.5

Q ss_pred             CchHHHHHHHHHhhchhHHHhhh
Q psy15893         52 NASDLYRQEVTQLKCDKLDLLRQ   74 (80)
Q Consensus        52 ~~~e~L~~eV~rLk~dKldLLrQ   74 (80)
                      ...|.|..|++||+.|-..|=||
T Consensus         8 ~tvEeLaaeL~kL~~ENK~LKkk   30 (115)
T PHA03155          8 ADVEELEKELQKLKIENKALKKK   30 (115)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH
Confidence            35699999999999997776443


No 10 
>PF14122 YokU:  YokU-like protein
Probab=32.95  E-value=31  Score=23.56  Aligned_cols=41  Identities=22%  Similarity=0.344  Sum_probs=32.2

Q ss_pred             CCccccCCccccccccCCCCCCCcccccCCCchHHHHHHHH
Q psy15893         22 GGVYIDSDTGLESMSSAETPSKPCGLCMDGNASDLYRQEVT   62 (80)
Q Consensus        22 ~~~~~DSDTGlESMSSae~~~~~Cs~C~d~~~~e~L~~eV~   62 (80)
                      ..+|++...|.-+.-=.++|+-.|+.|----+.+....||+
T Consensus        15 ~tvyWeLpdGtraIeI~~tP~i~C~~CgmvYq~d~vi~EIE   55 (87)
T PF14122_consen   15 STVYWELPDGTRAIEITDTPAIICSNCGMVYQDDEVIKEIE   55 (87)
T ss_pred             ceEEEEcCCCceEEEecCCceeeecCCCcEEehhHHHHHHh
Confidence            57899999999988889999988888875445566666664


No 11 
>PHA03162 hypothetical protein; Provisional
Probab=31.48  E-value=53  Score=23.99  Aligned_cols=23  Identities=13%  Similarity=0.237  Sum_probs=18.8

Q ss_pred             CchHHHHHHHHHhhchhHHHhhh
Q psy15893         52 NASDLYRQEVTQLKCDKLDLLRQ   74 (80)
Q Consensus        52 ~~~e~L~~eV~rLk~dKldLLrQ   74 (80)
                      ...|.|..|++||+.|-..|=||
T Consensus        13 ~tmEeLaaeL~kLqmENK~LKkk   35 (135)
T PHA03162         13 PTMEDLAAEIAKLQLENKALKKK   35 (135)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH
Confidence            35799999999999998777443


No 12 
>KOG2492|consensus
Probab=31.42  E-value=18  Score=31.40  Aligned_cols=35  Identities=29%  Similarity=0.393  Sum_probs=26.3

Q ss_pred             CCcccccCCC--------chHHHHHHHHHhhch---hHHHhhhhcc
Q psy15893         43 KPCGLCMDGN--------ASDLYRQEVTQLKCD---KLDLLRQNVV   77 (80)
Q Consensus        43 ~~Cs~C~d~~--------~~e~L~~eV~rLk~d---KldLLrQNVs   77 (80)
                      +-|++|+-|+        -.+.+..||.+|.-.   -.-||-|||-
T Consensus       232 NMCtyCiVpftrGreRsrpi~siv~ev~~L~~qG~KeVTLLGQNVN  277 (552)
T KOG2492|consen  232 NMCTYCIVPFTRGRERSRPIESIVEEVKRLAEQGVKEVTLLGQNVN  277 (552)
T ss_pred             cccceEEEeccCCcccCCchHHHHHHHHHHhhcCceeeeeeccccc
Confidence            5899999643        259999999998732   2458999984


No 13 
>KOG3863|consensus
Probab=29.81  E-value=39  Score=29.59  Aligned_cols=21  Identities=33%  Similarity=0.351  Sum_probs=17.8

Q ss_pred             hHHHHHHHHHhhchhHHHhhh
Q psy15893         54 SDLYRQEVTQLKCDKLDLLRQ   74 (80)
Q Consensus        54 ~e~L~~eV~rLk~dKldLLrQ   74 (80)
                      .-+|..||.+|+++|-.|||.
T Consensus       513 I~nLE~ev~~l~~eKeqLl~E  533 (604)
T KOG3863|consen  513 ILNLEDEVEKLQKEKEQLLRE  533 (604)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            378889999999999888874


