Query         psy15902
Match_columns 93
No_of_seqs    103 out of 162
Neff          4.5 
Searched_HMMs 46136
Date          Sat Aug 17 00:32:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15902.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15902hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG5072 ALK1 Serine/threonine  100.0 1.1E-30 2.4E-35  214.0   4.6   80    8-89    356-435 (488)
  2 PF12330 DUF3635:  Domain of un  99.9 2.6E-28 5.7E-33  165.5   5.3   53   37-91      1-53  (98)
  3 KOG2464|consensus               97.9 2.8E-06   6E-11   64.3   1.0   73    5-79    162-234 (246)
  4 KOG0192|consensus               89.4    0.24 5.2E-06   39.9   2.0   49    3-53    174-232 (362)
  5 KOG0593|consensus               80.0    0.66 1.4E-05   38.6   0.4   26    7-32    135-160 (396)
  6 KOG0583|consensus               78.7     1.6 3.4E-05   35.1   2.2   37    5-45    153-198 (370)
  7 KOG0594|consensus               77.3     0.5 1.1E-05   38.3  -1.0   54    9-62    156-245 (323)
  8 PF00069 Pkinase:  Protein kina  71.2     1.7 3.7E-05   30.3   0.6   50    4-54    130-186 (260)
  9 TIGR03724 arch_bud32 Kae1-asso  71.1       7 0.00015   26.9   3.6   16    9-24    125-140 (199)
 10 cd07867 STKc_CDC2L6 Catalytic   71.0     4.6  0.0001   29.4   2.8   46    8-53    147-202 (317)
 11 PRK14879 serine/threonine prot  70.8       7 0.00015   27.1   3.6   15    9-23    130-144 (211)
 12 cd07868 STKc_CDK8 Catalytic do  68.5       5 0.00011   29.4   2.6   45    8-52    147-201 (317)
 13 PLN00009 cyclin-dependent kina  68.1     5.1 0.00011   29.0   2.5   50    4-53    134-190 (294)
 14 KOG0581|consensus               67.4     2.7 5.8E-05   34.8   1.0   18    8-25    214-231 (364)
 15 cd05145 RIO1_like RIO kinase f  63.5     5.1 0.00011   28.2   1.8   16    9-24    153-168 (190)
 16 cd07874 STKc_JNK3 Catalytic do  63.1     7.1 0.00015   29.4   2.6   45    8-52    154-203 (355)
 17 KOG0199|consensus               61.3     4.7  0.0001   37.0   1.5   17   10-26    249-265 (1039)
 18 KOG1187|consensus               61.2     5.7 0.00012   31.7   1.8   39    3-42    208-252 (361)
 19 cd05612 STKc_PRKX_like Catalyt  59.5       9 0.00019   28.0   2.5   46    8-53    136-184 (291)
 20 PTZ00283 serine/threonine prot  58.8     9.6 0.00021   31.2   2.8   42    8-53    178-231 (496)
 21 cd07876 STKc_JNK2 Catalytic do  56.1      13 0.00027   28.2   2.9   46    8-53    158-208 (359)
 22 COG3642 Mn2+-dependent serine/  55.7     4.9 0.00011   30.9   0.6   20    7-26    125-144 (204)
 23 cd07875 STKc_JNK1 Catalytic do  55.4      11 0.00024   28.5   2.5   45    8-52    161-210 (364)
 24 cd07870 STKc_PFTAIRE2 Catalyti  54.2      19 0.00041   26.0   3.4   45    9-53    139-190 (291)
 25 KOG0984|consensus               53.7     6.5 0.00014   31.4   1.0   17    9-25    185-201 (282)
 26 cd05037 PTK_Jak_rpt1 Pseudokin  52.1      14 0.00031   25.7   2.4   44   10-53    145-192 (259)
 27 cd05119 RIO RIO kinase family,  51.6      11 0.00023   25.7   1.7   17    9-25    150-166 (187)
 28 cd05147 RIO1_euk RIO kinase fa  51.3     9.1  0.0002   27.4   1.4   13    9-21    153-165 (190)
 29 cd07871 STKc_PCTAIRE3 Catalyti  50.6      16 0.00035   26.6   2.6   45    9-53    139-190 (288)
 30 KOG0663|consensus               50.2     8.3 0.00018   32.5   1.1   65    2-66    206-306 (419)
 31 PHA02882 putative serine/threo  49.4      18 0.00039   26.5   2.7   64    9-72    162-243 (294)
 32 cd07869 STKc_PFTAIRE1 Catalyti  48.9      13 0.00029   27.1   1.9   44    9-52    139-189 (303)
 33 cd07872 STKc_PCTAIRE2 Catalyti  48.8      19 0.00042   26.4   2.8   45    9-53    140-191 (309)
 34 PRK09188 serine/threonine prot  48.5      11 0.00024   30.5   1.6   15    9-23    148-162 (365)
 35 PTZ00036 glycogen synthase kin  48.5      11 0.00023   30.2   1.5   50    3-52    201-256 (440)
 36 cd00180 PKc Catalytic domain o  48.3      21 0.00046   23.0   2.7   45    9-53    129-180 (215)
 37 PTZ00263 protein kinase A cata  47.8     9.3  0.0002   28.7   1.0   18    8-25    153-170 (329)
 38 cd05631 STKc_GRK4 Catalytic do  47.6      16 0.00034   26.6   2.1   16    9-24    138-153 (285)
 39 PHA02988 hypothetical protein;  46.9      12 0.00025   27.5   1.4   40    9-52    159-207 (283)
 40 KOG0197|consensus               46.5      12 0.00027   31.9   1.6   17    9-25    339-355 (468)
 41 KOG0659|consensus               46.1      14 0.00031   30.1   1.9   36    8-43    136-176 (318)
 42 cd07844 STKc_PCTAIRE_like Cata  46.1      19  0.0004   25.9   2.3   45    8-52    138-189 (291)
 43 cd05611 STKc_Rim15_like Cataly  46.0      21 0.00046   25.1   2.6   45    9-53    133-179 (260)
 44 KOG1026|consensus               46.0      10 0.00022   34.3   1.1   17    8-24    638-654 (774)
 45 cd05108 PTKc_EGFR Catalytic do  46.0      19 0.00042   26.5   2.4   17    8-24    144-160 (316)
 46 cd05595 STKc_PKB_beta Catalyti  45.5      17 0.00036   27.3   2.0   45    8-52    130-180 (323)
 47 cd05584 STKc_p70S6K Catalytic   45.3      14 0.00031   27.5   1.6   45    8-52    135-185 (323)
 48 cd07853 STKc_NLK Catalytic dom  44.0      16 0.00034   27.9   1.7   46    8-53    138-191 (372)
 49 PTZ00426 cAMP-dependent protei  43.6      14 0.00031   28.2   1.5   17    8-24    166-182 (340)
 50 cd07836 STKc_Pho85 Catalytic d  43.0      29 0.00063   24.6   2.9   46    8-53    135-187 (284)
 51 cd06618 PKc_MKK7 Catalytic dom  43.0      25 0.00054   25.5   2.6   17    8-24    150-166 (296)
 52 cd07839 STKc_CDK5 Catalytic do  42.9      22 0.00048   25.3   2.3   46    8-53    134-186 (284)
 53 cd05118 STKc_CMGC Catalytic do  42.5      23 0.00051   25.0   2.3   46    8-53    133-185 (283)
 54 KOG0658|consensus               42.4      19 0.00042   29.9   2.1   23    3-25    156-178 (364)
 55 KOG0194|consensus               42.4      14  0.0003   31.4   1.3   14   11-24    300-313 (474)
 56 KOG0667|consensus               41.5      18 0.00039   31.8   1.9   17   10-26    328-344 (586)
 57 cd05109 PTKc_HER2 Catalytic do  41.4      29 0.00062   24.8   2.7   46    9-54    145-198 (279)
 58 cd07835 STKc_CDK1_like Catalyt  41.1      40 0.00086   24.0   3.4   45    9-53    135-186 (283)
 59 PHA03390 pk1 serine/threonine-  40.7      30 0.00064   24.9   2.7   50    4-54    141-193 (267)
 60 cd06649 PKc_MEK2 Catalytic dom  40.4      23 0.00049   26.5   2.1   45    9-53    140-188 (331)
 61 cd07846 STKc_CDKL2_3 Catalytic  39.3      31 0.00068   24.5   2.6   45    8-52    135-186 (286)
 62 PHA03210 serine/threonine kina  39.2      33 0.00071   28.0   3.0   44    9-52    303-353 (501)
 63 PTZ00284 protein kinase; Provi  38.7      33 0.00072   27.3   2.9   43   11-53    286-331 (467)
 64 KOG1164|consensus               38.6      30 0.00066   26.4   2.6   12   10-21    164-175 (322)
 65 cd05085 PTKc_Fer Catalytic dom  38.2      30 0.00065   24.1   2.3   46    8-53    128-180 (250)
 66 cd05614 STKc_MSK2_N N-terminal  38.0      20 0.00044   26.6   1.5   15    9-23    141-155 (332)
 67 cd06624 STKc_ASK Catalytic dom  37.9      35 0.00076   24.1   2.6   21    3-23    139-159 (268)
 68 PLN03225 Serine/threonine-prot  37.8      23 0.00051   29.9   2.0   20    4-23    287-306 (566)
 69 cd05059 PTKc_Tec_like Catalyti  37.8      35 0.00076   24.0   2.7   44    9-52    136-186 (256)
 70 cd07863 STKc_CDK4 Catalytic do  37.7      25 0.00053   25.1   1.9   46    8-53    143-193 (288)
 71 KOG0660|consensus               37.6      17 0.00037   30.2   1.1   15   10-24    162-176 (359)
 72 cd07861 STKc_CDK1_euk Catalyti  37.4      32 0.00069   24.4   2.4   46    8-53    136-188 (285)
 73 PHA03212 serine/threonine kina  37.1      37 0.00081   26.7   2.9   45    9-53    218-269 (391)
 74 cd05577 STKc_GRK Catalytic dom  36.9      30 0.00066   24.7   2.2   46    9-54    131-181 (277)
 75 cd05607 STKc_GRK7 Catalytic do  36.8      40 0.00086   24.4   2.8   44    9-52    131-179 (277)
 76 cd07840 STKc_CDK9_like Catalyt  36.6      39 0.00084   23.8   2.7   45    9-53    136-188 (287)
 77 cd05068 PTKc_Frk_like Catalyti  36.2      33 0.00071   24.2   2.3   45    9-53    139-190 (261)
 78 cd05116 PTKc_Syk Catalytic dom  36.0      52  0.0011   23.2   3.3   45    9-53    131-184 (257)
 79 KOG1345|consensus               35.6      20 0.00044   29.7   1.3   15   10-24    160-174 (378)
 80 cd08220 STKc_Nek8 Catalytic do  35.6      36 0.00078   23.6   2.4   50    4-53    133-187 (256)
 81 PHA03211 serine/threonine kina  35.1      27 0.00058   28.7   1.9   16    9-24    296-311 (461)
 82 cd05041 PTKc_Fes_like Catalyti  34.8      53  0.0011   22.8   3.1   45    9-53    129-181 (251)
 83 cd05062 PTKc_IGF-1R Catalytic   34.8      59  0.0013   23.2   3.4   46    8-53    154-207 (277)
 84 cd05604 STKc_SGK3 Catalytic do  34.7      25 0.00054   26.2   1.5   15    9-23    132-146 (325)
 85 KOG0575|consensus               34.6      19 0.00041   31.7   1.0   15    8-22    153-167 (592)
 86 KOG3087|consensus               34.4      20 0.00044   28.1   1.0   39   10-52    153-202 (229)
 87 smart00090 RIO RIO-like kinase  34.3      24 0.00053   26.2   1.4   16    9-24    184-199 (237)
 88 cd05592 STKc_nPKC_theta_delta   34.2      23  0.0005   26.4   1.3   17    8-24    131-147 (316)
 89 PRK12274 serine/threonine prot  34.2      26 0.00057   26.9   1.6   15    8-22    127-141 (218)
 90 KOG0662|consensus               33.8      19 0.00041   28.5   0.8   17    8-24    136-152 (292)
 91 cd05586 STKc_Sck1_like Catalyt  33.7      26 0.00057   26.0   1.5   16    8-23    131-146 (330)
 92 cd05585 STKc_YPK1_like Catalyt  33.7      28 0.00061   25.8   1.6   16    9-24    129-144 (312)
 93 cd05084 PTKc_Fes Catalytic dom  33.5      66  0.0014   22.4   3.5   45    9-53    130-182 (252)
 94 PHA03209 serine/threonine kina  33.5      47   0.001   25.3   2.9   45    9-53    193-242 (357)
 95 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  33.5      46 0.00099   23.8   2.7   45    9-53    144-197 (284)
 96 cd07873 STKc_PCTAIRE1 Catalyti  33.5      42 0.00092   24.4   2.5   46    8-53    139-191 (301)
 97 cd05618 STKc_aPKC_iota Catalyt  33.3      27 0.00058   26.3   1.5   16    8-23    131-146 (329)
 98 cd05600 STKc_Sid2p_Dbf2p Catal  33.3      28  0.0006   26.0   1.6   17    8-24    136-152 (333)
 99 cd06629 STKc_MAPKKK_Bck1_like   32.4      44 0.00095   23.6   2.4   46    8-53    143-198 (272)
100 cd07832 STKc_CCRK Catalytic do  32.3      51  0.0011   23.3   2.8   45    9-53    135-187 (286)
101 cd05571 STKc_PKB Catalytic dom  32.1      30 0.00064   25.8   1.6   16    8-23    130-145 (323)
102 cd05594 STKc_PKB_alpha Catalyt  32.0      28  0.0006   25.9   1.4   16    8-23    131-146 (325)
103 cd05122 PKc_STE Catalytic doma  31.9      45 0.00097   22.6   2.3   45    9-53    134-183 (253)
104 cd05615 STKc_cPKC_alpha Cataly  31.8      28 0.00061   26.0   1.4   16    8-23    136-151 (323)
105 PLN00034 mitogen-activated pro  30.8      27 0.00058   26.4   1.1   17    8-24    203-219 (353)
106 cd06654 STKc_PAK1 Catalytic do  30.8      35 0.00075   25.0   1.7   45    9-53    152-202 (296)
107 KOG0664|consensus               30.8      27 0.00059   29.2   1.2   17    8-24    191-207 (449)
108 cd05628 STKc_NDR1 Catalytic do  30.3      33 0.00071   26.1   1.6   14    9-22    137-150 (363)
109 cd05096 PTKc_DDR1 Catalytic do  30.2      27 0.00059   25.4   1.1   46    8-53    173-226 (304)
110 cd07860 STKc_CDK2_3 Catalytic   30.1      58  0.0013   23.1   2.8   46    8-53    135-187 (284)
111 cd05123 STKc_AGC Catalytic dom  30.0      49  0.0011   22.8   2.3   45    9-53    129-179 (250)
112 cd05602 STKc_SGK1 Catalytic do  30.0      30 0.00065   25.8   1.3   16    8-23    131-146 (325)
113 cd05591 STKc_nPKC_epsilon Cata  29.9      33 0.00071   25.5   1.5   16    8-23    131-146 (321)
114 cd06644 STKc_STK10_LOK Catalyt  29.8      51  0.0011   23.7   2.5   16    9-24    146-161 (292)
115 PRK01723 3-deoxy-D-manno-octul  29.8      41 0.00088   25.0   2.0   51   10-78    179-231 (239)
116 cd05616 STKc_cPKC_beta Catalyt  29.7      30 0.00065   25.7   1.2   16    8-23    136-151 (323)
117 cd07862 STKc_CDK6 Catalytic do  29.6      27 0.00059   25.0   1.0   16    9-24    146-161 (290)
118 cd07866 STKc_BUR1 Catalytic do  29.5      43 0.00093   24.0   2.0   18    8-25    150-167 (311)
119 cd08219 STKc_Nek3 Catalytic do  29.4      40 0.00087   23.6   1.8   17    9-25    136-152 (255)
120 cd05629 STKc_NDR_like_fungal C  29.4      34 0.00074   26.1   1.5   14    8-21    136-149 (377)
121 cd06616 PKc_MKK4 Catalytic dom  29.2      39 0.00085   24.1   1.8   16    9-24    144-159 (288)
122 PF12705 PDDEXK_1:  PD-(D/E)XK   29.0      45 0.00097   22.8   1.9   39    8-59    142-180 (257)
123 cd05590 STKc_nPKC_eta Catalyti  28.9      35 0.00076   25.5   1.5   16    8-23    131-146 (320)
124 PF03244 PSI_PsaH:  Photosystem  28.8      14 0.00029   27.1  -0.7   13   22-34     45-57  (140)
125 cd05587 STKc_cPKC Catalytic do  28.7      35 0.00075   25.4   1.4   15    9-23    137-151 (324)
126 cd05603 STKc_SGK2 Catalytic do  28.2      34 0.00074   25.3   1.3   15    9-23    132-146 (321)
127 PRK09605 bifunctional UGMP fam  28.2      38 0.00083   28.0   1.7   17    8-24    462-478 (535)
128 cd06626 STKc_MEKK4 Catalytic d  28.2      58  0.0013   22.7   2.4   45    9-53    135-192 (264)
129 cd05102 PTKc_VEGFR3 Catalytic   28.1      35 0.00076   25.3   1.4   15    9-23    210-224 (338)
130 cd05060 PTKc_Syk_like Catalyti  27.9      56  0.0012   22.9   2.3   46    8-53    130-184 (257)
131 cd05072 PTKc_Lyn Catalytic dom  27.9      59  0.0013   22.8   2.4   45    9-53    139-190 (261)
132 KOG4278|consensus               27.4      28  0.0006   32.2   0.8   17   10-26    402-418 (1157)
133 cd05572 STKc_cGK_PKG Catalytic  27.3      64  0.0014   22.6   2.5   17    9-25    129-145 (262)
134 KOG0200|consensus               27.3      33 0.00072   29.2   1.2   15    8-22    453-467 (609)
135 cd05144 RIO2_C RIO kinase fami  27.2      57  0.0012   22.7   2.3   17    9-25    161-177 (198)
136 cd07833 STKc_CDKL Catalytic do  27.1      81  0.0018   22.3   3.0   46    8-53    135-188 (288)
137 cd05617 STKc_aPKC_zeta Catalyt  27.0      36 0.00078   25.5   1.3   45    8-52    131-181 (327)
138 cd06613 STKc_MAP4K3_like Catal  27.0      69  0.0015   22.2   2.6   45    8-52    136-189 (262)
139 cd05621 STKc_ROCK2 Catalytic d  26.9      39 0.00085   26.2   1.5   16    8-23    177-192 (370)
140 cd05625 STKc_LATS1 Catalytic d  26.8      42 0.00092   25.6   1.6   14    8-21    136-149 (382)
141 cd05593 STKc_PKB_gamma Catalyt  26.7      40 0.00087   25.3   1.5   16    8-23    130-145 (328)
142 cd07837 STKc_CdkB_plant Cataly  26.7      45 0.00098   23.9   1.7   51    3-53    141-198 (295)
143 cd05575 STKc_SGK Catalytic dom  26.7      40 0.00088   25.0   1.5   15    9-23    132-146 (323)
144 smart00221 STYKc Protein kinas  26.7      77  0.0017   21.1   2.8   44   10-53    135-186 (225)
145 cd06625 STKc_MEKK3_like Cataly  26.7      45 0.00098   23.3   1.7   16    8-23    139-154 (263)
146 cd07842 STKc_CDK8_like Catalyt  26.7      62  0.0013   23.3   2.4   44    9-52    148-201 (316)
147 cd05624 STKc_MRCK_beta Catalyt  26.7      39 0.00084   25.4   1.4   17    8-24    137-153 (331)
148 cd05619 STKc_nPKC_theta Cataly  26.5      37  0.0008   25.4   1.2   45    8-52    131-181 (316)
149 KOG0598|consensus               26.5      42  0.0009   27.9   1.6   65    9-78    161-238 (357)
150 cd07843 STKc_CDC2L1 Catalytic   26.5      80  0.0017   22.7   3.0   46    8-53    141-193 (293)
151 cd07878 STKc_p38beta_MAPK11 Ca  26.5      35 0.00075   25.5   1.1   45    8-52    153-201 (343)
152 cd08528 STKc_Nek10 Catalytic d  26.3      70  0.0015   22.5   2.6   44    9-52    150-198 (269)
153 cd05601 STKc_CRIK Catalytic do  26.2      36 0.00079   25.2   1.2   17    8-24    137-153 (330)
154 cd05623 STKc_MRCK_alpha Cataly  26.2      44 0.00096   25.0   1.6   16    8-23    137-152 (332)
155 cd05111 PTK_HER3 Pseudokinase   26.2      36 0.00078   24.5   1.1   45    8-52    144-196 (279)
156 cd05151 ChoK Choline Kinase (C  26.2      55  0.0012   21.5   1.9   14    9-22    123-136 (170)
157 cd05620 STKc_nPKC_delta Cataly  26.2      36 0.00079   25.3   1.2   15    9-23    132-146 (316)
158 cd05040 PTKc_Ack_like Catalyti  26.2      62  0.0013   22.5   2.3   16   10-25    134-149 (257)
159 cd05101 PTKc_FGFR2 Catalytic d  26.1      79  0.0017   23.0   2.9   41    9-53    173-225 (304)
160 cd05610 STKc_MASTL Catalytic d  26.1      63  0.0014   27.6   2.7   18    9-26    140-157 (669)
161 cd08217 STKc_Nek2 Catalytic do  26.0   1E+02  0.0023   21.2   3.4   45    9-53    146-196 (265)
162 cd05052 PTKc_Abl Catalytic dom  25.9      68  0.0015   22.6   2.5   46    8-53    139-191 (263)
163 cd05622 STKc_ROCK1 Catalytic d  25.7      43 0.00093   25.9   1.5   17    8-24    177-193 (371)
164 cd07859 STKc_TDY_MAPK_plant Ca  25.7      39 0.00084   24.8   1.2   17    8-24    138-154 (338)
165 KOG1094|consensus               25.7      34 0.00074   31.0   1.1   13    9-21    673-685 (807)
166 cd07848 STKc_CDKL5 Catalytic d  25.7      44 0.00096   23.9   1.5   45    8-52    135-186 (287)
167 KOG1163|consensus               25.6      42 0.00092   27.5   1.5   19    6-24    147-165 (341)
168 cd05120 APH_ChoK_like Aminogly  25.6      54  0.0012   20.2   1.7   16    9-24    125-140 (155)
169 cd07864 STKc_CDK12 Catalytic d  25.5      79  0.0017   22.7   2.8   45    8-52    151-203 (302)
170 cd05113 PTKc_Btk_Bmx Catalytic  25.4      88  0.0019   22.1   3.0   45    9-53    136-187 (256)
171 KOG0983|consensus               25.2      36 0.00079   28.4   1.1   15   10-24    229-243 (391)
172 PF01163 RIO1:  RIO1 family;  I  25.0      37 0.00081   24.8   1.0   14    9-22    142-155 (188)
173 COG0515 SPS1 Serine/threonine   25.0      96  0.0021   20.7   2.9   47    5-51    134-195 (384)
174 cd07845 STKc_CDK10 Catalytic d  24.9      79  0.0017   23.0   2.7   47    8-54    143-196 (309)
175 KOG4055|consensus               24.7      49  0.0011   25.6   1.6   16   43-58     77-92  (213)
176 cd07830 STKc_MAK_like Catalyti  24.4      63  0.0014   22.9   2.1   45    8-52    134-184 (283)
177 cd07879 STKc_p38delta_MAPK13 C  24.3      79  0.0017   23.7   2.7   46    8-53    152-201 (342)
178 cd05075 PTKc_Axl Catalytic dom  24.3      41 0.00089   23.7   1.1   17    8-24    147-163 (272)
179 cd07850 STKc_JNK Catalytic dom  24.3      55  0.0012   24.7   1.8   45    9-53    154-203 (353)
180 cd05589 STKc_PKN Catalytic dom  24.3      42 0.00091   24.9   1.2   16    8-23    136-151 (324)
181 cd06640 STKc_MST4 Catalytic do  24.3      71  0.0015   22.8   2.3   46    8-53    136-187 (277)
182 cd08222 STKc_Nek11 Catalytic d  24.3      72  0.0016   22.3   2.3   44   10-53    142-191 (260)
183 cd05078 PTK_Jak2_Jak3_rpt1 Pse  24.2 1.1E+02  0.0023   21.6   3.3   43   12-54    147-192 (258)
184 cd05597 STKc_DMPK_like Catalyt  24.2      48   0.001   24.9   1.5   16    8-23    137-152 (331)
185 cd08529 STKc_FA2-like Catalyti  24.0      48   0.001   23.0   1.4   46    8-53    136-187 (256)
186 COG0448 GlgC ADP-glucose pyrop  23.8      45 0.00096   28.0   1.3   17    9-25     34-50  (393)
187 cd05582 STKc_RSK_N N-terminal   23.8      52  0.0011   24.3   1.6   17    8-24    133-149 (318)
188 KOG4236|consensus               23.4      34 0.00074   30.9   0.6   15   10-24    704-718 (888)
189 cd08221 STKc_Nek9 Catalytic do  23.4      50  0.0011   23.0   1.4   16    9-24    137-152 (256)
190 cd05091 PTKc_Ror2 Catalytic do  23.3      45 0.00098   23.8   1.2   16    9-24    160-175 (283)
191 KOG0198|consensus               23.3      52  0.0011   26.3   1.6   54    4-57    149-212 (313)
192 cd06652 STKc_MEKK2 Catalytic d  23.0      46   0.001   23.5   1.1   16    8-23    141-156 (265)
193 PF10134 RPA:  Replication init  23.0      49  0.0011   25.1   1.3   49    8-61    139-187 (229)
194 cd05588 STKc_aPKC Catalytic do  23.0      45 0.00097   25.0   1.1   16    8-23    131-146 (329)
195 KOG0597|consensus               22.9      50  0.0011   30.0   1.5   31    8-42    135-174 (808)
196 cd05578 STKc_Yank1 Catalytic d  22.6      53  0.0012   23.0   1.4   45    8-52    135-184 (258)
197 cd05605 STKc_GRK4_like Catalyt  22.6      54  0.0012   23.7   1.5   16    9-24    138-153 (285)
198 cd05090 PTKc_Ror1 Catalytic do  22.3      53  0.0012   23.5   1.4   17    8-24    159-175 (283)
199 KOG0671|consensus               22.2      99  0.0021   26.3   3.1   18    8-25    247-264 (415)
200 CHL00073 chlN photochlorophyll  22.1      21 0.00045   30.1  -0.9   20   59-78     15-34  (457)
201 KOG1006|consensus               22.1      47   0.001   27.5   1.1   17    8-24    203-219 (361)
202 PF08685 GON:  GON domain;  Int  22.0      48   0.001   25.4   1.1   24    3-26     96-119 (201)
203 cd05146 RIO3_euk RIO kinase fa  22.0      57  0.0012   24.2   1.5   12    9-20    160-171 (197)
204 PLN00017 photosystem I reactio  22.0      33 0.00072   23.4   0.2   14   21-34      5-18  (90)
205 PF06658 DUF1168:  Protein of u  22.0      66  0.0014   23.3   1.8   15   43-57     33-47  (142)
206 cd05057 PTKc_EGFR_like Catalyt  21.7      97  0.0021   22.0   2.6   45    9-53    145-197 (279)
207 cd05042 PTKc_Aatyk Catalytic d  21.7      55  0.0012   23.1   1.3   16    9-24    136-151 (269)
208 cd06606 STKc_MAPKKK Catalytic   21.6      73  0.0016   21.7   1.9   45    9-53    137-189 (260)
209 cd06650 PKc_MEK1 Catalytic dom  21.5      55  0.0012   24.6   1.4   44    9-52    140-187 (333)
210 cd07834 STKc_MAPK Catalytic do  21.5   1E+02  0.0023   22.6   2.8   45    9-53    139-193 (330)
211 cd05097 PTKc_DDR_like Catalyti  21.5      56  0.0012   23.7   1.4   17    8-24    164-180 (295)
212 cd05608 STKc_GRK1 Catalytic do  21.3      60  0.0013   23.4   1.5   44    9-52    133-182 (280)
213 cd05627 STKc_NDR2 Catalytic do  21.1      62  0.0013   24.5   1.6   14    9-22    137-150 (360)
214 cd05573 STKc_ROCK_NDR_like Cat  21.1      59  0.0013   24.1   1.4   17    8-24    136-152 (350)
215 COG4650 RtcR Sigma54-dependent  21.1      49  0.0011   28.0   1.1   16    9-24    151-166 (531)
216 PF08222 HTH_CodY:  CodY helix-  21.0      42 0.00092   21.4   0.5   16   77-92     21-36  (61)
217 PF09178 DUF1945:  Domain of un  20.9      49  0.0011   20.3   0.8   16   28-43     26-41  (51)
218 PF06688 DUF1187:  Protein of u  20.9      57  0.0012   20.8   1.1   16    8-23     44-59  (61)
219 cd05048 PTKc_Ror Catalytic Dom  20.9      51  0.0011   23.4   1.0   46    8-53    159-212 (283)
220 KOG0666|consensus               20.6      56  0.0012   27.7   1.3   15   10-24    173-187 (438)
221 cd05580 STKc_PKA Catalytic dom  20.4      95  0.0021   22.4   2.4   44    9-52    137-183 (290)
222 cd05626 STKc_LATS2 Catalytic d  20.4      63  0.0014   24.8   1.5   14    9-22    137-150 (381)
223 PRK13184 pknD serine/threonine  20.3      88  0.0019   28.9   2.6   15    9-23    149-163 (932)
224 cd05082 PTKc_Csk Catalytic dom  20.3      55  0.0012   22.9   1.1   45    8-52    137-184 (256)
225 cd06612 STKc_MST1_2 Catalytic   20.0      82  0.0018   21.8   1.9   44    9-52    135-184 (256)

