BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1590
         (365 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3J1Z|P Chain P, Inward-facing Conformation Of The Zinc Transporter Yiip
           Revealed By Cryo-electron Microscopy
 pdb|3J1Z|Q Chain Q, Inward-facing Conformation Of The Zinc Transporter Yiip
           Revealed By Cryo-electron Microscopy
          Length = 306

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 68  YGWARVEILGVLINTVFLTGLCFLMVIHGVKRILEPSPVK 107
           YG  + E L  L  + F+ G  FL++ +G +R+L PSPV+
Sbjct: 75  YGHGKAEPLAALAQSAFIMGSAFLLLFYGGERLLNPSPVE 114


>pdb|3TLJ|A Chain A, Crystal Structure Of Trm14 From Pyrococcus Furiosus In
           Complex With S- Adenosyl-L-Homocysteine
 pdb|3TLJ|B Chain B, Crystal Structure Of Trm14 From Pyrococcus Furiosus In
           Complex With S- Adenosyl-L-Homocysteine
 pdb|3TM4|A Chain A, Crystal Structure Of Trm14 From Pyrococcus Furiosus In
           Complex With S- Adenosylmethionine
 pdb|3TM4|B Chain B, Crystal Structure Of Trm14 From Pyrococcus Furiosus In
           Complex With S- Adenosylmethionine
 pdb|3TM5|A Chain A, Crystal Structure Of Trm14 From Pyrococcus Furiosus In
           Complex With Sinefungin
 pdb|3TM5|B Chain B, Crystal Structure Of Trm14 From Pyrococcus Furiosus In
           Complex With Sinefungin
          Length = 373

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 10  LFMFVGTFSYFIIEITYGYKLNSVALIADSYLMFSNVVALAVACLSV-IMSKKKSIRNTY 68
           L  +V +  + I  + YG K+   ++I D Y+ F N +A  +    V I ++KK+I    
Sbjct: 280 LSQYVDSVDFAISNLPYGLKIGKKSMIPDLYMKFFNELAKVLEKRGVFITTEKKAIEEAI 339

Query: 69  GWARVEIL 76
                EI+
Sbjct: 340 AENGFEII 347


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.427 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,634,630
Number of Sequences: 62578
Number of extensions: 355747
Number of successful extensions: 787
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 785
Number of HSP's gapped (non-prelim): 2
length of query: 365
length of database: 14,973,337
effective HSP length: 100
effective length of query: 265
effective length of database: 8,715,537
effective search space: 2309617305
effective search space used: 2309617305
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)