No 14 
>PF08265 YL1_C:  YL1 nuclear protein C-terminal domain;  InterPro: IPR013272 This domain is found at the C terminus in proteins of the YL1 family []. These proteins have been shown to be DNA-binding and may be transcription factors []. This domain is also found in proteins that do not belong to the YL1 family.
Probab=29.77  E-value=32  Score=18.94  Aligned_cols=12  Identities=42%  Similarity=0.551  Sum_probs=10.3

Q ss_pred             CCCccccCCccc
Q psy15893         21 AGGVYIDSDTGL   32 (80)
Q Consensus        21 ~~~~~~DSDTGl   32 (80)
                      .+|.|.|+-||+
T Consensus         8 lpA~Y~DP~T~l   19 (30)
T PF08265_consen    8 LPARYRDPKTGL   19 (30)
T ss_pred             CCccccCCCCCC
Confidence            468999999997


No 15 
>PF08432 Vfa1:  AAA-ATPase Vps4-associated protein 1;  InterPro: IPR013640 This is a family of fungal proteins of unknown function. 
Probab=29.47  E-value=54  Score=23.43  Aligned_cols=14  Identities=14%  Similarity=0.309  Sum_probs=10.5

Q ss_pred             hHHHHHHHHHhhch
Q psy15893         54 SDLYRQEVTQLKCD   67 (80)
Q Consensus        54 ~e~L~~eV~rLk~d   67 (80)
                      .+.|..||.+++-+
T Consensus        64 ~~el~~eiekvkke   77 (182)
T PF08432_consen   64 KKELEEEIEKVKKE   77 (182)
T ss_pred             HHHHHHHHHHHHHH
Confidence            37888888888654


No 16 
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]
Probab=28.62  E-value=30  Score=26.01  Aligned_cols=38  Identities=26%  Similarity=0.519  Sum_probs=27.1

Q ss_pred             CCccccCCccccccccCCCCCCCcccccCC--------------------CchHHHHH-HHHHhhchh
Q psy15893         22 GGVYIDSDTGLESMSSAETPSKPCGLCMDG--------------------NASDLYRQ-EVTQLKCDK   68 (80)
Q Consensus        22 ~~~~~DSDTGlESMSSae~~~~~Cs~C~d~--------------------~~~e~L~~-eV~rLk~dK   68 (80)
                      |+.++|.++|.         ...|.||++.                    ...+.++. +|.+++-++
T Consensus       115 ga~~~~~~~~~---------~~KCt~C~~ri~~g~~PaCV~~CP~~A~~fG~~~d~~~~~v~~~~~~~  173 (203)
T COG0437         115 GAPQFNPDKGV---------VDKCTFCVDRVAVGKLPACVEACPTGALIFGDIDDPKSKRVAELKPEG  173 (203)
T ss_pred             CCceeCcccCc---------ccccCcchhhHhcCCCCcccccCCcccccccchhhcchhhhhhhcccC
Confidence            67888888886         3689999752                    13577777 787777655


No 17 
>PF13062 DUF3924:  Protein of unknown function (DUF3924)
Probab=27.80  E-value=13  Score=24.05  Aligned_cols=16  Identities=44%  Similarity=0.677  Sum_probs=11.1

Q ss_pred             HHHHhhchhHHHhhhh
Q psy15893         60 EVTQLKCDKLDLLRQN   75 (80)
Q Consensus        60 eV~rLk~dKldLLrQN   75 (80)
                      |+-+=-.||++||+|-
T Consensus         7 elpke~aekl~llkqa   22 (62)
T PF13062_consen    7 ELPKETAEKLDLLKQA   22 (62)
T ss_pred             eccHHHHHHHHHHHHH
Confidence            3334446899999985


No 18 
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion]
Probab=27.72  E-value=46  Score=29.13  Aligned_cols=21  Identities=24%  Similarity=0.493  Sum_probs=16.7