No 1  
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=99.96  E-value=1.1e-30  Score=214.05  Aligned_cols=80  Identities=33%  Similarity=0.573  Sum_probs=73.2

Q ss_pred             cCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcCCCCCCCchhHHHHHHHHHhhhhhhhcc
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIESSQLLDVD   87 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~~W~~f~P~TNvlWL~YL~~~l~Ll~~k   87 (93)
                      ..++||||||+|||+..++++++++..+||.||+|.+||||||||.||.+++++|+.|+|.|||||||||.+  +||.++
T Consensus       356 d~GnvtLIDfklsRl~~~q~~isy~rldhp~lF~G~dd~QFeIYrlMr~l~~g~wa~F~P~TNvlWL~yLs~--~llkk~  433 (488)
T COG5072         356 DEGNVTLIDFKLSRLSYSQGIISYNRLDHPDLFNGVDDYQFEIYRLMRRLLKGRWAQFEPITNVLWLYYLSH--QLLKKK  433 (488)
T ss_pred             ecCceEEEEeeeeecccCCceeeccccCchhhhcCccceeeeHHHHHHHHhcCcHHhcccchhhHHHHHHHH--HHHhhc
Confidence            389999999999999999988877777899999999999999999999999999999999999999999999  666555


Q ss_pred             CC
Q psy15902         88 GL   89 (93)
Q Consensus        88 gl   89 (93)
                      -+
T Consensus       434 ~~  435 (488)
T COG5072         434 NL  435 (488)
T ss_pred             cc
Confidence            43


No 2  
>PF12330 DUF3635:  Domain of unknown function (DUF3635);  InterPro: IPR024604 This domain may be a potential Haspin-related leucine-zipper. A leucine zipper was proposed to be present towards the C terminus of human Haspin, (up-stream of the current family) []; however, as this domain would appear to span several helices and be largely within a loop structure [], the actual zipper might be further downstream, and be represented by this entry, which is the very C-terminal part of the Schizosaccharomyces pombe sequence.; PDB: 2WB8_A 3F2N_A 3FMD_A 3DLZ_A 2VUW_A 3IQ7_A 3E7V_A.
Probab=99.95  E-value=2.6e-28  Score=165.55  Aligned_cols=53  Identities=51%  Similarity=0.923  Sum_probs=43.1

Q ss_pred             ccccccCCchhhHHHHHHHHhhcCCCCCCCchhHHHHHHHHHhhhhhhhccCCcc
Q psy15902         37 EELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIESSQLLDVDGLIE   91 (93)
Q Consensus        37 ~~~F~G~gD~QfdiYr~MR~~~~~~W~~f~P~TNvlWL~YL~~~l~Ll~~kgl~~   91 (93)
                      ++||+|+|||||||||+||++++++|+.|+|+|||||||||++  +|+.+++.+.
T Consensus         1 ~~~F~g~gD~QfdiYr~Mr~~~~~~W~~f~P~TNvlWL~YL~~--kLl~~~~~~~   53 (98)
T PF12330_consen    1 EELFEGRGDYQFDIYRLMRSLTKNDWSEFEPKTNVLWLHYLAD--KLLDKKKYKK   53 (98)
T ss_dssp             SGGGS--SSHHHHHHHHHHHHHTT-TTS--THHHHHHHHHHHH--HHHHS--BSS
T ss_pred             CccccCCCccHHHHHHHHHHHhhCcchhcCCHHHHHHHHHHHH--HHHHHccCCC
Confidence            5899999999999999999999999999999999999999999  8887777654


No 3  
>KOG2464|consensus
Probab=97.95  E-value=2.8e-06  Score=64.31  Aligned_cols=73  Identities=23%  Similarity=0.344  Sum_probs=63.9

Q ss_pred             ecccCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcCCCCCCCchhHHHHHHHHHh
Q psy15902          5 TDIRTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIE   79 (93)
Q Consensus         5 ~~~~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~~W~~f~P~TNvlWL~YL~~   79 (93)
                      -|++.++|=|-..+  |...+....+.+..++...+.+.++.|+|+|+.|+......|..|.|.+|+.|++|+.+
T Consensus       162 rdl~~gnili~k~~--~~~~~~~~~~~n~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (246)
T KOG2464|consen  162 RDLHLGNILIKKTG--RLLIPLIKDSINLKDDAKKIKGNGNGVFDIYRLMFVKFDMSASLFKPADNLLWLDYLSD  234 (246)
T ss_pred             cccCcCcEEEeccc--ccccccceeEecchhhhhhhcccceeEEEEeeecccccCcceeccccchhHHHHHHhhc
Confidence            46667777666666  66667778888888899999999999999999999999999999999999999999998


No 4  
>KOG0192|consensus
Probab=89.41  E-value=0.24  Score=39.91  Aligned_cols=49  Identities=27%  Similarity=0.417  Sum_probs=32.6

Q ss_pred             ceecccCCeEEEEeccccccccCCc---e----EEecCCCCccccccC---CchhhHHHHH
Q psy15902          3 ALTDIRTQHFQVENFTISRCFVGEK---I----CYYDLSQDEELFEGE---GDYQFDMYRM   53 (93)
Q Consensus         3 ~~~~~~g~~vTIIDftLSR~~~~~~---~----~f~dL~~d~~~F~G~---gD~QfdiYr~   53 (93)
                      .|++-++..+.|+|||+||......   .    -+.=.  =||+|+++   -+-.-|||--
T Consensus       174 iLv~~~~~~~KI~DFGlsr~~~~~~~~~~~~~GT~~wM--APEv~~~~~~~~~~K~DvySF  232 (362)
T KOG0192|consen  174 ILVDLKGKTLKIADFGLSREKVISKTSMTSVAGTYRWM--APEVLRGEKSPYTEKSDVYSF  232 (362)
T ss_pred             EEEcCCCCEEEECCCccceeeccccccccCCCCCcccc--ChhhhcCCCCcCCccchhhhH
Confidence            3566667899999999999887421   0    11112  58999964   4566666653


No 5  
>KOG0593|consensus
Probab=80.04  E-value=0.66  Score=38.56  Aligned_cols=26  Identities=15%  Similarity=0.234  Sum_probs=18.9

Q ss_pred             ccCCeEEEEeccccccccCCceEEec
Q psy15902          7 IRTQHFQVENFTISRCFVGEKICYYD   32 (93)
Q Consensus         7 ~~g~~vTIIDftLSR~~~~~~~~f~d   32 (93)
                      ++++.|.|||||+.|.-.+.+-.|+|
T Consensus       135 t~~gvvKLCDFGFAR~L~~pgd~YTD  160 (396)
T KOG0593|consen  135 TQNGVVKLCDFGFARTLSAPGDNYTD  160 (396)
T ss_pred             ecCCcEEeccchhhHhhcCCcchhhh
Confidence            46788999999999987744334443


No 6  
>KOG0583|consensus
Probab=78.73  E-value=1.6  Score=35.06  Aligned_cols=37  Identities=19%  Similarity=0.315  Sum_probs=26.3

Q ss_pred             ecccCCeEEEEecccccccc-C--------CceEEecCCCCccccccCCc
Q psy15902          5 TDIRTQHFQVENFTISRCFV-G--------EKICYYDLSQDEELFEGEGD   45 (93)
Q Consensus         5 ~~~~g~~vTIIDftLSR~~~-~--------~~~~f~dL~~d~~~F~G~gD   45 (93)
                      +|....+|.|+|||+|+... .        +...|.    -||+|.|.+.
T Consensus       153 ld~~~~~~Kl~DFG~s~~~~~~~~~l~t~cGsp~Y~----aPEvl~~~~~  198 (370)
T KOG0583|consen  153 LDGNEGNLKLSDFGLSAISPGEDGLLKTFCGSPAYA----APEVLSGKGT  198 (370)
T ss_pred             ecCCCCCEEEeccccccccCCCCCcccCCCCCcccC----CHHHhCCCCC
Confidence            44444899999999999873 2        123444    6899998774


No 7  
>KOG0594|consensus
Probab=77.26  E-value=0.5  Score=38.35  Aligned_cols=54  Identities=19%  Similarity=0.541  Sum_probs=36.6

Q ss_pred             CCeEEEEecccccccc-CC---------------------------------ceEEecCCCCccccccCC--chhhHHHH
Q psy15902          9 TQHFQVENFTISRCFV-GE---------------------------------KICYYDLSQDEELFEGEG--DYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~-~~---------------------------------~~~f~dL~~d~~~F~G~g--D~QfdiYr   52 (93)
                      .+.+.|+||||+|+.. +.                                 +++|..+..-..+|.|.-  |-.+-|+|
T Consensus       156 ~G~lKlaDFGlAra~~ip~~~yt~evvTlWYRaPEvLlGs~~Ys~~vDiWs~GcIfaEm~~~~~LFpG~se~~ql~~If~  235 (323)
T KOG0594|consen  156 SGVLKLADFGLARAFSIPMRTYTPEVVTLWYRAPEVLLGSTSYSTSVDIWSLGCIFAEMFTRRPLFPGDSEIDQLFRIFR  235 (323)
T ss_pred             CCcEeeeccchHHHhcCCcccccccEEEeeccCHHHhcCCCcCCCCcchHhHHHHHHHHHhCCCCCCCCcHHHHHHHHHH
Confidence            6788999999999876 11                                 133344444567787753  45677777


Q ss_pred             HHHHhhcCCC
Q psy15902         53 MMRKQCQNNW   62 (93)
Q Consensus        53 ~MR~~~~~~W   62 (93)
                      .+..-+..+|
T Consensus       236 ~lGtP~e~~W  245 (323)
T KOG0594|consen  236 LLGTPNEKDW  245 (323)
T ss_pred             HcCCCCccCC
Confidence            7777666777


No 8  
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=71.23  E-value=1.7  Score=30.31  Aligned_cols=50  Identities=14%  Similarity=0.142  Sum_probs=31.8

Q ss_pred             eecccCCeEEEEeccccccc-c-C---CceEEecCCCCccccc-c-CCchhhHHHHHH
Q psy15902          4 LTDIRTQHFQVENFTISRCF-V-G---EKICYYDLSQDEELFE-G-EGDYQFDMYRMM   54 (93)
Q Consensus         4 ~~~~~g~~vTIIDftLSR~~-~-~---~~~~f~dL~~d~~~F~-G-~gD~QfdiYr~M   54 (93)
                      +++ ...++.|||||+|... . .   .....+..-..|+..+ + .-+...|||-.=
T Consensus       130 l~~-~~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Di~slG  186 (260)
T PF00069_consen  130 LLD-ENGEVKLIDFGSSVKLSENNENFNPFVGTPEYMAPEVLQQGKKYTRKSDIWSLG  186 (260)
T ss_dssp             EES-TTSEEEESSGTTTEESTSTTSEBSSSSSSGGGSCHHHHTTTSSBSTHHHHHHHH
T ss_pred             ccc-cccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            445 6788999999999752 1 1   1122333334788887 3 456788888653


No 9  
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=71.06  E-value=7  Score=26.95  Aligned_cols=16  Identities=6%  Similarity=0.183  Sum_probs=13.5

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      +.++++|||++++...
T Consensus       125 ~~~~~liDfg~a~~~~  140 (199)
T TIGR03724       125 DDKLYLIDFGLGKYSD  140 (199)
T ss_pred             CCcEEEEECCCCcCCC
Confidence            6789999999998744


No 10 
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=71.01  E-value=4.6  Score=29.43  Aligned_cols=46  Identities=13%  Similarity=0.242  Sum_probs=27.3

Q ss_pred             cCCeEEEEeccccccccCCc--------eEEecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      ....+.|+|||+||.-....        .+.+-.-.-||.+.|.+  +.+-|||-.
T Consensus       147 ~~~~~kl~DfG~a~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~DiwSl  202 (317)
T cd07867         147 ERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAI  202 (317)
T ss_pred             CCCcEEEeeccceeccCCCcccccccCcceecccccCcHHhcCCCccCcHHHHHhH
Confidence            34679999999998643211        11111112588777643  456777763


No 11 
>PRK14879 serine/threonine protein kinase; Provisional
Probab=70.84  E-value=7  Score=27.13  Aligned_cols=15  Identities=7%  Similarity=0.129  Sum_probs=12.7

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      +..+.||||++++..
T Consensus       130 ~~~~~liDf~~a~~~  144 (211)
T PRK14879        130 GGKIYLIDFGLAEFS  144 (211)
T ss_pred             CCCEEEEECCcccCC
Confidence            567899999999873


No 12 
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=68.51  E-value=5  Score=29.44  Aligned_cols=45  Identities=13%  Similarity=0.228  Sum_probs=25.8

Q ss_pred             cCCeEEEEeccccccccCCc--------eEEecCCCCccccccCC--chhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGEG--DYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~g--D~QfdiYr   52 (93)
                      ....|.|+|||+||.-....        .+.+.--.-||.+.|..  +..-|||-
T Consensus       147 ~~~~~kl~DfG~a~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~Diws  201 (317)
T cd07868         147 ERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWA  201 (317)
T ss_pred             CcCcEEEeecCceeccCCCCccccccCCccccccccCCHHHcCCCCcCchhhHHH
Confidence            34679999999998643211        11111112578777643  44556665