Q ss_pred             CcccccCCC-------chHHHHHHHHHh
Q psy15893         44 PCGLCMDGN-------ASDLYRQEVTQL   64 (80)
Q Consensus        44 ~Cs~C~d~~-------~~e~L~~eV~rL   64 (80)
                      .||||+++.       ..|....||.-|
T Consensus       200 gCSFCtEp~~g~~~~R~~e~Vv~EVkaL  227 (560)
T COG1031         200 GCSFCTEPVRGRPEFRPPEDVVEEVKAL  227 (560)
T ss_pred             CCccccCcCcCCcccCCHHHHHHHHHHH
Confidence            699999864       358888888766


No 19 
>PF05812 Herpes_BLRF2:  Herpesvirus BLRF2 protein;  InterPro: IPR008642 This family consists of several herpes virus BLRF2 tegument proteins.; PDB: 2OA5_B 2H3R_D.
Probab=25.44  E-value=71  Score=22.63  Aligned_cols=22  Identities=14%  Similarity=0.259  Sum_probs=18.0

Q ss_pred             chHHHHHHHHHhhchhHHHhhh
Q psy15893         53 ASDLYRQEVTQLKCDKLDLLRQ   74 (80)
Q Consensus        53 ~~e~L~~eV~rLk~dKldLLrQ   74 (80)
                      ..|.|..|++||+.|-..|=||
T Consensus         4 t~EeLaaeL~kLqmENk~LKkk   25 (118)
T PF05812_consen    4 TMEELAAELQKLQMENKALKKK   25 (118)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHH
Confidence            4689999999999998776544


No 20 
>PF14738 PaaSYMP:  Solute carrier (proton/amino acid symporter), TRAMD3 or PAT1
Probab=25.13  E-value=52  Score=23.63  Aligned_cols=18  Identities=28%  Similarity=0.595  Sum_probs=15.7

Q ss_pred             HHHHHHhhchhHHHhhhh
Q psy15893         58 RQEVTQLKCDKLDLLRQN   75 (80)
Q Consensus        58 ~~eV~rLk~dKldLLrQN   75 (80)
                      -.||.+|+..+|+||++-
T Consensus        93 E~eI~~lQe~RLell~~~  110 (154)
T PF14738_consen   93 EEEIQELQERRLELLKKM  110 (154)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            368999999999999874


No 21 
>PF06005 DUF904:  Protein of unknown function (DUF904);  InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA.; GO: 0000917 barrier septum formation, 0043093 cytokinesis by binary fission, 0005737 cytoplasm; PDB: 2JEE_A.
Probab=25.10  E-value=82  Score=20.01  Aligned_cols=15  Identities=27%  Similarity=0.217  Sum_probs=10.1

Q ss_pred             HHHHHHHHHhhchhH
Q psy15893         55 DLYRQEVTQLKCDKL   69 (80)
Q Consensus        55 e~L~~eV~rLk~dKl   69 (80)
                      ..|+.||.+||-++-
T Consensus        21 ~~Lq~e~eeLke~n~   35 (72)
T PF06005_consen   21 ALLQMENEELKEKNN   35 (72)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH
Confidence            567777777777633


No 22 
>cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin. The BAR domain of Arfaptin-like proteins, also called the Arfaptin domain, is a dimerization and lipid binding module that can detect and drive membrane curvature. Arfaptins are ubiquitously expressed proteins implicated in mediating cross-talk between Rac, a member of the Rho family GTPases, and Arf (ADP-ribosylation factor) small GTPases. Arfaptins bind to GTP-bound Arf1, Arf5, and Arf6, with strongest binding to GTP-Arf1. Arfaptins also bind to Rac-GTP and Rac-GDP with similar affinities. The Arfs are thought to bind to the same surface as Rac, and their binding is mutually exclusive. Mammals contain at least two isoforms of Arfaptin. Arfaptin 1 has been shown to inhibit the activation of Arf-dependent phospholipase D (PLD) and the secretion of matrix metalloproteinase-9 (MMP-9), an enzyme implicated in cancer invasiveness and metastasis. Arfaptin 2 regulates the aggregation of the protein huntingtin, which is im
Probab=24.01  E-value=59  Score=24.55  Aligned_cols=17  Identities=35%  Similarity=0.567  Sum_probs=11.8

Q ss_pred             HHHHHHHHHhhchhHHHhhhh
Q psy15893         55 DLYRQEVTQLKCDKLDLLRQN   75 (80)
Q Consensus        55 e~L~~eV~rLk~dKldLLrQN   75 (80)
                      +.||.||    +.|++||-+|
T Consensus       151 ~KLR~DV----~~Kl~lLeen  167 (201)
T cd07660         151 EKLRNDV----SVKLKFLEEN  167 (201)
T ss_pred             HHHHHHH----HHHHHHHhhh
Confidence            6666666    3678888776


No 23 
>PRK06921 hypothetical protein; Provisional
Probab=23.56  E-value=68  Score=23.88  Aligned_cols=22  Identities=5%  Similarity=-0.031  Sum_probs=19.4

Q ss_pred             HHHHHHHHHhhchhHHHhhhhc
Q psy15893         55 DLYRQEVTQLKCDKLDLLRQNV   76 (80)
Q Consensus        55 e~L~~eV~rLk~dKldLLrQNV   76 (80)
                      -.|+.++.+|+.+|..||.+|-
T Consensus         4 ~~~~~~~~~l~~~~~~~l~~~g   25 (266)
T PRK06921          4 RTIEEKAAELLMRERPSTTTKP   25 (266)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCC
Confidence            3688999999999999999884


No 24 
>PF00170 bZIP_1:  bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature;  InterPro: IPR011616  The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0046983 protein dimerization activity, 0006355 regulation of transcription, DNA-dependent; PDB: 2H7H_B 2OQQ_B 1S9K_E 1JNM_A 1JUN_A 1FOS_H 1A02_J 1T2K_C 1CI6_A 1DH3_C ....
Probab=22.68  E-value=1e+02  Score=18.06  Aligned_cols=21  Identities=29%  Similarity=0.370  Sum_probs=10.1

Q ss_pred             HHHHHHHHHhhchhHHHhhhh
Q psy15893         55 DLYRQEVTQLKCDKLDLLRQN   75 (80)
Q Consensus        55 e~L~~eV~rLk~dKldLLrQN   75 (80)
                      +.|+.++..|+.+-..|..+|
T Consensus        43 ~~L~~~~~~L~~~~~~L~~e~   63 (64)
T PF00170_consen   43 EELKKELEQLKKEIQSLKSEN   63 (64)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhhc
Confidence            444455555555444444443


No 25 
>PF04508 Pox_A_type_inc:  Viral A-type inclusion protein repeat ;  InterPro: IPR007596 The repeat is found in the A-type inclusion protein of the Poxvirus family [].; GO: 0016032 viral reproduction
Probab=22.57  E-value=53  Score=17.49  Aligned_cols=16  Identities=38%  Similarity=0.468  Sum_probs=11.8

Q ss_pred             HHHHHhhchhHHHhhh
Q psy15893         59 QEVTQLKCDKLDLLRQ   74 (80)
Q Consensus        59 ~eV~rLk~dKldLLrQ   74 (80)
                      +||.|||..=.||=||
T Consensus         1 ~E~~rlr~rI~dLer~   16 (23)
T PF04508_consen    1 REMNRLRNRISDLERQ   16 (23)
T ss_pred             ChHHHHHHHHHHHHHH
Confidence            3778888777777766


No 26 
>PF02183 HALZ:  Homeobox associated leucine zipper;  InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox []. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=22.48  E-value=1e+02  Score=18.05  Aligned_cols=18  Identities=28%  Similarity=0.283  Sum_probs=9.0

Q ss_pred             HHHHHHHHHhhchhHHHh
Q psy15893         55 DLYRQEVTQLKCDKLDLL   72 (80)
Q Consensus        55 e~L~~eV~rLk~dKldLL   72 (80)
                      +.|..|-.+|+.|+-.|.
T Consensus        15 d~Lk~~~~~L~~E~~~L~   32 (45)
T PF02183_consen   15 DSLKAEYDSLKKENEKLR   32 (45)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            445555555555554443