No 13 
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=68.10  E-value=5.1  Score=28.96  Aligned_cols=50  Identities=20%  Similarity=0.272  Sum_probs=29.5

Q ss_pred             eecccCCeEEEEeccccccccCCce-----EEecCCCCccccccC--CchhhHHHHH
Q psy15902          4 LTDIRTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         4 ~~~~~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      +++-.+..|.|+|||+++.......     +.+-.-..||.+.|.  -+.+.|||..
T Consensus       134 ll~~~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl  190 (294)
T PLN00009        134 LIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDIWSV  190 (294)
T ss_pred             EEECCCCEEEEcccccccccCCCccccccCceeecccCHHHHhCCCCCCcHHHHHHH
Confidence            4444567899999999986432111     111111257777663  3567888873


No 14 
>KOG0581|consensus
Probab=67.36  E-value=2.7  Score=34.84  Aligned_cols=18  Identities=17%  Similarity=0.337  Sum_probs=15.4

Q ss_pred             cCCeEEEEeccccccccC
Q psy15902          8 RTQHFQVENFTISRCFVG   25 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~   25 (93)
                      +.++|+|||||-|+.-.+
T Consensus       214 skGeVKicDFGVS~~lvn  231 (364)
T KOG0581|consen  214 SKGEVKICDFGVSGILVN  231 (364)
T ss_pred             cCCCEEeccccccHHhhh
Confidence            578999999999997664


No 15 
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=63.46  E-value=5.1  Score=28.18  Aligned_cols=16  Identities=0%  Similarity=-0.172  Sum_probs=13.1

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      +.++.|||||+++.-.
T Consensus       153 ~~~~~liDFG~a~~~~  168 (190)
T cd05145         153 DGKPYIIDVSQAVELD  168 (190)
T ss_pred             CCCEEEEEcccceecC
Confidence            5789999999997543


No 16 
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=63.07  E-value=7.1  Score=29.42  Aligned_cols=45  Identities=13%  Similarity=0.199  Sum_probs=26.6

Q ss_pred             cCCeEEEEeccccccccCCc----eEEecCCCCccccccCC-chhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGEG-DYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~g-D~QfdiYr   52 (93)
                      ++..+.|+|||++|......    .+-+..-.-||.+.|.+ +.+-|||-
T Consensus       154 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~Diws  203 (355)
T cd07874         154 SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWS  203 (355)
T ss_pred             CCCCEEEeeCcccccCCCccccCCccccCCccCHHHHcCCCCCchhhHHH
Confidence            35679999999999654321    11122223577777642 45556665


No 17 
>KOG0199|consensus
Probab=61.31  E-value=4.7  Score=37.04  Aligned_cols=17  Identities=12%  Similarity=0.323  Sum_probs=13.8

Q ss_pred             CeEEEEeccccccccCC
Q psy15902         10 QHFQVENFTISRCFVGE   26 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~~   26 (93)
                      --|+|+||||+|+-.++
T Consensus       249 rtVKI~DFGLmRaLg~n  265 (1039)
T KOG0199|consen  249 RTVKICDFGLMRALGEN  265 (1039)
T ss_pred             ceeeeecccceeccCCC
Confidence            35899999999987643


No 18 
>KOG1187|consensus
Probab=61.18  E-value=5.7  Score=31.74  Aligned_cols=39  Identities=10%  Similarity=0.066  Sum_probs=25.5

Q ss_pred             ceecccCCeEEEEeccccccccC-CceEEec----C-CCCcccccc
Q psy15902          3 ALTDIRTQHFQVENFTISRCFVG-EKICYYD----L-SQDEELFEG   42 (93)
Q Consensus         3 ~~~~~~g~~vTIIDftLSR~~~~-~~~~f~d----L-~~d~~~F~G   42 (93)
                      .|+| +..++.|+||||+|.... ...+.+.    . --+|+..+.
T Consensus       208 ILLD-~~~~aKlsDFGLa~~~~~~~~~~~~~~~gt~gY~~PEy~~~  252 (361)
T KOG1187|consen  208 ILLD-EDFNAKLSDFGLAKLGPEGDTSVSTTVMGTFGYLAPEYAST  252 (361)
T ss_pred             eeEC-CCCCEEccCccCcccCCccccceeeecCCCCccCChhhhcc
Confidence            3566 789999999999987765 3322221    0 126888764


No 19 
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=59.46  E-value=9  Score=28.03  Aligned_cols=46  Identities=11%  Similarity=0.268  Sum_probs=27.3

Q ss_pred             cCCeEEEEeccccccccCCceEE--ecCCCCccccccCC-chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICY--YDLSQDEELFEGEG-DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f--~dL~~d~~~F~G~g-D~QfdiYr~   53 (93)
                      +...+.|+|||+++...+.....  +..-.-||++.+.+ +.+-|||-.
T Consensus       136 ~~~~~kl~Dfg~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwSl  184 (291)
T cd05612         136 KEGHIKLTDFGFAKKLRDRTWTLCGTPEYLAPEVIQSKGHNKAVDWWAL  184 (291)
T ss_pred             CCCCEEEEecCcchhccCCcccccCChhhcCHHHHcCCCCCchhhHHHH
Confidence            35689999999998655432111  00012578887743 556677653


No 20 
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=58.81  E-value=9.6  Score=31.21  Aligned_cols=42  Identities=14%  Similarity=0.339  Sum_probs=26.6

Q ss_pred             cCCeEEEEeccccccccCC-----------ceEEecCCCCccccccC-CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGE-----------KICYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~-----------~~~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      +..++.|+|||+||.....           ...|.    -||.+.+. -+.+-|||-.
T Consensus       178 ~~~~vkL~DFGls~~~~~~~~~~~~~~~~Gt~~Y~----aPE~~~~~~~s~k~DVwSl  231 (496)
T PTZ00283        178 SNGLVKLGDFGFSKMYAATVSDDVGRTFCGTPYYV----APEIWRRKPYSKKADMFSL  231 (496)
T ss_pred             CCCCEEEEecccCeeccccccccccccccCCccee----CHHHhCCCCCCcHHHHHHH
Confidence            3567999999999864321           12232    57777763 3566777753


No 21 
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=56.12  E-value=13  Score=28.19  Aligned_cols=46  Identities=11%  Similarity=0.158  Sum_probs=27.0

Q ss_pred             cCCeEEEEeccccccccCCc----eEEecCCCCccccccC-CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      +++.+.|+|||+++......    ..-+..-.-||.+.|. -+.+-|||-.
T Consensus       158 ~~~~~kl~Dfg~a~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~DiwSl  208 (359)
T cd07876         158 SDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSV  208 (359)
T ss_pred             CCCCEEEecCCCccccccCccCCCCcccCCCCCchhccCCCCCcchhhHHH
Confidence            35689999999998654321    1112212357777763 3455666654


No 22 
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=55.68  E-value=4.9  Score=30.93  Aligned_cols=20  Identities=5%  Similarity=0.007  Sum_probs=16.0

Q ss_pred             ccCCeEEEEeccccccccCC
Q psy15902          7 IRTQHFQVENFTISRCFVGE   26 (93)
Q Consensus         7 ~~g~~vTIIDftLSR~~~~~   26 (93)
                      +++.++-+|||||+..+...
T Consensus       125 l~~~~i~~IDfGLg~~s~~~  144 (204)
T COG3642         125 LSGGRIYFIDFGLGEFSDEV  144 (204)
T ss_pred             EeCCcEEEEECCcccccccH
Confidence            45677999999999977644


No 23 
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=55.40  E-value=11  Score=28.55  Aligned_cols=45  Identities=11%  Similarity=0.121  Sum_probs=26.5

Q ss_pred             cCCeEEEEeccccccccCCc----eEEecCCCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      .+..+.|+|||++|......    .+-+..-.-||.+.|. -+..-|||-
T Consensus       161 ~~~~~kL~DfG~a~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~DiwS  210 (364)
T cd07875         161 SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWS  210 (364)
T ss_pred             CCCcEEEEeCCCccccCCCCcccCCcccCCcCCHHHHhCCCCCchhhHHh
Confidence            35679999999998654321    1111111257777764 345667665


No 24 
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=54.24  E-value=19  Score=25.95  Aligned_cols=45  Identities=9%  Similarity=0.140  Sum_probs=26.6

Q ss_pred             CCeEEEEeccccccccCCc-----eEEecCCCCccccccCC--chhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      ..++.|+|||+++......     .+.+-.-.-|+.+.|..  +.+-|||-.
T Consensus       139 ~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl  190 (291)
T cd07870         139 LGELKLADFGLARAKSIPSQTYSSEVVTLWYRPPDVLLGATDYSSALDIWGA  190 (291)
T ss_pred             CCcEEEeccccccccCCCCCCCCCccccccccCCceeecCCCCCcHHHHHHH
Confidence            4579999999998643211     11111112577776532  456788874


No 25 
>KOG0984|consensus
Probab=53.71  E-value=6.5  Score=31.43  Aligned_cols=17  Identities=24%  Similarity=0.397  Sum_probs=14.1

Q ss_pred             CCeEEEEeccccccccC
Q psy15902          9 TQHFQVENFTISRCFVG   25 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~   25 (93)
                      .++|.|||||.|-.-.+
T Consensus       185 ~GqVKiCDFGIsG~L~d  201 (282)
T KOG0984|consen  185 DGQVKICDFGISGYLVD  201 (282)
T ss_pred             CCcEEEcccccceeehh
Confidence            46899999999987664


No 26 
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=52.13  E-value=14  Score=25.69  Aligned_cols=44  Identities=7%  Similarity=-0.044  Sum_probs=26.6

Q ss_pred             CeEEEEeccccccccCCceEEec-CCCCccccccC---CchhhHHHHH
Q psy15902         10 QHFQVENFTISRCFVGEKICYYD-LSQDEELFEGE---GDYQFDMYRM   53 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~~~~~f~d-L~~d~~~F~G~---gD~QfdiYr~   53 (93)
                      ..+.|+|||+++........-.. .-.-|+.+.+.   -..+-|||-.
T Consensus       145 ~~~kl~Dfg~a~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~~Di~sl  192 (259)
T cd05037         145 PFIKLSDPGIPITVLSREERVERIPWIAPECIRNGQASLTIAADKWSF  192 (259)
T ss_pred             eeEEeCCCCcccccccccccccCCCccChhhhcCCCCCcchhhHHHHH
Confidence            36999999999874432110000 01258888765   3567888874


No 27 
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=51.63  E-value=11  Score=25.68  Aligned_cols=17  Identities=0%  Similarity=-0.160  Sum_probs=13.4

Q ss_pred             CCeEEEEeccccccccC
Q psy15902          9 TQHFQVENFTISRCFVG   25 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~   25 (93)
                      +..+.|||||+++-..+
T Consensus       150 ~~~~~liDfg~a~~~~~  166 (187)
T cd05119         150 DGKVYIIDVPQAVEIDH  166 (187)
T ss_pred             CCcEEEEECcccccccC
Confidence            67889999999975443


No 28 
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=51.28  E-value=9.1  Score=27.38  Aligned_cols=13  Identities=8%  Similarity=0.064  Sum_probs=11.0

Q ss_pred             CCeEEEEeccccc
Q psy15902          9 TQHFQVENFTISR   21 (93)
Q Consensus         9 g~~vTIIDftLSR   21 (93)
                      +.+|.|||||+|-
T Consensus       153 ~~~v~LiDFG~a~  165 (190)
T cd05147         153 DGKLYIIDVSQSV  165 (190)
T ss_pred             CCcEEEEEccccc
Confidence            3579999999985


No 29 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=50.62  E-value=16  Score=26.58  Aligned_cols=45  Identities=11%  Similarity=0.162  Sum_probs=25.7

Q ss_pred             CCeEEEEeccccccccCCc-----eEEecCCCCccccccC--CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      ..++.|+|||+++......     .+-+-.-.-||++.|.  -...-|||-.
T Consensus       139 ~~~~kl~DfG~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl  190 (288)
T cd07871         139 KGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGV  190 (288)
T ss_pred             CCCEEECcCcceeeccCCCccccCceecccccChHHhcCCcccCcHHHHHHH
Confidence            4579999999998654221     1111111247777653  2456676653


No 30 
>KOG0663|consensus
Probab=50.21  E-value=8.3  Score=32.49  Aligned_cols=65  Identities=17%  Similarity=0.412  Sum_probs=39.8

Q ss_pred             cceecccCCeEEEEeccccccccCC--------ceEEec--------------------------CCCCccccccCC--c
Q psy15902          2 SALTDIRTQHFQVENFTISRCFVGE--------KICYYD--------------------------LSQDEELFEGEG--D   45 (93)
Q Consensus         2 ~~~~~~~g~~vTIIDftLSR~~~~~--------~~~f~d--------------------------L~~d~~~F~G~g--D   45 (93)
                      |-++=.+.+.+.|+||||.|.--..        -++|++                          +-...-+|.|++  |
T Consensus       206 SNLLm~~~G~lKiaDFGLAR~ygsp~k~~T~lVVTLWYRaPELLLG~~tyst~iDMWSvGCI~aE~l~~kPlf~G~sE~d  285 (419)
T KOG0663|consen  206 SNLLLSHKGILKIADFGLAREYGSPLKPYTPLVVTLWYRAPELLLGAKTYSTAVDMWSVGCIFAELLTQKPLFPGKSEID  285 (419)
T ss_pred             hheeeccCCcEEecccchhhhhcCCcccCcceEEEeeecCHHHhcCCcccCcchhhhhHHHHHHHHHhcCCCCCCCchHH
Confidence            4455567789999999999975432        123332                          223445677755  3


Q ss_pred             hhhHHHHHHHHhhcCCCCCCC
Q psy15902         46 YQFDMYRMMRKQCQNNWQNFT   66 (93)
Q Consensus        46 ~QfdiYr~MR~~~~~~W~~f~   66 (93)
                      --..|++.|=.=+...|..|.
T Consensus       286 Ql~~If~llGtPte~iwpg~~  306 (419)
T KOG0663|consen  286 QLDKIFKLLGTPSEAIWPGYS  306 (419)
T ss_pred             HHHHHHHHhCCCccccCCCcc
Confidence            333466666665667886654


No 31 
>PHA02882 putative serine/threonine kinase; Provisional
Probab=49.44  E-value=18  Score=26.53  Aligned_cols=64  Identities=14%  Similarity=0.145  Sum_probs=34.0

Q ss_pred             CCeEEEEeccccccccCCc----------eEE--ecCCCCccccccC-CchhhHHHHH---HHHhh--cCCCCCCCchhH
Q psy15902          9 TQHFQVENFTISRCFVGEK----------ICY--YDLSQDEELFEGE-GDYQFDMYRM---MRKQC--QNNWQNFTPKNN   70 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~----------~~f--~dL~~d~~~F~G~-gD~QfdiYr~---MR~~~--~~~W~~f~P~TN   70 (93)
                      ..++.|+|||+||.-....          ..+  +..-.-|+.+.|. -+.+-|||..   |=.+.  +-.|+.+....+
T Consensus       162 ~~~~~l~DFGla~~~~~~~~~~~~~~~~~~~~~gt~~y~ape~~~~~~~~~~~DiwSlG~~l~el~~g~~P~~~~~~~~~  241 (294)
T PHA02882        162 NNRGYIIDYGIASHFIIHGKHIEYSKEQKDLHRGTLYYAGLDAHNGACVTRRGDLESLGYCMLKWAGIKLPWKGFGHNGN  241 (294)
T ss_pred             CCcEEEEEcCCceeeccCCcccccccccccccCCCccccCHHHhCCCCCCcHHHHHHHHHHHHHHHhCCCCCCccccchH
Confidence            4578899999998542110          000  0000146666653 3567788874   22222  357777755455


Q ss_pred             HH
Q psy15902         71 AL   72 (93)
Q Consensus        71 vl   72 (93)
                      ++
T Consensus       242 ~~  243 (294)
T PHA02882        242 LI  243 (294)
T ss_pred             HH
Confidence            43


No 32 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=48.92  E-value=13  Score=27.13  Aligned_cols=44  Identities=14%  Similarity=0.185  Sum_probs=24.5

Q ss_pred             CCeEEEEeccccccccCCc-----eEEecCCCCccccccCC--chhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGEG--DYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~g--D~QfdiYr   52 (93)
                      ..++.|+|||+++......     ...+..-.-||++.+..  +..-|||-
T Consensus       139 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diws  189 (303)
T cd07869         139 TGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWG  189 (303)
T ss_pred             CCCEEECCCCcceeccCCCccCCCCcccCCCCChHHHcCCCCCCcHHHHHH
Confidence            4679999999998643221     11111112577776543  33456555


No 33 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=48.83  E-value=19  Score=26.36  Aligned_cols=45  Identities=13%  Similarity=0.186  Sum_probs=26.6

Q ss_pred             CCeEEEEeccccccccCCce-----EEecCCCCccccccC--CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      ..++.|+|||+++.......     +-+-.-.-|+.+.+.  -+.+-|||..
T Consensus       140 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl  191 (309)
T cd07872         140 RGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGV  191 (309)
T ss_pred             CCCEEECccccceecCCCccccccccccccccCCHHHhCCCCCCcHHHHHHH
Confidence            45799999999986542211     111111257777653  3567788764


No 34 
>PRK09188 serine/threonine protein kinase; Provisional
Probab=48.53  E-value=11  Score=30.47  Aligned_cols=15  Identities=20%  Similarity=0.390  Sum_probs=12.4

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      ..++.|||||+||..
T Consensus       148 ~~~ikLiDFGlA~~~  162 (365)
T PRK09188        148 DGEAAVIDFQLASVF  162 (365)
T ss_pred             CCCEEEEECccceec
Confidence            457999999999944


No 35 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=48.51  E-value=11  Score=30.20  Aligned_cols=50  Identities=16%  Similarity=0.317  Sum_probs=28.5

Q ss_pred             ceecccCCeEEEEeccccccccCCc--e--EEecCCCCccccccCC--chhhHHHH
Q psy15902          3 ALTDIRTQHFQVENFTISRCFVGEK--I--CYYDLSQDEELFEGEG--DYQFDMYR   52 (93)
Q Consensus         3 ~~~~~~g~~vTIIDftLSR~~~~~~--~--~f~dL~~d~~~F~G~g--D~QfdiYr   52 (93)
                      .+++-.+..|.|+|||+|+.-..+.  .  +-+..-.-|+++.|..  +..-|||-
T Consensus       201 ILl~~~~~~vkL~DFGla~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~DiwS  256 (440)
T PTZ00036        201 LLIDPNTHTLKLCDFGSAKNLLAGQRSVSYICSRFYRAPELMLGATNYTTHIDLWS  256 (440)
T ss_pred             EEEcCCCCceeeeccccchhccCCCCcccCCCCcCccCHHHhcCCCCCCcHHHHHH
Confidence            3556567789999999998643221  1  1111112577766532  34566665


No 36 
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=48.33  E-value=21  Score=22.97  Aligned_cols=45  Identities=16%  Similarity=0.250  Sum_probs=28.2

Q ss_pred             CCeEEEEeccccccccCCc-----eEEecCCCCcccccc--CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEG--EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G--~gD~QfdiYr~   53 (93)
                      +.++.|+||++++......     .........|+.+.+  ..+.+.|+|..
T Consensus       129 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~~pe~~~~~~~~~~~~D~~~l  180 (215)
T cd00180         129 NGKVKLADFGLSKLLTSDKSLLKTIVGTPAYMAPEVLLGKGYYSEKSDIWSL  180 (215)
T ss_pred             CCcEEEecCCceEEccCCcchhhcccCCCCccChhHhcccCCCCchhhhHHH
Confidence            5789999999998665432     122222235677665  44566777764


No 37 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=47.82  E-value=9.3  Score=28.70  Aligned_cols=18  Identities=17%  Similarity=0.350  Sum_probs=14.2

Q ss_pred             cCCeEEEEeccccccccC
Q psy15902          8 RTQHFQVENFTISRCFVG   25 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~   25 (93)
                      +..++.|+|||+++...+
T Consensus       153 ~~~~~kl~Dfg~~~~~~~  170 (329)
T PTZ00263        153 NKGHVKVTDFGFAKKVPD  170 (329)
T ss_pred             CCCCEEEeeccCceEcCC
Confidence            456799999999986543


No 38 
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=47.57  E-value=16  Score=26.59  Aligned_cols=16  Identities=6%  Similarity=0.260  Sum_probs=12.8

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ...+.|+|||+|+...
T Consensus       138 ~~~~kl~Dfg~~~~~~  153 (285)
T cd05631         138 RGHIRISDLGLAVQIP  153 (285)
T ss_pred             CCCEEEeeCCCcEEcC
Confidence            4569999999998643


No 39 
>PHA02988 hypothetical protein; Provisional
Probab=46.92  E-value=12  Score=27.52  Aligned_cols=40  Identities=10%  Similarity=0.280  Sum_probs=23.8

Q ss_pred             CCeEEEEeccccccccCC------ceEEecCCCCcccccc---CCchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGE------KICYYDLSQDEELFEG---EGDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~------~~~f~dL~~d~~~F~G---~gD~QfdiYr   52 (93)
                      +..+.|+|||+++...+.      ...|.    .|++..+   .-+.+-|||-
T Consensus       159 ~~~~kl~dfg~~~~~~~~~~~~~~~~~y~----aPE~~~~~~~~~~~k~Di~S  207 (283)
T PHA02988        159 NYKLKIICHGLEKILSSPPFKNVNFMVYF----SYKMLNDIFSEYTIKDDIYS  207 (283)
T ss_pred             CCcEEEcccchHhhhccccccccCccccc----CHHHhhhccccccchhhhhH
Confidence            467999999999964321      22332    4666654   2244556654


No 40 
>KOG0197|consensus
Probab=46.55  E-value=12  Score=31.87  Aligned_cols=17  Identities=12%  Similarity=0.282  Sum_probs=13.6

Q ss_pred             CCeEEEEeccccccccC
Q psy15902          9 TQHFQVENFTISRCFVG   25 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~   25 (93)
                      +.-|+|.||||+|...+
T Consensus       339 ~~~vKIsDFGLAr~~~d  355 (468)
T KOG0197|consen  339 DLVVKISDFGLARLIGD  355 (468)
T ss_pred             CceEEEcccccccccCC
Confidence            45899999999996443


No 41 
>KOG0659|consensus
Probab=46.11  E-value=14  Score=30.15  Aligned_cols=36  Identities=17%  Similarity=0.299  Sum_probs=25.9

Q ss_pred             cCCeEEEEeccccccccCC-----ceEEecCCCCccccccC
Q psy15902          8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGE   43 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~   43 (93)
                      +.+.++|.||||+|.-...     ..|+++.=.-||++-|.
T Consensus       136 ~~g~lKiADFGLAr~f~~p~~~~~~~V~TRWYRAPELLfGs  176 (318)
T KOG0659|consen  136 SDGQLKIADFGLARFFGSPNRIQTHQVVTRWYRAPELLFGS  176 (318)
T ss_pred             CCCcEEeecccchhccCCCCcccccceeeeeccChHHhccc
Confidence            5678999999999977632     23677776677766553


No 42 
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=46.06  E-value=19  Score=25.89  Aligned_cols=45  Identities=11%  Similarity=0.188  Sum_probs=25.9

Q ss_pred             cCCeEEEEeccccccccCC-----ceEEecCCCCccccccCC--chhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGEG--DYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~g--D~QfdiYr   52 (93)
                      +...+.|+|||++|.....     ....+..-.-|+.+.|..  +.+-|||.
T Consensus       138 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Dv~s  189 (291)
T cd07844         138 ERGELKLADFGLARAKSVPSKTYSNEVVTLWYRPPDVLLGSTEYSTSLDMWG  189 (291)
T ss_pred             CCCCEEECccccccccCCCCccccccccccccCCcHHhhcCcccCcHHHHHH
Confidence            3457999999999865311     111121123578776533  44567765


No 43 
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=46.04  E-value=21  Score=25.07  Aligned_cols=45  Identities=24%  Similarity=0.248  Sum_probs=27.2

Q ss_pred             CCeEEEEeccccccccCCceEEec-CCCCccccccCC-chhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYD-LSQDEELFEGEG-DYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~d-L~~d~~~F~G~g-D~QfdiYr~   53 (93)
                      ..++.|+||++++........... .-.-|+.+++.. +..-|||..
T Consensus       133 ~~~~~l~dfg~~~~~~~~~~~~~~~~y~~pe~~~~~~~~~~~Dv~sl  179 (260)
T cd05611         133 TGHLKLTDFGLSRNGLENKKFVGTPDYLAPETILGVGDDKMSDWWSL  179 (260)
T ss_pred             CCcEEEeecccceeccccccCCCCcCccChhhhcCCCCcchhhhHHH
Confidence            457999999999976532211111 112577777643 566777764


No 44 
>KOG1026|consensus
Probab=46.03  E-value=10  Score=34.29  Aligned_cols=17  Identities=18%  Similarity=0.329  Sum_probs=14.7

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      .+..|+|.||||||--+
T Consensus       638 e~l~VKIsDfGLsRdiY  654 (774)
T KOG1026|consen  638 ENLVVKISDFGLSRDIY  654 (774)
T ss_pred             cceEEEecccccchhhh
Confidence            36789999999999776


No 45 
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=45.99  E-value=19  Score=26.51  Aligned_cols=17  Identities=18%  Similarity=0.493  Sum_probs=13.7

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      +...+.|+|||+++...
T Consensus       144 ~~~~~kl~DfG~a~~~~  160 (316)
T cd05108         144 TPQHVKITDFGLAKLLG  160 (316)
T ss_pred             CCCcEEEcccccccccc
Confidence            34679999999999654


No 46 
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=45.45  E-value=17  Score=27.27  Aligned_cols=45  Identities=11%  Similarity=0.231  Sum_probs=25.0

Q ss_pred             cCCeEEEEeccccccccCCceE---E--ecCCCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKIC---Y--YDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~---f--~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      .+..+.|+|||+++........   +  +..---||.+.+. -+..-|||-
T Consensus       130 ~~~~~kL~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwS  180 (323)
T cd05595         130 KDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWG  180 (323)
T ss_pred             CCCCEEecccHHhccccCCCCccccccCCcCcCCcccccCCCCCchhchhh
Confidence            3467999999999864321110   0  1111257777653 345566665


No 47 
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=45.25  E-value=14  Score=27.54  Aligned_cols=45  Identities=11%  Similarity=0.163  Sum_probs=24.0

Q ss_pred             cCCeEEEEeccccccccCCceE---E--ecCCCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKIC---Y--YDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~---f--~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ....+.|+|||+++........   +  +-.-.-||.+.+. -+.+-|||-
T Consensus       135 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~Diws  185 (323)
T cd05584         135 AQGHVKLTDFGLCKESIHEGTVTHTFCGTIEYMAPEILMRSGHGKAVDWWS  185 (323)
T ss_pred             CCCCEEEeeCcCCeecccCCCcccccCCCccccChhhccCCCCCCcceecc
Confidence            3467999999999854322110   0  0001247777653 234555554


No 48 
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=44.00  E-value=16  Score=27.92  Aligned_cols=46  Identities=11%  Similarity=0.216  Sum_probs=27.3

Q ss_pred             cCCeEEEEeccccccccCCc------eEEecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      .+..+.|+|||++|......      .+.+..-.-||.+.|..  +..-|||-.
T Consensus       138 ~~~~~kL~Dfg~a~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl  191 (372)
T cd07853         138 SNCVLKICDFGLARVEEPDESKHMTQEVVTQYYRAPEILMGSRHYTSAVDIWSV  191 (372)
T ss_pred             CCCCEEeccccceeecccCccccCCCCCcCCCcCCHHHHcCCCCCCcHHHHHhH
Confidence            34689999999999754221      11111112577777643  455677764


No 49 
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=43.65  E-value=14  Score=28.15  Aligned_cols=17  Identities=6%  Similarity=0.309  Sum_probs=13.6

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ...++.|+|||+++...
T Consensus       166 ~~~~ikL~DFG~a~~~~  182 (340)
T PTZ00426        166 KDGFIKMTDFGFAKVVD  182 (340)
T ss_pred             CCCCEEEecCCCCeecC
Confidence            45689999999998643


No 50 
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=43.04  E-value=29  Score=24.62  Aligned_cols=46  Identities=11%  Similarity=0.250  Sum_probs=27.3

Q ss_pred             cCCeEEEEeccccccccCC-----ceEEecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      +..++.|+|||+++.....     ..+.+..-.-|+.+.+..  +.+-|||..
T Consensus       135 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl  187 (284)
T cd07836         135 KRGELKLADFGLARAFGIPVNTFSNEVVTLWYRAPDVLLGSRTYSTSIDIWSV  187 (284)
T ss_pred             CCCcEEEeecchhhhhcCCccccccccccccccChHHhcCCCCCCcHHHHHHH
Confidence            4568999999999854321     111111112577776642  457777774


No 51 
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=43.01  E-value=25  Score=25.52  Aligned_cols=17  Identities=24%  Similarity=0.354  Sum_probs=13.4

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      +...+.|+|||+++.-.
T Consensus       150 ~~~~~kL~dfg~~~~~~  166 (296)
T cd06618         150 ASGNVKLCDFGISGRLV  166 (296)
T ss_pred             CCCCEEECccccchhcc
Confidence            45689999999997543


No 52 
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=42.90  E-value=22  Score=25.34  Aligned_cols=46  Identities=13%  Similarity=0.223  Sum_probs=26.8

Q ss_pred             cCCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      ...++.|+|||+++.......     +.+-.-.-||.+.|..  +.+-|||..
T Consensus       134 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl  186 (284)
T cd07839         134 KNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSA  186 (284)
T ss_pred             CCCcEEECccchhhccCCCCCCcCCCccccCCcChHHHhCCcccCcHHHHHHH
Confidence            346799999999985432110     1111112577776642  567788765


No 53 
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=42.53  E-value=23  Score=24.96  Aligned_cols=46  Identities=17%  Similarity=0.312  Sum_probs=28.0

Q ss_pred             cCCeEEEEeccccccccCCceEEec-----CCCCccccccC--CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYD-----LSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~d-----L~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      .+..+.|+||++++........+..     .-.-|+.+.+.  -+.+-|+|-.
T Consensus       133 ~~~~~~l~df~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~~Di~sl  185 (283)
T cd05118         133 TEGVLKLADFGLARSFGSPVRPYTHYVVTRWYRAPELLLGDKGYSTPVDIWSV  185 (283)
T ss_pred             CCCcEEEeeeeeeEecCCCcccccCccCcccccCcHHHhcCCCCCchhHHHHH
Confidence            4567999999999866543311111     11257777654  3567777774


No 54 
>KOG0658|consensus
Probab=42.41  E-value=19  Score=29.88  Aligned_cols=23  Identities=22%  Similarity=0.322  Sum_probs=19.2

Q ss_pred             ceecccCCeEEEEeccccccccC
Q psy15902          3 ALTDIRTQHFQVENFTISRCFVG   25 (93)
Q Consensus         3 ~~~~~~g~~vTIIDftLSR~~~~   25 (93)
                      .|+|-..+.+.|||||.++.-..
T Consensus       156 lLvD~~tg~LKicDFGSAK~L~~  178 (364)
T KOG0658|consen  156 LLVDPDTGVLKICDFGSAKVLVK  178 (364)
T ss_pred             EEEcCCCCeEEeccCCcceeecc
Confidence            47888889999999999986653


No 55 
>KOG0194|consensus
Probab=42.39  E-value=14  Score=31.40  Aligned_cols=14  Identities=21%  Similarity=0.358  Sum_probs=12.3

Q ss_pred             eEEEEecccccccc
Q psy15902         11 HFQVENFTISRCFV   24 (93)
Q Consensus        11 ~vTIIDftLSR~~~   24 (93)
                      -|.|.||||||...
T Consensus       300 ~vKISDFGLs~~~~  313 (474)
T KOG0194|consen  300 VVKISDFGLSRAGS  313 (474)
T ss_pred             eEEeCccccccCCc
Confidence            37999999999885


No 56 
>KOG0667|consensus
Probab=41.45  E-value=18  Score=31.77  Aligned_cols=17  Identities=18%  Similarity=0.081  Sum_probs=14.3

Q ss_pred             CeEEEEeccccccccCC
Q psy15902         10 QHFQVENFTISRCFVGE   26 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~~   26 (93)
                      -+|.|||||.|......
T Consensus       328 ~~vKVIDFGSSc~~~q~  344 (586)
T KOG0667|consen  328 SRIKVIDFGSSCFESQR  344 (586)
T ss_pred             CceeEEecccccccCCc
Confidence            48999999999987753


No 57 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=41.43  E-value=29  Score=24.82  Aligned_cols=46  Identities=15%  Similarity=0.097  Sum_probs=26.1

Q ss_pred             CCeEEEEeccccccccCCceEEecC-------CCCcccccc-CCchhhHHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYDL-------SQDEELFEG-EGDYQFDMYRMM   54 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~dL-------~~d~~~F~G-~gD~QfdiYr~M   54 (93)
                      ..++.|+|||+++........+...       -.-|+...+ .-+..-|||...
T Consensus       145 ~~~~kL~dfG~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~slG  198 (279)
T cd05109         145 PNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILHRRFTHQSDVWSYG  198 (279)
T ss_pred             CCcEEECCCCceeecccccceeecCCCccchhhCCHHHhccCCCCchhHHHHHH
Confidence            4569999999998654222111100       013555543 346677888853


No 58 
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=41.15  E-value=40  Score=23.99  Aligned_cols=45  Identities=13%  Similarity=0.231  Sum_probs=26.7

Q ss_pred             CCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      +..+.|+||++++.......     +.+-.-.-|+.+.+..  +.+-|||..
T Consensus       135 ~~~~~l~df~~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~sl  186 (283)
T cd07835         135 EGALKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGSRQYSTPVDIWSI  186 (283)
T ss_pred             CCcEEEeecccccccCCCccccCccccccCCCCCceeecCcccCcHHHHHHH
Confidence            56899999999985431111     1111112577776543  567888874


No 59 
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=40.68  E-value=30  Score=24.93  Aligned_cols=50  Identities=16%  Similarity=0.211  Sum_probs=29.2

Q ss_pred             eecccCCeEEEEeccccccccCCceEEecC--CCCccccccC-CchhhHHHHHH
Q psy15902          4 LTDIRTQHFQVENFTISRCFVGEKICYYDL--SQDEELFEGE-GDYQFDMYRMM   54 (93)
Q Consensus         4 ~~~~~g~~vTIIDftLSR~~~~~~~~f~dL--~~d~~~F~G~-gD~QfdiYr~M   54 (93)
                      +++-.+..+.|+|||+++....... +...  ---|+.+++. -+..-|||...
T Consensus       141 l~~~~~~~~~l~dfg~~~~~~~~~~-~~~~~~y~aPE~~~~~~~~~~~DvwslG  193 (267)
T PHA03390        141 LYDRAKDRIYLCDYGLCKIIGTPSC-YDGTLDYFSPEKIKGHNYDVSFDWWAVG  193 (267)
T ss_pred             EEeCCCCeEEEecCccceecCCCcc-CCCCCcccChhhhcCCCCCchhhHHHHH
Confidence            4444455899999999986543321 1110  0147777653 45667887754


No 60 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=40.35  E-value=23  Score=26.54  Aligned_cols=45  Identities=16%  Similarity=0.199  Sum_probs=27.0

Q ss_pred             CCeEEEEeccccccccCCc---eEEecCCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK---ICYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~---~~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ...+.|+|||+++...+..   .+-+..-.-||.+.|. -+.+-|||-.
T Consensus       140 ~~~~kl~Dfg~~~~~~~~~~~~~~g~~~y~aPE~~~~~~~~~~~Diwsl  188 (331)
T cd06649         140 RGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSM  188 (331)
T ss_pred             CCcEEEccCcccccccccccccCCCCcCcCCHhHhcCCCCCchHhHHHH
Confidence            4579999999998554321   1111111257887764 4567788764


No 61 
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=39.25  E-value=31  Score=24.48  Aligned_cols=45  Identities=18%  Similarity=0.347  Sum_probs=26.0

Q ss_pred             cCCeEEEEeccccccccCCceEEec-----CCCCccccccCC--chhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYD-----LSQDEELFEGEG--DYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~d-----L~~d~~~F~G~g--D~QfdiYr   52 (93)
                      ++..+.|+||++++.-......+..     .-.-|+.+.+..  ...-|||.
T Consensus       135 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~s  186 (286)
T cd07846         135 QSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDTKYGRAVDIWA  186 (286)
T ss_pred             CCCcEEEEeeeeeeeccCCccccCcccceeeccCcHHhccccccCchHhHHH
Confidence            4568999999999865432221111     112477776532  34567776


No 62 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=39.24  E-value=33  Score=28.04  Aligned_cols=44  Identities=16%  Similarity=0.229  Sum_probs=25.0

Q ss_pred             CCeEEEEeccccccccCCc------eEEecCCCCccccccCC-chhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGEG-DYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~g-D~QfdiYr   52 (93)
                      ...+.|+|||+++.-....      .+-+..-.-||++.|.+ +..-|||-
T Consensus       303 ~~~vkL~DFGla~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwS  353 (501)
T PHA03210        303 DGKIVLGDFGTAMPFEKEREAFDYGWVGTVATNSPEILAGDGYCEITDIWS  353 (501)
T ss_pred             CCCEEEEeCCCceecCcccccccccccCCcCCCCchhhcCCCCCcHHHHHH
Confidence            4579999999998643221      11111112578877643 34456554


No 63 
>PTZ00284 protein kinase; Provisional
Probab=38.73  E-value=33  Score=27.33  Aligned_cols=43  Identities=14%  Similarity=0.067  Sum_probs=24.7

Q ss_pred             eEEEEeccccccccCCceEE--ecCCCCccccccC-CchhhHHHHH
Q psy15902         11 HFQVENFTISRCFVGEKICY--YDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus        11 ~vTIIDftLSR~~~~~~~~f--~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      .|.|+|||+++........+  +.--.-||++.|. -+..-|||-.
T Consensus       286 ~vkl~DfG~~~~~~~~~~~~~gt~~Y~APE~~~~~~~~~~~DiwSl  331 (467)
T PTZ00284        286 RVRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSM  331 (467)
T ss_pred             eEEECCCCccccCccccccccCCccccCcHHhhcCCCCcHHHHHHH
Confidence            69999999987544322111  1111257777764 3455666663


No 64 
>KOG1164|consensus
Probab=38.63  E-value=30  Score=26.36  Aligned_cols=12  Identities=17%  Similarity=0.479  Sum_probs=10.8

Q ss_pred             CeEEEEeccccc
Q psy15902         10 QHFQVENFTISR   21 (93)
Q Consensus        10 ~~vTIIDftLSR   21 (93)
                      -.|-||||||+|
T Consensus       164 ~~~~llDfGlar  175 (322)
T KOG1164|consen  164 RTLYLLDFGLAR  175 (322)
T ss_pred             ceEEEEecCCCc
Confidence            468999999999


No 65 
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=38.17  E-value=30  Score=24.05  Aligned_cols=46  Identities=13%  Similarity=0.094  Sum_probs=26.0

Q ss_pred             cCCeEEEEeccccccccCCceEEecC------CCCcccccc-CCchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYDL------SQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~dL------~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ....+.++|||+++....+..--...      -.-|+.+.+ .-..+-|||-.
T Consensus       128 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  180 (250)
T cd05085         128 ENNVLKISDFGMSRQEDDGIYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSY  180 (250)
T ss_pred             CCCeEEECCCccceeccccccccCCCCCCcccccCHHHhccCCCCchhHHHHH
Confidence            34578999999998644321100000      114666664 33566788874


No 66 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=37.95  E-value=20  Score=26.60  Aligned_cols=15  Identities=27%  Similarity=0.556  Sum_probs=12.5

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      ..++.|+|||+++.-
T Consensus       141 ~~~~kl~DfG~~~~~  155 (332)
T cd05614         141 EGHVVLTDFGLSKEF  155 (332)
T ss_pred             CCCEEEeeCcCCccc
Confidence            458999999999853


No 67 
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=37.89  E-value=35  Score=24.14  Aligned_cols=21  Identities=14%  Similarity=0.311  Sum_probs=15.6

Q ss_pred             ceecccCCeEEEEeccccccc
Q psy15902          3 ALTDIRTQHFQVENFTISRCF   23 (93)
Q Consensus         3 ~~~~~~g~~vTIIDftLSR~~   23 (93)
                      .+++-....+.|+||++++.-
T Consensus       139 il~~~~~~~~~l~dfg~~~~~  159 (268)
T cd06624         139 VLVNTYSGVVKISDFGTSKRL  159 (268)
T ss_pred             EEEcCCCCeEEEecchhheec
Confidence            345555678999999999754


No 68 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=37.83  E-value=23  Score=29.86  Aligned_cols=20  Identities=5%  Similarity=0.139  Sum_probs=15.3

Q ss_pred             eecccCCeEEEEeccccccc
Q psy15902          4 LTDIRTQHFQVENFTISRCF   23 (93)
Q Consensus         4 ~~~~~g~~vTIIDftLSR~~   23 (93)
                      +++-....+.|+|||+|+.-
T Consensus       287 Ll~~~~~~~KL~DFGlA~~l  306 (566)
T PLN03225        287 IFSEGSGSFKIIDLGAAADL  306 (566)
T ss_pred             EEeCCCCcEEEEeCCCcccc
Confidence            45545678999999999843


No 69 
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=37.81  E-value=35  Score=24.01  Aligned_cols=44  Identities=14%  Similarity=0.221  Sum_probs=25.5

Q ss_pred             CCeEEEEeccccccccCCceEEec------CCCCccccccC-CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYD------LSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~d------L~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ...+.|+||+++|...++...-..      --.-|+.+.+. -+.+-|||.
T Consensus       136 ~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~y~~Pe~~~~~~~~~~~Di~s  186 (256)
T cd05059         136 DNVVKVSDFGLARYVLDDQYTSSQGTKFPVKWAPPEVFDYSRFSSKSDVWS  186 (256)
T ss_pred             CCcEEECCcccceecccccccccCCCCCCccccCHHHhccCCCCchhhHHH
Confidence            457999999999866533211000      01146766653 345677776


No 70 
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=37.72  E-value=25  Score=25.14  Aligned_cols=46  Identities=11%  Similarity=0.194  Sum_probs=25.7

Q ss_pred             cCCeEEEEeccccccccCCc----eEEecCCCCccccccC-CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ....+.|+|||+++......    .+-+..-.-||.+.+. -+..-|||..
T Consensus       143 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Diwsl  193 (288)
T cd07863         143 SGGQVKLADFGLARIYSCQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSV  193 (288)
T ss_pred             CCCCEEECccCccccccCcccCCCccccccccCchHhhCCCCCCcchhhhH
Confidence            35679999999998654221    1111111257777653 3455566653