No 27 
>PF11388 DotA:  Phagosome trafficking protein DotA;  InterPro: IPR021528  DotA is essential for intracellular growth in Legionella []. DotA is thought to play an important role in regulating initial phagosome trafficking decisions either upon or immediately after macrophage uptake []. 
Probab=22.19  E-value=38  Score=23.92  Aligned_cols=9  Identities=67%  Similarity=0.996  Sum_probs=7.7

Q ss_pred             ccCCccccc
Q psy15893         26 IDSDTGLES   34 (80)
Q Consensus        26 ~DSDTGlES   34 (80)
                      +||+||||-
T Consensus         1 fds~tgle~    9 (105)
T PF11388_consen    1 FDSNTGLEK    9 (105)
T ss_pred             CCccccccc
Confidence            599999985


No 28 
>PF00990 GGDEF:  GGDEF domain;  InterPro: IPR000160 This domain appears to be ubiquitous in bacteria and is often linked to a regulatory domain, such as a phosphorylation receiver or oxygen sensing domain. Its function is to synthesize cyclic di-GMP, which is used as an intracellular signalling molecule in a wide variety of bacteria [,]. Enzymatic activity can be strongly influenced by the adjacent domains. Processes regulated by this domain include exopolysaccharide synthesis, biofilm formation, motility and cell differentiation. Structural studies of PleD from Caulobacter crescentus show that this domain forms a five-stranded beta sheet surrounded by helices, similar to the catalytic core of adenylate cyclase [].; PDB: 3IGN_A 3BRE_B 3EZU_A 3ICL_B 3PJX_A 3PJW_A 3HVW_A 3HVA_B 3I5C_B 3I5B_B ....
Probab=22.14  E-value=40  Score=20.26  Aligned_cols=8  Identities=63%  Similarity=0.970  Sum_probs=3.9

Q ss_pred             cccCCccc
Q psy15893         25 YIDSDTGL   32 (80)
Q Consensus        25 ~~DSDTGl   32 (80)
                      |+|..|||
T Consensus         2 ~~D~~TgL    9 (161)
T PF00990_consen    2 FIDPLTGL    9 (161)
T ss_dssp             CB-TTTSS
T ss_pred             cccCCCCC
Confidence            45666665


No 29 
>cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes. The BAR domain of Arfaptin-like proteins, also called the Arfaptin domain, is a dimerization, lipid binding and curvature sensing module present in Arfaptins, PICK1, ICA69, and similar proteins. Arfaptins are ubiquitously expressed proteins implicated in mediating cross-talk between Rac, a member of the Rho family GTPases, and Arf (ADP-ribosylation factor) small GTPases. Arfaptins bind to GTP-bound Arf1, Arf5, and Arf6, with strongest binding to GTP-Arf1. Arfaptins also binds to Rac-GTP and Rac-GDP with similar affinities. The Arfs are thought to bind to the same surface as Rac, and their binding is mutually exclusive. Protein Interacting with C Kinase 1 (PICK1) plays a key role in the trafficking of AMPA receptors, which are critical for regulating synaptic strength and may be important in cellular processes involved in learning and memory. Is
Probab=21.92  E-value=71  Score=24.07  Aligned_cols=18  Identities=33%  Similarity=0.444  Sum_probs=13.9

Q ss_pred             hHHHHHHHHHhhchhHHHhhhh
Q psy15893         54 SDLYRQEVTQLKCDKLDLLRQN   75 (80)
Q Consensus        54 ~e~L~~eV~rLk~dKldLLrQN   75 (80)
                      -+.||.||    +.|+|||-+|
T Consensus       153 f~kLr~Dv----~~Kl~lL~~~  170 (203)
T cd00011         153 FEKLRGDV----AIKLKFLEEN  170 (203)
T ss_pred             HHHHHHHH----HHHHHHHHHh
Confidence            47777777    4699999887


No 30 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=21.71  E-value=39  Score=19.40  Aligned_cols=6  Identities=67%  Similarity=1.896  Sum_probs=5.5

Q ss_pred             CCcccc
Q psy15893         43 KPCGLC   48 (80)
Q Consensus        43 ~~Cs~C   48 (80)
                      +||.||
T Consensus         4 kPCPFC    9 (61)
T PF14354_consen    4 KPCPFC    9 (61)
T ss_pred             cCCCCC
Confidence            799999