No 71 
>KOG0660|consensus
Probab=37.55  E-value=17  Score=30.18  Aligned_cols=15  Identities=13%  Similarity=0.377  Sum_probs=12.5

Q ss_pred             CeEEEEecccccccc
Q psy15902         10 QHFQVENFTISRCFV   24 (93)
Q Consensus        10 ~~vTIIDftLSR~~~   24 (93)
                      -...||||||+|...
T Consensus       162 c~lKI~DFGLAR~~~  176 (359)
T KOG0660|consen  162 CDLKICDFGLARYLD  176 (359)
T ss_pred             CCEEeccccceeecc
Confidence            456999999999883


No 72 
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=37.35  E-value=32  Score=24.45  Aligned_cols=46  Identities=15%  Similarity=0.258  Sum_probs=26.2

Q ss_pred             cCCeEEEEeccccccccCCceEE-----ecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICY-----YDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f-----~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      ++.++.|+|||+++........+     +-.-.-|+.+.+..  +..-|||-.
T Consensus       136 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl  188 (285)
T cd07861         136 NKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSPRYSTPVDIWSI  188 (285)
T ss_pred             CCCcEEECcccceeecCCCcccccCCcccccccChHHhcCCCCcCcHHHHHHH
Confidence            45689999999998543221111     11112477776532  456677763


No 73 
>PHA03212 serine/threonine kinase US3; Provisional
Probab=37.07  E-value=37  Score=26.67  Aligned_cols=45  Identities=11%  Similarity=0.039  Sum_probs=25.2

Q ss_pred             CCeEEEEeccccccccCC--ce----EEecCCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGE--KI----CYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~--~~----~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ...|.|+|||+++...+.  ..    +-+..-.-||++.+. -+..-|||-.
T Consensus       218 ~~~vkL~DFG~a~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwSl  269 (391)
T PHA03212        218 PGDVCLGDFGAACFPVDINANKYYGWAGTIATNAPELLARDPYGPAVDIWSA  269 (391)
T ss_pred             CCCEEEEeCCcccccccccccccccccCccCCCChhhhcCCCCCcHHHHHHH
Confidence            356899999999753321  10    111111257777663 3566677653


No 74 
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=36.93  E-value=30  Score=24.74  Aligned_cols=46  Identities=15%  Similarity=0.226  Sum_probs=26.7

Q ss_pred             CCeEEEEeccccccccCCceEEe----cCCCCccccccC-CchhhHHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYY----DLSQDEELFEGE-GDYQFDMYRMM   54 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~----dL~~d~~~F~G~-gD~QfdiYr~M   54 (93)
                      ...+.|+|||+++....+...-.    ..-.-|+.+.+. -+.+-|||...
T Consensus       131 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~slG  181 (277)
T cd05577         131 HGNVRISDLGLAVELKGGKKIKGRAGTPGYMAPEVLQGEVYDFSVDWFALG  181 (277)
T ss_pred             CCCEEEccCcchhhhccCCccccccCCCCcCCHHHhcCCCCCchhhhHHHH
Confidence            45799999999985432211100    011247777653 45677888754


No 75 
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=36.82  E-value=40  Score=24.35  Aligned_cols=44  Identities=11%  Similarity=0.162  Sum_probs=25.1

Q ss_pred             CCeEEEEeccccccccCCceEE----ecCCCCccccccC-CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICY----YDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f----~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ...+.|+|||+++....+...-    +.--.-|+.+.+. -+.+-|||.
T Consensus       131 ~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dvws  179 (277)
T cd05607         131 QGNCRLSDLGLAVELKDGKTITQRAGTNGYMAPEILKEEPYSYPVDWFA  179 (277)
T ss_pred             CCCEEEeeceeeeecCCCceeeccCCCCCccCHHHHccCCCCCchhHHH
Confidence            4578999999987544322110    0011247777653 356667775


No 76 
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=36.62  E-value=39  Score=23.81  Aligned_cols=45  Identities=16%  Similarity=0.242  Sum_probs=27.3

Q ss_pred             CCeEEEEeccccccccCCc------eEEecCCCCccccccC--CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      +.++.|+|||+++......      ...+-.-..|+.+.|.  ...+-|||..
T Consensus       136 ~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl  188 (287)
T cd07840         136 DGVLKLADFGLARPYTKRNSADYTNRVITLWYRPPELLLGATRYGPEVDMWSV  188 (287)
T ss_pred             CCCEEEccccceeeccCCCcccccccccccccCCceeeEccccCChHHHHHHH
Confidence            5679999999998665332      1111111257766653  3567788863


No 77 
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=36.19  E-value=33  Score=24.17  Aligned_cols=45  Identities=11%  Similarity=0.051  Sum_probs=25.5

Q ss_pred             CCeEEEEeccccccccCCc------eEEecCCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ...+.|+||++++......      ..+.-.-..|+.+.+. -+.+-|||..
T Consensus       139 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  190 (261)
T cd05068         139 NNICKVADFGLARVIKEDIYEAREGAKFPIKWTAPEAALYNRFSIKSDVWSF  190 (261)
T ss_pred             CCCEEECCcceEEEccCCcccccCCCcCceeccCccccccCCCCchhhHHHH
Confidence            4579999999998654221      1000011257777653 3456677763


No 78 
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=36.04  E-value=52  Score=23.16  Aligned_cols=45  Identities=11%  Similarity=0.156  Sum_probs=25.6

Q ss_pred             CCeEEEEeccccccccCCceEEec--------CCCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYD--------LSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~d--------L~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      +..+.|+|||+|+.-......+..        .-..|+.+.+ .-+.+-|||..
T Consensus       131 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  184 (257)
T cd05116         131 QHYAKISDFGLSKALGADENYYKAKTHGKWPVKWYAPECMNYYKFSSKSDVWSF  184 (257)
T ss_pred             CCeEEECCCccccccCCCCCeeeecCCCCCCccccCHhHhccCCcCchhHHHHH
Confidence            457899999999865432211110        0114666654 33567777764


No 79 
>KOG1345|consensus
Probab=35.60  E-value=20  Score=29.72  Aligned_cols=15  Identities=13%  Similarity=0.233  Sum_probs=12.7

Q ss_pred             CeEEEEecccccccc
Q psy15902         10 QHFQVENFTISRCFV   24 (93)
Q Consensus        10 ~~vTIIDftLSR~~~   24 (93)
                      .+|.+||||++|-.-
T Consensus       160 ~rvKlcDFG~t~k~g  174 (378)
T KOG1345|consen  160 YRVKLCDFGLTRKVG  174 (378)
T ss_pred             cEEEeeecccccccC
Confidence            479999999999654


No 80 
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=35.59  E-value=36  Score=23.59  Aligned_cols=50  Identities=22%  Similarity=0.339  Sum_probs=27.9

Q ss_pred             eecccCCeEEEEeccccccccCCceEE----ecCCCCccccccC-CchhhHHHHH
Q psy15902          4 LTDIRTQHFQVENFTISRCFVGEKICY----YDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         4 ~~~~~g~~vTIIDftLSR~~~~~~~~f----~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      +++-.+..+.|+||++++........+    +..-.-|+.+++. .+.+-|||-.
T Consensus       133 l~~~~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl  187 (256)
T cd08220         133 LLDKHKMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWAL  187 (256)
T ss_pred             EEcCCCCEEEEccCCCceecCCCccccccccCCcccCchhccCCCCCcccchHHH
Confidence            444455668999999998654322111    1111246666653 3566777654


No 81 
>PHA03211 serine/threonine kinase US3; Provisional
Probab=35.07  E-value=27  Score=28.70  Aligned_cols=16  Identities=6%  Similarity=0.063  Sum_probs=12.9

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ..++.|+|||+|+...
T Consensus       296 ~~~vkL~DFGla~~~~  311 (461)
T PHA03211        296 PEDICLGDFGAACFAR  311 (461)
T ss_pred             CCCEEEcccCCceecc
Confidence            4579999999998653


No 82 
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=34.83  E-value=53  Score=22.81  Aligned_cols=45  Identities=16%  Similarity=0.142  Sum_probs=25.5

Q ss_pred             CCeEEEEeccccccccCCceEEe-cC------CCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYY-DL------SQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~-dL------~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ...+.|+||++++....+..... ..      -.-|+.+.+ ..+..-|+|-.
T Consensus       129 ~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~sl  181 (251)
T cd05041         129 NNVLKISDFGMSREEEGGIYTVSDGLKQIPIKWTAPEALNYGRYTSESDVWSY  181 (251)
T ss_pred             CCcEEEeeccccccccCCcceeccccCcceeccCChHhhccCCCCcchhHHHH
Confidence            45799999999986542211100 00      114777665 34566677764


No 83 
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=34.82  E-value=59  Score=23.16  Aligned_cols=46  Identities=9%  Similarity=0.046  Sum_probs=25.7

Q ss_pred             cCCeEEEEeccccccccCCceEEec-------CCCCcccccc-CCchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYD-------LSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~d-------L~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      +..++.|+|||+++...........       .-.-|+.+.+ .-+..-|||..
T Consensus       154 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  207 (277)
T cd05062         154 EDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSF  207 (277)
T ss_pred             CCCCEEECCCCCccccCCcceeecCCCCccCHhhcChhHhhcCCcCchhHHHHH
Confidence            3567999999999864322111000       0114666654 33566677773


No 84 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=34.71  E-value=25  Score=26.18  Aligned_cols=15  Identities=13%  Similarity=0.242  Sum_probs=12.4

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      +.++.|+|||+++..
T Consensus       132 ~~~~kL~DfG~~~~~  146 (325)
T cd05604         132 QGHVVLTDFGLCKEG  146 (325)
T ss_pred             CCCEEEeecCCcccC
Confidence            457999999999853


No 85 
>KOG0575|consensus
Probab=34.57  E-value=19  Score=31.73  Aligned_cols=15  Identities=7%  Similarity=0.321  Sum_probs=12.7

Q ss_pred             cCCeEEEEecccccc
Q psy15902          8 RTQHFQVENFTISRC   22 (93)
Q Consensus         8 ~g~~vTIIDftLSR~   22 (93)
                      ++.+|.|.||||+--
T Consensus       153 ~~~~VKIgDFGLAt~  167 (592)
T KOG0575|consen  153 ENMNVKIGDFGLATQ  167 (592)
T ss_pred             CcCcEEecccceeee
Confidence            567999999999853


No 86 
>KOG3087|consensus
Probab=34.37  E-value=20  Score=28.10  Aligned_cols=39  Identities=21%  Similarity=0.214  Sum_probs=24.1

Q ss_pred             CeEEEEeccccccccC---Cce-E-------EecCCCCccccccCCchhhHHHH
Q psy15902         10 QHFQVENFTISRCFVG---EKI-C-------YYDLSQDEELFEGEGDYQFDMYR   52 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~---~~~-~-------f~dL~~d~~~F~G~gD~QfdiYr   52 (93)
                      ..+-+||||||-.+.-   ..+ +       -+-.+..+.+|+|    -.+.|+
T Consensus       153 ~~~~lIdfgls~~s~~~EDKgVDLYVlErA~lsTh~~~~~~fe~----~~~~Y~  202 (229)
T KOG3087|consen  153 ITPILIDFGLSSVSRLPEDKGVDLYVLERAVLSTHDKKALLFEG----FLEGYR  202 (229)
T ss_pred             CceEEEeecchhcccCcccccceeeeehHhHhccCcccHHHHHH----HHHHHH
Confidence            4457999999987762   221 2       2334556778887    345565


No 87 
>smart00090 RIO RIO-like kinase.
Probab=34.27  E-value=24  Score=26.21  Aligned_cols=16  Identities=6%  Similarity=-0.064  Sum_probs=12.7

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      +.+++||||++++...
T Consensus       184 ~~~i~LiDFg~a~~~~  199 (237)
T smart00090      184 DGKVVIIDVSQSVELD  199 (237)
T ss_pred             CCCEEEEEChhhhccC
Confidence            5689999999988543


No 88 
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=34.20  E-value=23  Score=26.40  Aligned_cols=17  Identities=12%  Similarity=0.436  Sum_probs=13.4

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      +...+.|+|||+|+...
T Consensus       131 ~~~~~kL~Dfg~a~~~~  147 (316)
T cd05592         131 KDGHIKIADFGMCKENM  147 (316)
T ss_pred             CCCCEEEccCcCCeECC
Confidence            45679999999998643


No 89 
>PRK12274 serine/threonine protein kinase; Provisional
Probab=34.17  E-value=26  Score=26.87  Aligned_cols=15  Identities=13%  Similarity=0.109  Sum_probs=12.3

Q ss_pred             cCCeEEEEecccccc
Q psy15902          8 RTQHFQVENFTISRC   22 (93)
Q Consensus         8 ~g~~vTIIDftLSR~   22 (93)
                      .+.++.|||||++..
T Consensus       127 ~~g~i~LIDFG~A~~  141 (218)
T PRK12274        127 EDGSPAVIDFQLAVR  141 (218)
T ss_pred             CCCCEEEEECCCcee
Confidence            456799999999964


No 90 
>KOG0662|consensus
Probab=33.82  E-value=19  Score=28.52  Aligned_cols=17  Identities=24%  Similarity=0.604  Sum_probs=14.7

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ++++..+.||||+|+--
T Consensus       136 ~ngelkladfglarafg  152 (292)
T KOG0662|consen  136 RNGELKLADFGLARAFG  152 (292)
T ss_pred             cCCcEEecccchhhhcC
Confidence            57899999999999854


No 91 
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=33.75  E-value=26  Score=26.05  Aligned_cols=16  Identities=25%  Similarity=0.412  Sum_probs=12.9

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      .+.++.|+|||+++..
T Consensus       131 ~~~~~kl~Dfg~a~~~  146 (330)
T cd05586         131 ATGHIALCDFGLSKAN  146 (330)
T ss_pred             CCCCEEEecCCcCcCC
Confidence            3467999999999864


No 92 
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=33.73  E-value=28  Score=25.76  Aligned_cols=16  Identities=13%  Similarity=0.320  Sum_probs=12.9

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ..++.|+|||+++...
T Consensus       129 ~~~~kl~Dfg~~~~~~  144 (312)
T cd05585         129 QGHIALCDFGLCKLNM  144 (312)
T ss_pred             CCcEEEEECcccccCc
Confidence            4579999999998643


No 93 
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=33.53  E-value=66  Score=22.40  Aligned_cols=45  Identities=11%  Similarity=0.085  Sum_probs=24.9

Q ss_pred             CCeEEEEeccccccccCCce-EEecC------CCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKI-CYYDL------SQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~-~f~dL------~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ..++.|+|||+++...++.. .....      -.-|+.+.+ .-..+-|||..
T Consensus       130 ~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl  182 (252)
T cd05084         130 KNVLKISDFGMSREEEDGVYASTGGMKQIPVKWTAPEALNYGRYSSESDVWSF  182 (252)
T ss_pred             CCcEEECccccCcccccccccccCCCCCCceeecCchhhcCCCCChHHHHHHH
Confidence            34699999999985432211 00000      013666654 34567777773


No 94 
>PHA03209 serine/threonine kinase US3; Provisional
Probab=33.51  E-value=47  Score=25.30  Aligned_cols=45  Identities=7%  Similarity=0.050  Sum_probs=25.0

Q ss_pred             CCeEEEEeccccccccCCce----EEecCCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ...+.|+|||+++.......    .-+-.-.-||.+.+. -+.+-|||-.
T Consensus       193 ~~~~kl~DfG~a~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwSl  242 (357)
T PHA03209        193 VDQVCIGDLGAAQFPVVAPAFLGLAGTVETNAPEVLARDKYNSKADIWSA  242 (357)
T ss_pred             CCCEEEecCccccccccCcccccccccccccCCeecCCCCCCchhhHHHH
Confidence            45689999999986442211    001111257777653 3456666653


No 95 
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=33.50  E-value=46  Score=23.76  Aligned_cols=45  Identities=11%  Similarity=0.218  Sum_probs=25.1

Q ss_pred             CCeEEEEeccccccccCCceEEe--cC------CCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYY--DL------SQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~--dL------~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ...+.|+|||+++....+...+.  ..      ---|+...+ .-+.+-|||..
T Consensus       144 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  197 (284)
T cd05081         144 ENRVKIGDFGLTKVLPQDKEYYKVREPGESPIFWYAPESLTESKFSVASDVWSF  197 (284)
T ss_pred             CCeEEECCCcccccccCCCcceeecCCCCCceEeeCHHHhccCCcChHHHHHHH
Confidence            45799999999996543221111  00      013555544 34566777774


No 96 
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=33.48  E-value=42  Score=24.37  Aligned_cols=46  Identities=13%  Similarity=0.204  Sum_probs=26.5

Q ss_pred             cCCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      ...++.|+|||+++.......     .-+-.-.-|+.+.+..  ..+-|||..
T Consensus       139 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl  191 (301)
T cd07873         139 ERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGV  191 (301)
T ss_pred             CCCcEEECcCcchhccCCCCCcccccceeecccCcHHHhCCCCCccHHHHHHH
Confidence            346799999999986542211     1111112577776543  356777764


No 97 
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=33.34  E-value=27  Score=26.27  Aligned_cols=16  Identities=6%  Similarity=0.256  Sum_probs=12.9

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +..+|.|+|||+++..
T Consensus       131 ~~~~~kL~DfG~~~~~  146 (329)
T cd05618         131 SEGHIKLTDYGMCKEG  146 (329)
T ss_pred             CCCCEEEeeCCccccc
Confidence            3467999999999864


No 98 
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=33.33  E-value=28  Score=25.97  Aligned_cols=17  Identities=24%  Similarity=0.556  Sum_probs=13.5

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      +..++.|+|||+++...
T Consensus       136 ~~~~~kL~Dfg~a~~~~  152 (333)
T cd05600         136 ASGHIKLTDFGLSKGIV  152 (333)
T ss_pred             CCCCEEEEeCcCCcccc
Confidence            45679999999998643


No 99 
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=32.36  E-value=44  Score=23.60  Aligned_cols=46  Identities=11%  Similarity=0.067  Sum_probs=26.4

Q ss_pred             cCCeEEEEeccccccccCCceE-----E--ecCCCCccccccCC---chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKIC-----Y--YDLSQDEELFEGEG---DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~-----f--~dL~~d~~~F~G~g---D~QfdiYr~   53 (93)
                      .+..+.|+||++++........     .  +..-..|+.+.+..   +.+-|+|..
T Consensus       143 ~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~~Dv~sl  198 (272)
T cd06629         143 ADGICKISDFGISKKSDDIYDNDQNMSMQGSVFWMAPEVIHSYSQGYSAKVDIWSL  198 (272)
T ss_pred             CCCeEEEeeccccccccccccccccccccCCccccCHHHhccccCCCCccchhHHH
Confidence            3567999999999864321100     0  00011477776543   567788764


No 100
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=32.35  E-value=51  Score=23.32  Aligned_cols=45  Identities=22%  Similarity=0.409  Sum_probs=26.5

Q ss_pred             CCeEEEEeccccccccCCc-eEEec-----CCCCccccccCC--chhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-ICYYD-----LSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-~~f~d-----L~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      ...+.|+||++++...... ..+..     --.-||.+.+..  +.+-|||-.
T Consensus       135 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Di~sl  187 (286)
T cd07832         135 DGVLKIADFGLARLFSEEEPRLYSHQVATRWYRAPELLYGARKYDPGVDLWAV  187 (286)
T ss_pred             CCcEEEeeeeecccccCCCCCccccccCcccccCceeeeccccCCchhHHHHH
Confidence            4568999999998765332 11111     012467766532  567788774


No 101
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=32.13  E-value=30  Score=25.83  Aligned_cols=16  Identities=13%  Similarity=0.391  Sum_probs=12.9

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ....+.|+|||+++..
T Consensus       130 ~~~~~kl~DfG~a~~~  145 (323)
T cd05571         130 KDGHIKITDFGLCKEG  145 (323)
T ss_pred             CCCCEEEeeCCCCccc
Confidence            3567999999999864


No 102
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=32.00  E-value=28  Score=25.94  Aligned_cols=16  Identities=13%  Similarity=0.391  Sum_probs=12.7

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +...+.|+|||+++..
T Consensus       131 ~~~~~kL~Dfg~~~~~  146 (325)
T cd05594         131 KDGHIKITDFGLCKEG  146 (325)
T ss_pred             CCCCEEEecCCCCeec
Confidence            3457999999999853


No 103
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=31.86  E-value=45  Score=22.61  Aligned_cols=45  Identities=18%  Similarity=0.296  Sum_probs=27.1

Q ss_pred             CCeEEEEeccccccccCCc--eEEec--CCCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK--ICYYD--LSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~--~~f~d--L~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      +.+++|+||+.++......  ..+..  .-.-|+...+ ..+++-|+|..
T Consensus       134 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~Dv~sl  183 (253)
T cd05122         134 DGEVKLIDFGLSAQLSDTKARNTMVGTPYWMAPEVINGKPYDYKADIWSL  183 (253)
T ss_pred             CCeEEEeeccccccccccccccceecCCcccCHHHHcCCCCCccccHHHH
Confidence            5689999999998765432  11111  1124665554 34677788874


No 104
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=31.81  E-value=28  Score=26.03  Aligned_cols=16  Identities=13%  Similarity=0.430  Sum_probs=13.0

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ++..+.|+|||+++..
T Consensus       136 ~~~~ikL~Dfg~~~~~  151 (323)
T cd05615         136 SEGHIKIADFGMCKEH  151 (323)
T ss_pred             CCCCEEEecccccccc
Confidence            4567999999999864


No 105
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=30.80  E-value=27  Score=26.43  Aligned_cols=17  Identities=18%  Similarity=0.528  Sum_probs=13.5

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      .+.++.|+|||+++...
T Consensus       203 ~~~~~kL~DfG~~~~~~  219 (353)
T PLN00034        203 SAKNVKIADFGVSRILA  219 (353)
T ss_pred             CCCCEEEcccccceecc
Confidence            35689999999998643


No 106
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=30.77  E-value=35  Score=24.98  Aligned_cols=45  Identities=9%  Similarity=0.103  Sum_probs=25.3

Q ss_pred             CCeEEEEeccccccccCCceEEe---c--CCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYY---D--LSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~---d--L~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      +..+.|+|||+++..........   .  .-.-|+.+.+. -+.+-|||-.
T Consensus       152 ~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~s~  202 (296)
T cd06654         152 DGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL  202 (296)
T ss_pred             CCCEEECccccchhccccccccCcccCCccccCHHHHcCCCCCccchHHHH
Confidence            44799999999886432211100   0  01147777653 3467777764


No 107
>KOG0664|consensus
Probab=30.76  E-value=27  Score=29.22  Aligned_cols=17  Identities=12%  Similarity=0.319  Sum_probs=13.7

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      |+--.+||||||.|.+.
T Consensus       191 SNCvLKICDFGLARvee  207 (449)
T KOG0664|consen  191 SNCILKICDFGLARTWD  207 (449)
T ss_pred             cCceEEecccccccccc
Confidence            44457899999999876


No 108
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=30.26  E-value=33  Score=26.12  Aligned_cols=14  Identities=14%  Similarity=0.418  Sum_probs=11.8

Q ss_pred             CCeEEEEecccccc
Q psy15902          9 TQHFQVENFTISRC   22 (93)
Q Consensus         9 g~~vTIIDftLSR~   22 (93)
                      ..+|.|+|||+++.
T Consensus       137 ~~~vkL~DFGla~~  150 (363)
T cd05628         137 KGHVKLSDFGLCTG  150 (363)
T ss_pred             CCCEEEeeccCccc
Confidence            45799999999975


No 109
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=30.21  E-value=27  Score=25.42  Aligned_cols=46  Identities=11%  Similarity=0.000  Sum_probs=25.2

Q ss_pred             cCCeEEEEeccccccccCCceEE-------ecCCCCcccccc-CCchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICY-------YDLSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f-------~dL~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ....+.|+|||+++.........       +..---|+.+.+ .-+..-|||..
T Consensus       173 ~~~~~kl~DfG~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl  226 (304)
T cd05096         173 ENLTIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAF  226 (304)
T ss_pred             CCccEEECCCccceecccCceeEecCcCCCCccccCHHHHhcCCCCchhhhHHH
Confidence            34679999999998643321100       000013565543 44566777764


No 110
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=30.13  E-value=58  Score=23.15  Aligned_cols=46  Identities=13%  Similarity=0.196  Sum_probs=26.6

Q ss_pred             cCCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      ....+.|+||++++.......     ..+..-.-||.+.|..  +.+-|||-.
T Consensus       135 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl  187 (284)
T cd07860         135 TEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSL  187 (284)
T ss_pred             CCCCEEEeeccchhhcccCccccccccccccccCCeEEecCCCCCcHHHHHHH
Confidence            345799999999985432211     1111112577776643  567787773


No 111
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=30.03  E-value=49  Score=22.83  Aligned_cols=45  Identities=16%  Similarity=0.300  Sum_probs=26.0

Q ss_pred             CCeEEEEeccccccccCCc-----eEEecCCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ..++.|+||++++......     ..-.-.-..|+.+.+. .+.+-|+|..
T Consensus       129 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~~Pe~~~~~~~~~~~D~~sl  179 (250)
T cd05123         129 DGHIKLTDFGLAKELSSEGSRTNTFCGTPEYLAPEVLLGKGYGKAVDWWSL  179 (250)
T ss_pred             CCcEEEeecCcceecccCCCcccCCcCCccccChHHhCCCCCCchhhHHHH
Confidence            3579999999998765431     0101111256766653 4566777763


No 112
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=30.02  E-value=30  Score=25.76  Aligned_cols=16  Identities=13%  Similarity=0.285  Sum_probs=12.8

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ....+.|+|||+++..
T Consensus       131 ~~~~~kl~DfG~a~~~  146 (325)
T cd05602         131 SQGHIVLTDFGLCKEN  146 (325)
T ss_pred             CCCCEEEccCCCCccc
Confidence            3567999999999853


No 113
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=29.92  E-value=33  Score=25.50  Aligned_cols=16  Identities=13%  Similarity=0.252  Sum_probs=12.8

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +...+.|+|||+++..
T Consensus       131 ~~~~~kL~Dfg~~~~~  146 (321)
T cd05591         131 AEGHCKLADFGMCKEG  146 (321)
T ss_pred             CCCCEEEeecccceec
Confidence            3467999999999854


No 114
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=29.84  E-value=51  Score=23.74  Aligned_cols=16  Identities=19%  Similarity=0.293  Sum_probs=13.0

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      +.++.|+|||+++...
T Consensus       146 ~~~~kl~dfg~~~~~~  161 (292)
T cd06644         146 DGDIKLADFGVSAKNV  161 (292)
T ss_pred             CCCEEEccCccceecc
Confidence            5679999999988644


No 115
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=29.77  E-value=41  Score=25.00  Aligned_cols=51  Identities=12%  Similarity=-0.021  Sum_probs=29.7

Q ss_pred             CeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcC--CCCCCCchhHHHHHHHHH
Q psy15902         10 QHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQN--NWQNFTPKNNALDIDGLI   78 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~--~W~~f~P~TNvlWL~YL~   78 (93)
                      .+|.||||+.++...+                 ..+-+.|+.|+-|.+.+.  .=+.| +.++-.|=..+.
T Consensus       179 ~~v~LIDfg~~~~~~~-----------------~~~~~~nl~rl~rs~~~~~~~~~~~-~~~~~~~~~~~~  231 (239)
T PRK01723        179 GKFWLIDFDRGELRTP-----------------TRWKQANLARLLRSFNKEQGKRPIL-AFSEQDWQALLA  231 (239)
T ss_pred             CCEEEEECCCcccCCC-----------------HHHHHHHHHHHHHHHHHHhccCCcc-cccHHHHHHHHH
Confidence            4799999999887531                 124567777777766431  21222 255566654443


No 116
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=29.73  E-value=30  Score=25.73  Aligned_cols=16  Identities=13%  Similarity=0.368  Sum_probs=12.7

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +...+.|+|||+++..
T Consensus       136 ~~~~~kL~DfG~~~~~  151 (323)
T cd05616         136 SEGHIKIADFGMCKEN  151 (323)
T ss_pred             CCCcEEEccCCCceec
Confidence            3457999999999853


No 117
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=29.64  E-value=27  Score=25.02  Aligned_cols=16  Identities=13%  Similarity=0.536  Sum_probs=13.0

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ...+.|+|||+++...
T Consensus       146 ~~~~kl~Dfg~~~~~~  161 (290)
T cd07862         146 SGQIKLADFGLARIYS  161 (290)
T ss_pred             CCCEEEccccceEecc
Confidence            4579999999998643


No 118
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=29.51  E-value=43  Score=24.04  Aligned_cols=18  Identities=17%  Similarity=0.484  Sum_probs=14.2

Q ss_pred             cCCeEEEEeccccccccC
Q psy15902          8 RTQHFQVENFTISRCFVG   25 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~   25 (93)
                      +++++.|+||+++|....
T Consensus       150 ~~~~~~l~dfg~~~~~~~  167 (311)
T cd07866         150 NQGILKIADFGLARPYDG  167 (311)
T ss_pred             CCCCEEECcCccchhccC
Confidence            456799999999997653


No 119
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=29.42  E-value=40  Score=23.57  Aligned_cols=17  Identities=12%  Similarity=0.309  Sum_probs=13.3

Q ss_pred             CCeEEEEeccccccccC
Q psy15902          9 TQHFQVENFTISRCFVG   25 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~   25 (93)
                      ...+.|+|||+++....
T Consensus       136 ~~~~~l~dfg~~~~~~~  152 (255)
T cd08219         136 NGKVKLGDFGSARLLTS  152 (255)
T ss_pred             CCcEEEcccCcceeecc
Confidence            45789999999986543


No 120
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=29.41  E-value=34  Score=26.08  Aligned_cols=14  Identities=29%  Similarity=0.619  Sum_probs=11.8

Q ss_pred             cCCeEEEEeccccc
Q psy15902          8 RTQHFQVENFTISR   21 (93)
Q Consensus         8 ~g~~vTIIDftLSR   21 (93)
                      +...+.|+|||+|+
T Consensus       136 ~~~~~kl~DfGla~  149 (377)
T cd05629         136 RGGHIKLSDFGLST  149 (377)
T ss_pred             CCCCEEEeeccccc
Confidence            35679999999997


No 121
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=29.24  E-value=39  Score=24.15  Aligned_cols=16  Identities=25%  Similarity=0.382  Sum_probs=12.4

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ...+.|+|||+++...
T Consensus       144 ~~~~kl~dfg~~~~~~  159 (288)
T cd06616         144 NGNIKLCDFGISGQLV  159 (288)
T ss_pred             CCcEEEeecchhHHhc
Confidence            4568999999997543


No 122
>PF12705 PDDEXK_1:  PD-(D/E)XK nuclease superfamily; PDB: 1W36_B 3K70_B 3U4Q_A 3U44_A.
Probab=28.97  E-value=45  Score=22.81  Aligned_cols=39  Identities=13%  Similarity=0.209  Sum_probs=26.4

Q ss_pred             cCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhc
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQ   59 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~   59 (93)
                      .++++.|+||+-++......          .+.   -+.|--+|..|=....
T Consensus       142 ~~g~~~IvDyKt~~~~~~~~----------~~~---~~~Ql~~Y~~~l~~~~  180 (257)
T PF12705_consen  142 KDGRVRIVDYKTGSSPDDKS----------DLK---YDLQLALYALALEQQF  180 (257)
T ss_dssp             ESSTEEEEEEESSS-SSSHH----------HHH---CHHHHHHHHHHHHHHH
T ss_pred             CCCcEEEEEEcCCCCCCccc----------hhh---hHHHHHHHHHHHHhcc
Confidence            37789999999988744332          111   4789999998866543


No 123
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=28.95  E-value=35  Score=25.45  Aligned_cols=16  Identities=13%  Similarity=0.276  Sum_probs=12.9

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +...+.|+|||+++..
T Consensus       131 ~~~~~kL~DfG~~~~~  146 (320)
T cd05590         131 HEGHCKLADFGMCKEG  146 (320)
T ss_pred             CCCcEEEeeCCCCeec
Confidence            3567999999999864


No 124
>PF03244 PSI_PsaH:  Photosystem I reaction centre subunit VI;  InterPro: IPR004928 Photosystem I, a membrane complex found in the chloroplasts of plants and cyanobacteria uses light energy to transfer electrons from plastocyanin to ferredoxin []. The electron transfer components of the photosystem include the primary electron donor chlorophyll P-700 and 5 electron acceptors: chlorophyll (A0), phylloquinone (A1) and three 4Fe-4S iron-sulphur centres, designated Fx, Fa and Fb. The role of this protein, subunit VI or PsaH, may be in docking of the light harvesting complex I antenna to the core complex.; GO: 0015979 photosynthesis, 0009522 photosystem I, 0009538 photosystem I reaction center; PDB: 2WSF_H 2WSE_H 2WSC_H 2O01_H.
Probab=28.84  E-value=14  Score=27.07  Aligned_cols=13  Identities=38%  Similarity=0.733  Sum_probs=0.6

Q ss_pred             cccCCceEEecCC
Q psy15902         22 CFVGEKICYYDLS   34 (93)
Q Consensus        22 ~~~~~~~~f~dL~   34 (93)
                      ++.|+..+|+||+
T Consensus        45 AKYGdkSvYFDL~   57 (140)
T PF03244_consen   45 AKYGDKSVYFDLE   57 (140)
T ss_dssp             ------------S
T ss_pred             eecccceeEEehh
Confidence            4457789999996


No 125
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=28.74  E-value=35  Score=25.41  Aligned_cols=15  Identities=13%  Similarity=0.397  Sum_probs=12.3

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      ...+.|+|||+++..
T Consensus       137 ~~~~kL~Dfg~~~~~  151 (324)
T cd05587         137 EGHIKIADFGMCKEN  151 (324)
T ss_pred             CCCEEEeecCcceec
Confidence            457999999999853


No 126
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=28.24  E-value=34  Score=25.33  Aligned_cols=15  Identities=13%  Similarity=0.242  Sum_probs=12.3

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      ..++.|+|||+++..
T Consensus       132 ~~~~kl~Dfg~~~~~  146 (321)
T cd05603         132 QGHVVLTDFGLCKEG  146 (321)
T ss_pred             CCCEEEccCCCCccC
Confidence            457999999999863


No 127
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=28.19  E-value=38  Score=27.96  Aligned_cols=17  Identities=12%  Similarity=0.264  Sum_probs=14.1

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      .+.++.||||++||...
T Consensus       462 ~~~~~~liDFGla~~~~  478 (535)
T PRK09605        462 RDDRLYLIDFGLGKYSD  478 (535)
T ss_pred             ECCcEEEEeCcccccCC
Confidence            46789999999999854


No 128
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=28.16  E-value=58  Score=22.66  Aligned_cols=45  Identities=9%  Similarity=0.142  Sum_probs=26.4

Q ss_pred             CCeEEEEeccccccccCCceEEec---------CCCCccccccC----CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYD---------LSQDEELFEGE----GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~d---------L~~d~~~F~G~----gD~QfdiYr~   53 (93)
                      +.++.|+||++++...........         .-..|+.+.+.    .+.+-|||..
T Consensus       135 ~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~~~~Dv~s~  192 (264)
T cd06626         135 NGVIKLGDFGCAVKLKNNTTTMGEEVQSLAGTPAYMAPEVITGGKGKGHGRAADIWSL  192 (264)
T ss_pred             CCCEEEcccccccccCCCCCcccccccCCcCCcCccChhhccCCCCCCCCcccchHHH
Confidence            567999999999876543211110         11246766653    3556677764


No 129
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=28.08  E-value=35  Score=25.33  Aligned_cols=15  Identities=13%  Similarity=0.343  Sum_probs=12.3

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      ...+.|+|||++|..
T Consensus       210 ~~~~kl~DfG~a~~~  224 (338)
T cd05102         210 NNVVKICDFGLARDI  224 (338)
T ss_pred             CCcEEEeeccccccc
Confidence            457999999999854


No 130
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=27.93  E-value=56  Score=22.92  Aligned_cols=46  Identities=13%  Similarity=0.122  Sum_probs=26.8

Q ss_pred             cCCeEEEEeccccccccCCceEEe-c-------CCCCccccccC-CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYY-D-------LSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~-d-------L~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ...++.|+||++++........+. .       .-.-|+.+.+. -+..-|||..
T Consensus       130 ~~~~~kl~df~~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  184 (257)
T cd05060         130 NRHQAKISDFGMSRALGAGSDYYRATTAGRWPLKWYAPECINYGKFSSKSDVWSY  184 (257)
T ss_pred             CCCcEEeccccccceeecCCcccccccCccccccccCHHHhcCCCCCccchHHHH
Confidence            345799999999986643322111 0       01247777653 4556777763


No 131
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=27.91  E-value=59  Score=22.79  Aligned_cols=45  Identities=9%  Similarity=0.101  Sum_probs=25.8

Q ss_pred             CCeEEEEeccccccccCCceE-EecC-----CCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKIC-YYDL-----SQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~-f~dL-----~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ...+.|+|||+++...+.... ....     -.-|+.+.+ ..+.+-|||..
T Consensus       139 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  190 (261)
T cd05072         139 SLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSF  190 (261)
T ss_pred             CCcEEECCCccceecCCCceeccCCCccceecCCHHHhccCCCChhhhhhhh
Confidence            456899999999976533211 1110     113565554 34567788773


No 132
>KOG4278|consensus
Probab=27.41  E-value=28  Score=32.18  Aligned_cols=17  Identities=29%  Similarity=0.612  Sum_probs=14.0

Q ss_pred             CeEEEEeccccccccCC
Q psy15902         10 QHFQVENFTISRCFVGE   26 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~~   26 (93)
                      .-|.|.||||||+-.++
T Consensus       402 hiVKvADFGLsRlMtgD  418 (1157)
T KOG4278|consen  402 HIVKVADFGLSRLMTGD  418 (1157)
T ss_pred             ceEEeeccchhhhhcCC
Confidence            45899999999987754


No 133
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=27.29  E-value=64  Score=22.64  Aligned_cols=17  Identities=6%  Similarity=0.190  Sum_probs=13.9

Q ss_pred             CCeEEEEeccccccccC
Q psy15902          9 TQHFQVENFTISRCFVG   25 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~   25 (93)
                      ...+.|+||++++....
T Consensus       129 ~~~~~l~df~~~~~~~~  145 (262)
T cd05572         129 NGYVKLVDFGFAKKLKS  145 (262)
T ss_pred             CCCEEEeeCCcccccCc
Confidence            46799999999997654


No 134
>KOG0200|consensus
Probab=27.27  E-value=33  Score=29.20  Aligned_cols=15  Identities=13%  Similarity=0.485  Sum_probs=12.6

Q ss_pred             cCCeEEEEecccccc
Q psy15902          8 RTQHFQVENFTISRC   22 (93)
Q Consensus         8 ~g~~vTIIDftLSR~   22 (93)
                      ++.-+.|+||||+|-
T Consensus       453 ~~~~~kIaDFGlar~  467 (609)
T KOG0200|consen  453 KNKVIKIADFGLARD  467 (609)
T ss_pred             CCCEEEEccccceec
Confidence            456789999999994


No 135
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=27.17  E-value=57  Score=22.71  Aligned_cols=17  Identities=0%  Similarity=-0.072  Sum_probs=13.3

Q ss_pred             CCeEEEEeccccccccC
Q psy15902          9 TQHFQVENFTISRCFVG   25 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~   25 (93)
                      +.++.|||||+++....
T Consensus       161 ~~~~~liDfg~~~~~~~  177 (198)
T cd05144         161 DEKIYIIDWPQMVSTDH  177 (198)
T ss_pred             CCcEEEEECCccccCCC
Confidence            56889999999965543


No 136
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=27.07  E-value=81  Score=22.31  Aligned_cols=46  Identities=13%  Similarity=0.241  Sum_probs=27.7

Q ss_pred             cCCeEEEEeccccccccCCce------EEecCCCCccccccC--CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI------CYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~------~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      ++.+|.|+|||+++.-.....      +.+..-.-||.+.+.  -+..-|||..
T Consensus       135 ~~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~~Dv~sl  188 (288)
T cd07833         135 ESGVLKLCDFGFARALRARPASPLTDYVATRWYRAPELLVGDTNYGKPVDVWAI  188 (288)
T ss_pred             CCCCEEEEeeecccccCCCccccccCcccccCCcCCchhcCCCCcCchhhHHHH
Confidence            367899999999886553321      111222356766654  2466777763


No 137
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=27.04  E-value=36  Score=25.50  Aligned_cols=45  Identities=13%  Similarity=0.310  Sum_probs=24.8

Q ss_pred             cCCeEEEEeccccccccCC--c-eEEe--cCCCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGE--K-ICYY--DLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~--~-~~f~--dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      +...+.|||||+|+.....  . ..+.  ..-.-||.+.+. -+.+-|||-
T Consensus       131 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~Diws  181 (327)
T cd05617         131 ADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWA  181 (327)
T ss_pred             CCCCEEEeccccceeccCCCCceecccCCcccCCHHHHCCCCCCchheeeh
Confidence            3467999999999853321  1 1111  111257777663 345566555


No 138
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=26.97  E-value=69  Score=22.24  Aligned_cols=45  Identities=13%  Similarity=0.171  Sum_probs=25.4

Q ss_pred             cCCeEEEEeccccccccCCc---eEEec--CCCCccccccC----CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK---ICYYD--LSQDEELFEGE----GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~---~~f~d--L~~d~~~F~G~----gD~QfdiYr   52 (93)
                      ...++.|+|||+++.-....   ..+..  .--.|+++.+.    .+.+-|||.
T Consensus       136 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~y~~Pe~~~~~~~~~~~~~~Di~s  189 (262)
T cd06613         136 EDGDVKLADFGVSAQLTATIAKRKSFIGTPYWMAPEVAAVERKGGYDGKCDIWA  189 (262)
T ss_pred             CCCCEEECccccchhhhhhhhccccccCCccccCchhhcccccCCcCchhhhHH
Confidence            45679999999987533211   11111  01257777653    455667776


No 139
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=26.91  E-value=39  Score=26.15  Aligned_cols=16  Identities=13%  Similarity=0.364  Sum_probs=13.1

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +..++.|||||+|+..
T Consensus       177 ~~~~~kL~DFG~a~~~  192 (370)
T cd05621         177 KHGHLKLADFGTCMKM  192 (370)
T ss_pred             CCCCEEEEecccceec
Confidence            4568999999999864


No 140
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=26.84  E-value=42  Score=25.63  Aligned_cols=14  Identities=21%  Similarity=0.589  Sum_probs=11.6