No 31 
>PRK13922 rod shape-determining protein MreC; Provisional
Probab=20.59  E-value=95  Score=22.70  Aligned_cols=16  Identities=13%  Similarity=0.254  Sum_probs=11.8

Q ss_pred             hHHHHHHHHHhhchhH
Q psy15893         54 SDLYRQEVTQLKCDKL   69 (80)
Q Consensus        54 ~e~L~~eV~rLk~dKl   69 (80)
                      .+.|++|+.+|+.+..
T Consensus        78 n~~L~~e~~~l~~~~~   93 (276)
T PRK13922         78 NEELKKELLELESRLQ   93 (276)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4677777777777766


No 32 
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]
Probab=20.56  E-value=75  Score=26.34  Aligned_cols=23  Identities=26%  Similarity=0.405  Sum_probs=18.0

Q ss_pred             CCcccccCCC--------chHHHHHHHHHhh
Q psy15893         43 KPCGLCMDGN--------ASDLYRQEVTQLK   65 (80)
Q Consensus        43 ~~Cs~C~d~~--------~~e~L~~eV~rLk   65 (80)
                      +.|+||+-|.        ..+....||.+|-
T Consensus       156 ~~CtfCiiP~~RG~~rSr~~e~Il~ev~~Lv  186 (437)
T COG0621         156 KFCTFCIIPYARGKERSRPPEDILKEVKRLV  186 (437)
T ss_pred             CCCCeeeeeccCCCccCCCHHHHHHHHHHHH
Confidence            7999999643        3688888998874


No 33 
>PF04325 DUF465:  Protein of unknown function (DUF465);  InterPro: IPR007420 Family members are found in small bacterial proteins, and also in the heavy chains of eukaryotic myosin and kinesin, C-terminal of the motor domain. Members of this family may form coiled coil structures.; PDB: 1ZHC_A.
Probab=20.30  E-value=74  Score=18.23  Aligned_cols=13  Identities=46%  Similarity=0.680  Sum_probs=9.0

Q ss_pred             HHHHHhhchhHHH
Q psy15893         59 QEVTQLKCDKLDL   71 (80)
Q Consensus        59 ~eV~rLk~dKldL   71 (80)
                      .++.+||-+|+-|
T Consensus        27 ~~l~~LKk~kL~L   39 (49)
T PF04325_consen   27 EELERLKKEKLRL   39 (49)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            4677788777754


No 34 
>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional
Probab=20.24  E-value=85  Score=24.93  Aligned_cols=24  Identities=17%  Similarity=0.266  Sum_probs=18.2

Q ss_pred             CCcccccCCC--------chHHHHHHHHHhhc
Q psy15893         43 KPCGLCMDGN--------ASDLYRQEVTQLKC   66 (80)
Q Consensus        43 ~~Cs~C~d~~--------~~e~L~~eV~rLk~   66 (80)
                      ..|+||.-+.        ..+.+..||.+|+.
T Consensus       151 ~~CsFC~ip~~~G~~rsr~~e~Vv~Ei~~l~~  182 (440)
T PRK14862        151 HRCTFCIIPSMRGDLVSRPIGDVLREAERLVK  182 (440)
T ss_pred             CCCccCCcccccCCccccCHHHHHHHHHHHHH
Confidence            5799998542        36888899998753


No 35 
>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional
Probab=20.03  E-value=91  Score=25.04  Aligned_cols=24  Identities=17%  Similarity=0.335  Sum_probs=18.4

Q ss_pred             CCcccccCCC--------chHHHHHHHHHhhc
Q psy15893         43 KPCGLCMDGN--------ASDLYRQEVTQLKC   66 (80)
Q Consensus        43 ~~Cs~C~d~~--------~~e~L~~eV~rLk~   66 (80)
                      ..|+||.-+.        ..|.+..||.+|..
T Consensus       166 ~~CsFC~ip~~rG~~rsr~~e~Iv~Ei~~l~~  197 (449)
T PRK14332        166 NFCTFCVVPYTRGRERSRDPKSIVREIQDLQE  197 (449)
T ss_pred             CCCCCCCcccccCCcccCCHHHHHHHHHHHHH
Confidence            5899998642        36889999988853


Done!