Q ss_pred             cCCeEEEEeccccc
Q psy15902          8 RTQHFQVENFTISR   21 (93)
Q Consensus         8 ~g~~vTIIDftLSR   21 (93)
                      +...+.|+|||+++
T Consensus       136 ~~g~~kL~DFGla~  149 (382)
T cd05625         136 RDGHIKLTDFGLCT  149 (382)
T ss_pred             CCCCEEEeECCCCc
Confidence            35679999999986


No 141
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=26.74  E-value=40  Score=25.32  Aligned_cols=16  Identities=13%  Similarity=0.391  Sum_probs=13.0

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ...++.|+|||+++..
T Consensus       130 ~~~~~kL~DfG~~~~~  145 (328)
T cd05593         130 KDGHIKITDFGLCKEG  145 (328)
T ss_pred             CCCcEEEecCcCCccC
Confidence            4567999999999863


No 142
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=26.74  E-value=45  Score=23.87  Aligned_cols=51  Identities=14%  Similarity=0.185  Sum_probs=27.4

Q ss_pred             ceecccCCeEEEEeccccccccCCce-----EEecCCCCccccccC--CchhhHHHHH
Q psy15902          3 ALTDIRTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         3 ~~~~~~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      ++++-.+..+.|+|||+++.-.....     +-+-.-.-|+.+.+.  -+.+-|||-.
T Consensus       141 il~~~~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~sl  198 (295)
T cd07837         141 LLVDKQKGLLKIADLGLGRAFSIPVKSYTHEIVTLWYRAPEVLLGSTHYSTPVDIWSV  198 (295)
T ss_pred             EEEecCCCeEEEeecccceecCCCccccCCcccccCCCChHHhhCCCCCCchHHHHHH
Confidence            34554477899999999985321110     000001146666542  2556777763


No 143
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=26.70  E-value=40  Score=25.03  Aligned_cols=15  Identities=13%  Similarity=0.242  Sum_probs=12.5

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      ...+.|+|||+++..
T Consensus       132 ~~~~kl~Dfg~~~~~  146 (323)
T cd05575         132 QGHVVLTDFGLCKEG  146 (323)
T ss_pred             CCcEEEeccCCCccc
Confidence            457999999999854


No 144
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=26.69  E-value=77  Score=21.14  Aligned_cols=44  Identities=11%  Similarity=0.184  Sum_probs=25.2

Q ss_pred             CeEEEEeccccccccCCc------eEEecCCCCccccc-c-CCchhhHHHHH
Q psy15902         10 QHFQVENFTISRCFVGEK------ICYYDLSQDEELFE-G-EGDYQFDMYRM   53 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~-G-~gD~QfdiYr~   53 (93)
                      ..+.||||++++......      ......-..|+.+. + .-...-|+|..
T Consensus       135 ~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~~~pe~~~~~~~~~~~~Dv~~l  186 (225)
T smart00221      135 GLVKLADFGLARFIHRDLAALLKTVKGTPFYLAPEVLLGGKGYGEAVDIWSL  186 (225)
T ss_pred             CCEEEeeCceeeEecCcccccccceeccCCcCCHhHhcCCCCCCchhhHHHH
Confidence            789999999999775432      22222223566662 2 12345666653


No 145
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=26.66  E-value=45  Score=23.27  Aligned_cols=16  Identities=13%  Similarity=0.318  Sum_probs=13.0

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ...++.|+|||+++.-
T Consensus       139 ~~~~~~l~dfg~~~~~  154 (263)
T cd06625         139 SAGNVKLGDFGASKRL  154 (263)
T ss_pred             CCCCEEEeecccceec
Confidence            4568999999999754


No 146
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=26.66  E-value=62  Score=23.34  Aligned_cols=44  Identities=14%  Similarity=0.205  Sum_probs=26.1

Q ss_pred             CCeEEEEeccccccccCCc--------eEEecCCCCccccccC--CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGE--GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~--gD~QfdiYr   52 (93)
                      ...+.|+|||+++.-....        .+.+-.-.-|+.+.|.  -+.+-|||.
T Consensus       148 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~s  201 (316)
T cd07842         148 RGVVKIGDLGLARLFNAPLKPLADLDPVVVTIWYRAPELLLGARHYTKAIDIWA  201 (316)
T ss_pred             cceEEECCCccccccCCCcccccccCCccccccccCHHHHhCCCCCCcHHHHHH
Confidence            5779999999998643211        1111111257777663  356778887


No 147
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=26.65  E-value=39  Score=25.36  Aligned_cols=17  Identities=12%  Similarity=0.176  Sum_probs=13.0

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ...++.|+|||+++...
T Consensus       137 ~~~~~kl~DfG~a~~~~  153 (331)
T cd05624         137 MNGHIRLADFGSCLKMN  153 (331)
T ss_pred             CCCCEEEEeccceeecc
Confidence            34579999999997543


No 148
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=26.55  E-value=37  Score=25.37  Aligned_cols=45  Identities=11%  Similarity=0.187  Sum_probs=24.7

Q ss_pred             cCCeEEEEeccccccccCCc---eEE--ecCCCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK---ICY--YDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~---~~f--~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ++..|.|+|||+++......   .-+  +.--.-||.+.+. -+.+-|||-
T Consensus       131 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~Dvws  181 (316)
T cd05619         131 TDGHIKIADFGMCKENMLGDAKTCTFCGTPDYIAPEILLGQKYNTSVDWWS  181 (316)
T ss_pred             CCCCEEEccCCcceECCCCCCceeeecCCccccCHHHHcCCCCCchhhhhh
Confidence            35679999999998532111   001  1111257777764 245556664


No 149
>KOG0598|consensus
Probab=26.53  E-value=42  Score=27.88  Aligned_cols=65  Identities=17%  Similarity=0.360  Sum_probs=37.1

Q ss_pred             CCeEEEEeccccccccCCc---eEEecCCC--CccccccCC-chhhH-------HHHHHHHhhcCCCCCCCchhHHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK---ICYYDLSQ--DEELFEGEG-DYQFD-------MYRMMRKQCQNNWQNFTPKNNALDID   75 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~---~~f~dL~~--d~~~F~G~g-D~Qfd-------iYr~MR~~~~~~W~~f~P~TNvlWL~   75 (93)
                      .++|.|+|||||+.....+   .-|+....  -||+..+.| +..-|       .|.|+.     .|.+|.-...--|..
T Consensus       161 ~GHi~LtDFgL~k~~~~~~~~t~tfcGT~eYmAPEil~~~gy~~~vDWWsLGillYeML~-----G~pPF~~~~~~~~~~  235 (357)
T KOG0598|consen  161 QGHIKLTDFGLCKEDLKDGDATRTFCGTPEYMAPEILLGKGYDKAVDWWSLGILLYEMLT-----GKPPFYAEDVKKMYD  235 (357)
T ss_pred             CCcEEEeccccchhcccCCCccccccCCccccChHHHhcCCCCcccchHhHHHHHHHHhh-----CCCCCcCccHHHHHH
Confidence            4789999999999766431   12333211  488888865 22222       344433     466666555555544


Q ss_pred             HHH
Q psy15902         76 GLI   78 (93)
Q Consensus        76 YL~   78 (93)
                      =++
T Consensus       236 ~I~  238 (357)
T KOG0598|consen  236 KIL  238 (357)
T ss_pred             HHh
Confidence            443


No 150
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=26.51  E-value=80  Score=22.67  Aligned_cols=46  Identities=17%  Similarity=0.254  Sum_probs=27.0

Q ss_pred             cCCeEEEEeccccccccCCceEE-----ecCCCCccccccCC--chhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICY-----YDLSQDEELFEGEG--DYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f-----~dL~~d~~~F~G~g--D~QfdiYr~   53 (93)
                      .++.+.|+|||+++........+     +-.-..|+.+.+..  +..-|+|..
T Consensus       141 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~sl  193 (293)
T cd07843         141 NRGILKICDFGLAREYGSPLKPYTQLVVTLWYRAPELLLGAKEYSTAIDMWSV  193 (293)
T ss_pred             CCCcEEEeecCceeeccCCccccccccccccccCchhhcCCccccchhhHHHH
Confidence            34679999999999655431111     11112578777642  455677763


No 151
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=26.50  E-value=35  Score=25.47  Aligned_cols=45  Identities=13%  Similarity=0.178  Sum_probs=24.5

Q ss_pred             cCCeEEEEeccccccccCCceEE--ecCCCCccccccC--CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICY--YDLSQDEELFEGE--GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f--~dL~~d~~~F~G~--gD~QfdiYr   52 (93)
                      ...++.|+|||+++.......-+  +..-.-||++.+.  -...-|||-
T Consensus       153 ~~~~~kl~Dfg~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~Diws  201 (343)
T cd07878         153 EDCELRILDFGLARQADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWS  201 (343)
T ss_pred             CCCCEEEcCCccceecCCCcCCccccccccCchHhcCCccCCchhhhHh
Confidence            35679999999998654332111  1111247776652  223445554


No 152
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=26.28  E-value=70  Score=22.51  Aligned_cols=44  Identities=14%  Similarity=0.117  Sum_probs=25.4

Q ss_pred             CCeEEEEeccccccccCCce----EEecCCCCccccccC-CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ...+.|+|||+++.......    .-+..-..|+.+.+. -+.+-|||-
T Consensus       150 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~Pe~~~~~~~~~~~Dv~s  198 (269)
T cd08528         150 DDKVTITDFGLAKQKQPESKLTSVVGTILYSCPEIVKNEPYGEKADVWA  198 (269)
T ss_pred             CCcEEEecccceeecccccccccccCcccCcChhhhcCCCCchHHHHHH
Confidence            45799999999987554321    001111257777653 245667765


No 153
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=26.25  E-value=36  Score=25.22  Aligned_cols=17  Identities=24%  Similarity=0.454  Sum_probs=13.4

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ...+|.|+|||+++.-.
T Consensus       137 ~~~~~kL~Dfg~a~~~~  153 (330)
T cd05601         137 RTGHIKLADFGSAARLT  153 (330)
T ss_pred             CCCCEEeccCCCCeECC
Confidence            35689999999998543


No 154
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=26.22  E-value=44  Score=24.98  Aligned_cols=16  Identities=13%  Similarity=0.241  Sum_probs=12.6

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ...++.|+|||+++.-
T Consensus       137 ~~~~~kL~DfG~a~~~  152 (332)
T cd05623         137 MNGHIRLADFGSCLKL  152 (332)
T ss_pred             CCCCEEEeecchheec
Confidence            4567999999998753


No 155
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=26.20  E-value=36  Score=24.53  Aligned_cols=45  Identities=13%  Similarity=0.092  Sum_probs=24.9

Q ss_pred             cCCeEEEEeccccccccCCc-eE-EecC-----CCCcccccc-CCchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK-IC-YYDL-----SQDEELFEG-EGDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~-~~-f~dL-----~~d~~~F~G-~gD~QfdiYr   52 (93)
                      .+..+.|+|||++|...++. .. +...     -..|+.+.+ .-+..-|||-
T Consensus       144 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~~y~~pE~~~~~~~~~~~Dv~s  196 (279)
T cd05111         144 SDSIVQIADFGVADLLYPDDKKYFYSEHKTPIKWMALESILFGRYTHQSDVWS  196 (279)
T ss_pred             CCCcEEEcCCccceeccCCCcccccCCCCCcccccCHHHhccCCcCchhhHHH
Confidence            45679999999998654321 11 1110     114666654 3345566665


No 156
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=26.19  E-value=55  Score=21.54  Aligned_cols=14  Identities=0%  Similarity=0.055  Sum_probs=8.9

Q ss_pred             CCeEEEEecccccc
Q psy15902          9 TQHFQVENFTISRC   22 (93)
Q Consensus         9 g~~vTIIDftLSR~   22 (93)
                      +.++.+|||+.++.
T Consensus       123 ~~~~~liDf~~a~~  136 (170)
T cd05151         123 DGRLWLIDWEYAGM  136 (170)
T ss_pred             CCeEEEEecccccC
Confidence            34567777777654


No 157
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=26.19  E-value=36  Score=25.32  Aligned_cols=15  Identities=13%  Similarity=0.399  Sum_probs=12.3

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      +..+.|+|||+++..
T Consensus       132 ~~~~kl~Dfg~~~~~  146 (316)
T cd05620         132 DGHIKIADFGMCKEN  146 (316)
T ss_pred             CCCEEeCccCCCeec
Confidence            457999999999853


No 158
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=26.15  E-value=62  Score=22.54  Aligned_cols=16  Identities=13%  Similarity=0.403  Sum_probs=13.1

Q ss_pred             CeEEEEeccccccccC
Q psy15902         10 QHFQVENFTISRCFVG   25 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~   25 (93)
                      ..+.|+|||+++....
T Consensus       134 ~~~kl~dfg~~~~~~~  149 (257)
T cd05040         134 DKVKIGDFGLMRALPQ  149 (257)
T ss_pred             CEEEeccccccccccc
Confidence            6799999999986543


No 159
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=26.14  E-value=79  Score=22.97  Aligned_cols=41  Identities=12%  Similarity=0.186  Sum_probs=25.3

Q ss_pred             CCeEEEEeccccccccCCc-----------eEEecCCCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-----------ICYYDLSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-----------~~f~dL~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      +..+.|+|||+++......           ..|.    -|+.+.+ .-+.+-|||..
T Consensus       173 ~~~~kl~D~g~~~~~~~~~~~~~~~~~~~~~~y~----aPE~~~~~~~~~~~Di~sl  225 (304)
T cd05101         173 NNVMKIADFGLARDVNNIDYYKKTTNGRLPVKWM----APEALFDRVYTHQSDVWSF  225 (304)
T ss_pred             CCcEEECCCccceecccccccccccCCCCCceee----CchhhccCCCCchhhHHHH
Confidence            4578999999998543211           1222    4666554 34567788874


No 160
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=26.13  E-value=63  Score=27.64  Aligned_cols=18  Identities=17%  Similarity=0.469  Sum_probs=14.5

Q ss_pred             CCeEEEEeccccccccCC
Q psy15902          9 TQHFQVENFTISRCFVGE   26 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~   26 (93)
                      ...|.|+|||+||.....
T Consensus       140 ~g~vkL~DFGls~~~~~~  157 (669)
T cd05610         140 EGHIKLTDFGLSKVTLNR  157 (669)
T ss_pred             CCCEEEEeCCCCccccCC
Confidence            357999999999977643


No 161
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=25.99  E-value=1e+02  Score=21.16  Aligned_cols=45  Identities=9%  Similarity=0.174  Sum_probs=26.8

Q ss_pred             CCeEEEEeccccccccCCceEEec-----CCCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYD-----LSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~d-----L~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ...+.|+||++++...........     .-.-|+.+.+ ..+.+-|+|..
T Consensus       146 ~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~~~pE~~~~~~~~~~~Dv~sl  196 (265)
T cd08217         146 NNNVKLGDFGLAKILGHDSSFAKTYVGTPYYMSPEQLNHMSYDEKSDIWSL  196 (265)
T ss_pred             CCCEEEecccccccccCCcccccccccCCCccChhhhcCCCCCchhHHHHH
Confidence            468999999999976533211110     0113666654 34677788874


No 162
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=25.91  E-value=68  Score=22.64  Aligned_cols=46  Identities=15%  Similarity=0.208  Sum_probs=25.5

Q ss_pred             cCCeEEEEeccccccccCCceE------EecCCCCccccccC-CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKIC------YYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~------f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ....+.|+||++++........      ++-.-.-|+.+.+. -+.+-|||-.
T Consensus       139 ~~~~~kl~df~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl  191 (263)
T cd05052         139 ENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAF  191 (263)
T ss_pred             CCCcEEeCCCccccccccceeeccCCCCCccccCCHHHhccCCCCchhHHHHH
Confidence            4457999999999876543210      00001136666653 3456677663


No 163
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=25.71  E-value=43  Score=25.88  Aligned_cols=17  Identities=12%  Similarity=0.335  Sum_probs=13.3

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      +..++.|+|||+++.-.
T Consensus       177 ~~~~ikL~DfG~a~~~~  193 (371)
T cd05622         177 KSGHLKLADFGTCMKMN  193 (371)
T ss_pred             CCCCEEEEeCCceeEcC
Confidence            35679999999998543


No 164
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=25.69  E-value=39  Score=24.81  Aligned_cols=17  Identities=12%  Similarity=0.309  Sum_probs=13.5

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ....+.|+|||+++...
T Consensus       138 ~~~~~kL~Dfg~~~~~~  154 (338)
T cd07859         138 ADCKLKICDFGLARVAF  154 (338)
T ss_pred             CCCcEEEccCccccccc
Confidence            35679999999998653


No 165
>KOG1094|consensus
Probab=25.69  E-value=34  Score=30.99  Aligned_cols=13  Identities=23%  Similarity=0.516  Sum_probs=11.9

Q ss_pred             CCeEEEEeccccc
Q psy15902          9 TQHFQVENFTISR   21 (93)
Q Consensus         9 g~~vTIIDftLSR   21 (93)
                      ..+|+|+|||+||
T Consensus       673 e~~iKiadfgmsR  685 (807)
T KOG1094|consen  673 EFTIKIADFGMSR  685 (807)
T ss_pred             cccEEecCccccc
Confidence            4789999999999


No 166
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=25.67  E-value=44  Score=23.86  Aligned_cols=45  Identities=16%  Similarity=0.220  Sum_probs=25.0

Q ss_pred             cCCeEEEEeccccccccCC-ce-----EEecCCCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGE-KI-----CYYDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~-~~-----~f~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ....+.|+|||+++.-... ..     +-+..-.-||.+.+. -+..-|||-
T Consensus       135 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Diws  186 (287)
T cd07848         135 HNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLGAPYGKAVDMWS  186 (287)
T ss_pred             CCCcEEEeeccCcccccccccccccccccccccCCcHHHcCCCCCCchhHHh
Confidence            3457999999999864321 11     111111247776653 345666665


No 167
>KOG1163|consensus
Probab=25.63  E-value=42  Score=27.52  Aligned_cols=19  Identities=5%  Similarity=0.239  Sum_probs=14.5

Q ss_pred             cccCCeEEEEecccccccc
Q psy15902          6 DIRTQHFQVENFTISRCFV   24 (93)
Q Consensus         6 ~~~g~~vTIIDftLSR~~~   24 (93)
                      +.+--++-+||||||.--.
T Consensus       147 grh~~kl~LIDFGLaKky~  165 (341)
T KOG1163|consen  147 GRHCNKLYLIDFGLAKKYR  165 (341)
T ss_pred             ccccceEEEEeccchhhhc
Confidence            4566789999999996433


No 168
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=25.56  E-value=54  Score=20.18  Aligned_cols=16  Identities=0%  Similarity=-0.056  Sum_probs=12.8

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      +..+.++||++++...
T Consensus       125 ~~~~~l~Df~~~~~~~  140 (155)
T cd05120         125 GKILGIIDWEYAGYGP  140 (155)
T ss_pred             CcEEEEEecccccCCC
Confidence            4679999999988644


No 169
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=25.51  E-value=79  Score=22.68  Aligned_cols=45  Identities=20%  Similarity=0.322  Sum_probs=26.1

Q ss_pred             cCCeEEEEeccccccccCCc-eEE-----ecCCCCccccccC--CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEK-ICY-----YDLSQDEELFEGE--GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~-~~f-----~dL~~d~~~F~G~--gD~QfdiYr   52 (93)
                      .+..+.|+|||+++.-.... ..+     ...-..|+.+.+.  -...-|||-
T Consensus       151 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Di~s  203 (302)
T cd07864         151 NKGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYGPAIDVWS  203 (302)
T ss_pred             CCCcEEeCcccccccccCCcccccccceeccCccChHHhcCCCCCCchhHHHH
Confidence            45689999999998654221 111     1111257777653  245677775


No 170
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=25.40  E-value=88  Score=22.09  Aligned_cols=45  Identities=13%  Similarity=0.119  Sum_probs=26.8

Q ss_pred             CCeEEEEeccccccccCCceEE------ecCCCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICY------YDLSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f------~dL~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      +..+.|+||++++...+....-      .-.-..|+.+.+ .-+..-|||..
T Consensus       136 ~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~y~~pe~~~~~~~~~~~Di~sl  187 (256)
T cd05113         136 QGCVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLLYSKFSSKSDVWAF  187 (256)
T ss_pred             CCCEEECCCccceecCCCceeecCCCccChhhCCHHHHhcCcccchhHHHHH
Confidence            4579999999998654332110      001125777765 33566777773


No 171
>KOG0983|consensus
Probab=25.23  E-value=36  Score=28.35  Aligned_cols=15  Identities=27%  Similarity=0.401  Sum_probs=11.9

Q ss_pred             CeEEEEecccccccc
Q psy15902         10 QHFQVENFTISRCFV   24 (93)
Q Consensus        10 ~~vTIIDftLSR~~~   24 (93)
                      ++|.+||||.|-.-.
T Consensus       229 GniKlCDFGIsGrlv  243 (391)
T KOG0983|consen  229 GNIKLCDFGISGRLV  243 (391)
T ss_pred             CCEEeecccccceee
Confidence            589999999985443


No 172
>PF01163 RIO1:  RIO1 family;  InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date.   Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=25.04  E-value=37  Score=24.85  Aligned_cols=14  Identities=7%  Similarity=0.014  Sum_probs=8.5

Q ss_pred             CCeEEEEecccccc
Q psy15902          9 TQHFQVENFTISRC   22 (93)
Q Consensus         9 g~~vTIIDftLSR~   22 (93)
                      ..++.||||+.+--
T Consensus       142 ~~~~~iIDf~qav~  155 (188)
T PF01163_consen  142 DGKVYIIDFGQAVD  155 (188)
T ss_dssp             TTCEEE--GTTEEE
T ss_pred             cceEEEEecCccee
Confidence            34899999986643


No 173
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=24.98  E-value=96  Score=20.67  Aligned_cols=47  Identities=11%  Similarity=0.092  Sum_probs=29.0

Q ss_pred             ecccCCeEEEEeccccccccCC-----------ceEEecCCCCcccccc----CCchhhHHH
Q psy15902          5 TDIRTQHFQVENFTISRCFVGE-----------KICYYDLSQDEELFEG----EGDYQFDMY   51 (93)
Q Consensus         5 ~~~~g~~vTIIDftLSR~~~~~-----------~~~f~dL~~d~~~F~G----~gD~QfdiY   51 (93)
                      ++..+..+.++|||+++.....           ..+-+..-..|+...+    ....+-|+|
T Consensus       134 ~~~~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~~t~~~~~pe~~~~~~~~~~~~~~D~~  195 (384)
T COG0515         134 LDRDGRVVKLIDFGLAKLLPDPGSTSSIPALPSTSVGTPGYMAPEVLLGLSLAYASSSSDIW  195 (384)
T ss_pred             ecCCCCeEEEeccCcceecCCCCccccccccccccccccccCCHHHhcCCCCCCCCchHhHH
Confidence            3444447999999999844322           1223333346777776    456777887


No 174
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=24.94  E-value=79  Score=23.03  Aligned_cols=47  Identities=15%  Similarity=0.154  Sum_probs=27.2

Q ss_pred             cCCeEEEEeccccccccCC-----ceEEecCCCCccccccC--CchhhHHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGE--GDYQFDMYRMM   54 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~--gD~QfdiYr~M   54 (93)
                      ....+.|+|||+++.....     ....+-.-.-||.+.|.  -+.+-|||...
T Consensus       143 ~~~~~kL~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~DvwslG  196 (309)
T cd07845         143 DKGCLKIADFGLARTYGLPAKPMTPKVVTLWYRAPELLLGCTTYTTAIDMWAVG  196 (309)
T ss_pred             CCCCEEECccceeeecCCccCCCCcccccccccChhhhcCCCCcCchHHHHHHH
Confidence            3467999999999865422     11111111257776553  35677777754


No 175
>KOG4055|consensus
Probab=24.73  E-value=49  Score=25.62  Aligned_cols=16  Identities=31%  Similarity=0.702  Sum_probs=13.0

Q ss_pred             CCchhhHHHHHHHHhh
Q psy15902         43 EGDYQFDMYRMMRKQC   58 (93)
Q Consensus        43 ~gD~QfdiYr~MR~~~   58 (93)
                      -|--.|-|||.||.--
T Consensus        77 aGSgeFHvYR~lRRrE   92 (213)
T KOG4055|consen   77 AGSGEFHVYRHLRRRE   92 (213)
T ss_pred             CCCchhHHHHHHHHHH
Confidence            4678899999999843


No 176
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=24.37  E-value=63  Score=22.88  Aligned_cols=45  Identities=9%  Similarity=0.134  Sum_probs=25.6

Q ss_pred             cCCeEEEEeccccccccCCce----EEecCCCCccccccC--CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE--GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~--gD~QfdiYr   52 (93)
                      .+.++.|+||++++.......    +-+..-.-|+.+.+.  -+.+-|+|.
T Consensus       134 ~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~s  184 (283)
T cd07830         134 GPEVVKIADFGLAREIRSRPPYTDYVSTRWYRAPEILLRSTSYSSPVDIWA  184 (283)
T ss_pred             CCCCEEEeecccceeccCCCCcCCCCCcccccCceeeecCcCcCCccchhh
Confidence            367899999999985543211    111111246666442  356667666


No 177
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=24.34  E-value=79  Score=23.74  Aligned_cols=46  Identities=11%  Similarity=0.135  Sum_probs=26.4

Q ss_pred             cCCeEEEEeccccccccCCce--EEecCCCCccccccC--CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI--CYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~--~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      ..+.+.|+|||+++....+..  +-+..-.-|+.+.+.  .+.+-|||-.
T Consensus       152 ~~~~~kL~dfg~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl  201 (342)
T cd07879         152 EDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILNWMHYNQTVDIWSV  201 (342)
T ss_pred             CCCCEEEeeCCCCcCCCCCCCCceeeecccChhhhcCccccCchHHHHHH
Confidence            356899999999987543221  111111247766542  3456677763


No 178
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=24.32  E-value=41  Score=23.69  Aligned_cols=17  Identities=18%  Similarity=0.298  Sum_probs=13.5

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ....+.|+|||+++...
T Consensus       147 ~~~~~kl~Dfg~~~~~~  163 (272)
T cd05075         147 ENMNVCVADFGLSKKIY  163 (272)
T ss_pred             CCCCEEECCCCcccccC
Confidence            35678999999999654


No 179
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=24.31  E-value=55  Score=24.66  Aligned_cols=45  Identities=11%  Similarity=0.158  Sum_probs=26.0

Q ss_pred             CCeEEEEeccccccccCCce----EEecCCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ..++.|+|||+++.......    ..+..-.-|+.+.+. -+.+-|||-.
T Consensus       154 ~~~~kL~Dfg~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dvwsl  203 (353)
T cd07850         154 DCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSV  203 (353)
T ss_pred             CCCEEEccCccceeCCCCCCCCCCcccccccCHHHHhCCCCCCchhhHhH
Confidence            45799999999986543211    111111247777663 3456677653


No 180
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=24.28  E-value=42  Score=24.95  Aligned_cols=16  Identities=6%  Similarity=0.185  Sum_probs=12.8

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +...+.|+|||+++..
T Consensus       136 ~~~~~kL~Dfg~~~~~  151 (324)
T cd05589         136 TEGFVKIADFGLCKEG  151 (324)
T ss_pred             CCCcEEeCcccCCccC
Confidence            3568999999999853


No 181
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=24.28  E-value=71  Score=22.82  Aligned_cols=46  Identities=11%  Similarity=0.211  Sum_probs=26.7

Q ss_pred             cCCeEEEEeccccccccCCce-----EEecCCCCcccccc-CCchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ++.++.|+||++++.......     .-+..-.-||...+ .-+.+-|+|..
T Consensus       136 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~apE~~~~~~~~~~~Dv~sl  187 (277)
T cd06640         136 EQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSL  187 (277)
T ss_pred             CCCCEEEcccccceeccCCccccccccCcccccCHhHhccCCCccHHHHHHH
Confidence            345799999999987553221     11111124666655 34677888863


No 182
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=24.25  E-value=72  Score=22.32  Aligned_cols=44  Identities=16%  Similarity=0.298  Sum_probs=25.4

Q ss_pred             CeEEEEeccccccccCCceEEecCC-----CCccccccC-CchhhHHHHH
Q psy15902         10 QHFQVENFTISRCFVGEKICYYDLS-----QDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus        10 ~~vTIIDftLSR~~~~~~~~f~dL~-----~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ..+.|+||++++...+.........     .-|+.+++. -+.+.|+|..
T Consensus       142 ~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~~pe~~~~~~~~~~~Dv~sl  191 (260)
T cd08222         142 NLLKIGDFGVSRLLMGSCDLATTFTGTPYYMSPEALKHQGYDSKSDIWSL  191 (260)
T ss_pred             CCEeecccCceeecCCCcccccCCCCCcCccCHHHHccCCCCchhhHHHH
Confidence            4589999999987654332211110     136666653 2456777763


No 183
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=24.23  E-value=1.1e+02  Score=21.60  Aligned_cols=43  Identities=14%  Similarity=0.077  Sum_probs=26.2

Q ss_pred             EEEEeccccccccCCceEEecC-CCCccccccC--CchhhHHHHHH
Q psy15902         12 FQVENFTISRCFVGEKICYYDL-SQDEELFEGE--GDYQFDMYRMM   54 (93)
Q Consensus        12 vTIIDftLSR~~~~~~~~f~dL-~~d~~~F~G~--gD~QfdiYr~M   54 (93)
                      +.++|||+++............ ---|+.+.+.  .+..-|||-..
T Consensus       147 ~~l~d~g~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~DiwslG  192 (258)
T cd05078         147 IKLSDPGISITVLPKEILLERIPWVPPECIENPQNLSLAADKWSFG  192 (258)
T ss_pred             EEecccccccccCCchhccccCCccCchhccCCCCCCchhhHHHHH
Confidence            7899999998665433211111 1257777753  35677888754


No 184
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=24.16  E-value=48  Score=24.85  Aligned_cols=16  Identities=13%  Similarity=0.345  Sum_probs=12.6

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ...++.|+|||+++..
T Consensus       137 ~~~~~kl~Dfg~~~~~  152 (331)
T cd05597         137 KNGHIRLADFGSCLRL  152 (331)
T ss_pred             CCCCEEEEECCceeec
Confidence            3457999999998754


No 185
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=24.03  E-value=48  Score=22.98  Aligned_cols=46  Identities=9%  Similarity=0.152  Sum_probs=26.7

Q ss_pred             cCCeEEEEeccccccccCCceEE-----ecCCCCccccccC-CchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICY-----YDLSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f-----~dL~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      ...++.|+||++++.-.......     ...-.-|+.+.+. -+.+-|||-.
T Consensus       136 ~~~~~~l~df~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl  187 (256)
T cd08529         136 AYDNVKIGDLGVAKLLSDNTNFANTIVGTPYYLSPELCEDKPYNEKSDVWAL  187 (256)
T ss_pred             CCCCEEEcccccceeccCccchhhccccCccccCHHHhcCCCCCCccchHHH
Confidence            34678999999988644322111     1111257777654 3566777764


No 186
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]
Probab=23.80  E-value=45  Score=28.02  Aligned_cols=17  Identities=18%  Similarity=0.597  Sum_probs=14.5

Q ss_pred             CCeEEEEeccccccccC
Q psy15902          9 TQHFQVENFTISRCFVG   25 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~   25 (93)
                      |++-.||||+||-+-..
T Consensus        34 gGkYRiIDF~LSN~vNS   50 (393)
T COG0448          34 GGKYRIIDFALSNCVNS   50 (393)
T ss_pred             CceeEEEeEEccccccc
Confidence            78889999999987663


No 187
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=23.78  E-value=52  Score=24.33  Aligned_cols=17  Identities=18%  Similarity=0.444  Sum_probs=13.3

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ...++.|+|||+++...
T Consensus       133 ~~~~~kL~Dfg~~~~~~  149 (318)
T cd05582         133 EEGHIKLTDFGLSKESI  149 (318)
T ss_pred             CCCcEEEeeccCCcccC
Confidence            34579999999998654


No 188
>KOG4236|consensus
Probab=23.41  E-value=34  Score=30.94  Aligned_cols=15  Identities=13%  Similarity=0.288  Sum_probs=12.6

Q ss_pred             CeEEEEecccccccc
Q psy15902         10 QHFQVENFTISRCFV   24 (93)
Q Consensus        10 ~~vTIIDftLSR~~~   24 (93)
                      -+|+|||||..|+--
T Consensus       704 PQvKlCDFGfARiIg  718 (888)
T KOG4236|consen  704 PQVKLCDFGFARIIG  718 (888)
T ss_pred             Cceeeccccceeecc
Confidence            369999999999754


No 189
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=23.38  E-value=50  Score=23.02  Aligned_cols=16  Identities=19%  Similarity=0.331  Sum_probs=12.9

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      +..+.|+||++++...
T Consensus       137 ~~~~kl~d~~~~~~~~  152 (256)
T cd08221         137 AGLIKLGDFGISKILG  152 (256)
T ss_pred             CCCEEECcCcceEEcc
Confidence            4679999999998654


No 190
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=23.34  E-value=45  Score=23.78  Aligned_cols=16  Identities=6%  Similarity=0.177  Sum_probs=13.0

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ..++.|+|||++|...
T Consensus       160 ~~~~kl~Dfg~~~~~~  175 (283)
T cd05091         160 KLNVKISDLGLFREVY  175 (283)
T ss_pred             CCceEecccccccccc
Confidence            4579999999999654


No 191
>KOG0198|consensus
Probab=23.28  E-value=52  Score=26.31  Aligned_cols=54  Identities=13%  Similarity=0.180  Sum_probs=30.5

Q ss_pred             eecccCCeEEEEeccccccccC--C------ceEEecCCCCccccc-cC-CchhhHHHHHHHHh
Q psy15902          4 LTDIRTQHFQVENFTISRCFVG--E------KICYYDLSQDEELFE-GE-GDYQFDMYRMMRKQ   57 (93)
Q Consensus         4 ~~~~~g~~vTIIDftLSR~~~~--~------~~~f~dL~~d~~~F~-G~-gD~QfdiYr~MR~~   57 (93)
                      |++.++..+.|.|||+++...+  .      ...=+-.--.|+.-. |. .++--||+-.+-.+
T Consensus       149 Ll~~~~~~~KlaDFG~a~~~~~~~~~~~~~~~~~Gtp~~maPEvi~~g~~~~~~sDiWSlGCtV  212 (313)
T KOG0198|consen  149 LLDPSNGDVKLADFGLAKKLESKGTKSDSELSVQGTPNYMAPEVIRNGEVARRESDIWSLGCTV  212 (313)
T ss_pred             EEeCCCCeEEeccCccccccccccccccccccccCCccccCchhhcCCCcCCccchhhhcCCEE
Confidence            4555578999999999986653  0      011111112567766 32 23456666665543


No 192
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=23.03  E-value=46  Score=23.47  Aligned_cols=16  Identities=13%  Similarity=0.306  Sum_probs=12.8

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      .+..+.|+|||+++..
T Consensus       141 ~~~~~~l~Dfg~~~~~  156 (265)
T cd06652         141 SVGNVKLGDFGASKRL  156 (265)
T ss_pred             CCCCEEECcCcccccc
Confidence            3567999999999853


No 193
>PF10134 RPA:  Replication initiator protein A;  InterPro: IPR018777  Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination. 
Probab=23.00  E-value=49  Score=25.12  Aligned_cols=49  Identities=16%  Similarity=0.310  Sum_probs=32.1

Q ss_pred             cCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcCC
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNN   61 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~~   61 (93)
                      ..++|||.|.-.--+. ++.+...    ||+.|.=++-.-.-+||.-|++++.+
T Consensus       139 ~~v~I~L~~wl~~~i~-~~~vltl----d~~yf~L~~pl~R~LYrlarkh~g~q  187 (229)
T PF10134_consen  139 STVEITLSDWLYRSIR-AGYVLTL----DPDYFRLRKPLERRLYRLARKHCGRQ  187 (229)
T ss_pred             EEEEEEECHHHHHHHH-hCccEEe----cHHHhhCCChHHHHHHHHHHHhcCCC
Confidence            4456666666555554 3333333    77889656667777999999998653


No 194
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=22.99  E-value=45  Score=25.00  Aligned_cols=16  Identities=6%  Similarity=0.247  Sum_probs=12.8

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      +...+.|+|||+++..
T Consensus       131 ~~~~~kL~Dfg~~~~~  146 (329)
T cd05588         131 AEGHIKLTDYGMCKEG  146 (329)
T ss_pred             CCCCEEECcCcccccc
Confidence            3467999999999853


No 195
>KOG0597|consensus
Probab=22.90  E-value=50  Score=29.98  Aligned_cols=31  Identities=19%  Similarity=0.361  Sum_probs=22.5

Q ss_pred             cCCeEEEEeccccccccCC---------ceEEecCCCCcccccc
Q psy15902          8 RTQHFQVENFTISRCFVGE---------KICYYDLSQDEELFEG   42 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~---------~~~f~dL~~d~~~F~G   42 (93)
                      .|+.+++|||||.|+...+         ..+|+    -||+.+|
T Consensus       135 ~~~~~KlcdFg~Ar~m~~~t~vltsikGtPlYm----APElv~e  174 (808)
T KOG0597|consen  135 KGGTLKLCDFGLARAMSTNTSVLTSIKGTPLYM----APELVEE  174 (808)
T ss_pred             CCCceeechhhhhhhcccCceeeeeccCccccc----CHHHHcC
Confidence            5788999999999987643         34554    4666664


No 196
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=22.61  E-value=53  Score=22.98  Aligned_cols=45  Identities=11%  Similarity=0.176  Sum_probs=24.9

Q ss_pred             cCCeEEEEeccccccccCCceEEecC----CCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKICYYDL----SQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~~f~dL----~~d~~~F~G~-gD~QfdiYr   52 (93)
                      +..++.|+||++++........-...    --.|+.+.+. .+.+-|+|.
T Consensus       135 ~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~s  184 (258)
T cd05578         135 EQGHVHITDFNIATKVTPDTLTTSTSGTPGYMAPEVLCRQGYSVAVDWWS  184 (258)
T ss_pred             CCCCEEEeecccccccCCCccccccCCChhhcCHHHHcccCCCCcccchh
Confidence            34679999999998765432110000    0146666653 245555555


No 197
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=22.57  E-value=54  Score=23.73  Aligned_cols=16  Identities=6%  Similarity=0.212  Sum_probs=13.0

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ...+.|+|||+++...
T Consensus       138 ~~~~~l~Dfg~~~~~~  153 (285)
T cd05605         138 YGHIRISDLGLAVEIP  153 (285)
T ss_pred             CCCEEEeeCCCceecC
Confidence            4679999999998643


No 198
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=22.34  E-value=53  Score=23.46  Aligned_cols=17  Identities=18%  Similarity=0.382  Sum_probs=13.4

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      +...+.|+|||+++...
T Consensus       159 ~~~~~kl~dfg~~~~~~  175 (283)
T cd05090         159 EQLHVKISDLGLSREIY  175 (283)
T ss_pred             CCCcEEecccccccccc
Confidence            34679999999998653


No 199
>KOG0671|consensus
Probab=22.21  E-value=99  Score=26.29  Aligned_cols=18  Identities=11%  Similarity=0.108  Sum_probs=15.1

Q ss_pred             cCCeEEEEeccccccccC
Q psy15902          8 RTQHFQVENFTISRCFVG   25 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~   25 (93)
                      ..-+|.+||||-++....
T Consensus       247 ks~~I~vIDFGsAtf~~e  264 (415)
T KOG0671|consen  247 KSTAIKVIDFGSATFDHE  264 (415)
T ss_pred             CCcceEEEecCCcceecc
Confidence            367899999999998774


No 200
>CHL00073 chlN photochlorophyllide reductase subunit N
Probab=22.13  E-value=21  Score=30.14  Aligned_cols=20  Identities=20%  Similarity=0.263  Sum_probs=16.8

Q ss_pred             cCCCCCCCchhHHHHHHHHH
Q psy15902         59 QNNWQNFTPKNNALDIDGLI   78 (93)
Q Consensus        59 ~~~W~~f~P~TNvlWL~YL~   78 (93)
                      .|+-+.|||.|-|.|||.=+
T Consensus        15 ~g~~~~fc~~~~~~wl~~~I   34 (457)
T CHL00073         15 TGNYHTFCPISCVAWLYQKI   34 (457)
T ss_pred             cCCccccCCcceEeeecccc
Confidence            36788999999999999643


No 201
>KOG1006|consensus
Probab=22.13  E-value=47  Score=27.53  Aligned_cols=17  Identities=24%  Similarity=0.362  Sum_probs=13.1

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      +.+.|.+||||.|---.
T Consensus       203 r~G~vKLCDFGIcGqLv  219 (361)
T KOG1006|consen  203 RHGDVKLCDFGICGQLV  219 (361)
T ss_pred             cCCCEeeecccchHhHH
Confidence            34689999999986443


No 202
>PF08685 GON:  GON domain;  InterPro: IPR012314 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. The ADAMTSs (a disintegrin and metalloproteinase domain with thrombospondin type-1 modules) are a family of zinc dependent metalloproteinases that play important roles in a variety of normal and pathological conditions. These enzymes show a complex domain organisation including signal sequence, propeptide, metalloproteinase domain (see PDOC50215 from PROSITEDOC), disintegrin-like domain (see PDOC00351 from PROSITEDOC), central TS-1 motif (see PDOC50092 from PROSITEDOC), cysteine-rich region, and a variable number of TS-like repeats at the C-terminal region. The GON domain is an approximately 200-residue module, whose presence is the hallmark of a subfamily of structurally and evolutionarily related ADAMTSs, called GON- ADAMTSs. The GON domain is characterised by the presence of several conserved cysteine residues and is likely to be globular [], []. Some proteins known to contain a GON domain are listed below:  Mammalian ADAMTS-9 Mammalian ADAMTS-20  Caenorhabditis elegans gon-1, a protease required for gonadal morphogenesis   Proteins containing the GON domain belong to MEROPS peptidase subfamily M12B (adamalysin, clan MA).; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding
Probab=22.04  E-value=48  Score=25.40  Aligned_cols=24  Identities=25%  Similarity=0.289  Sum_probs=20.9

Q ss_pred             ceecccCCeEEEEeccccccccCC
Q psy15902          3 ALTDIRTQHFQVENFTISRCFVGE   26 (93)
Q Consensus         3 ~~~~~~g~~vTIIDftLSR~~~~~   26 (93)
                      +++|++.++|.+-||++|+-..+.
T Consensus        96 vRid~~tl~I~~~D~tFa~t~~G~  119 (201)
T PF08685_consen   96 VRIDPSTLRIITNDFTFARTTGGN  119 (201)
T ss_pred             EEEcccccEEEeCCceEeeccCCc
Confidence            578999999999999999988543


No 203
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=22.00  E-value=57  Score=24.24  Aligned_cols=12  Identities=8%  Similarity=-0.039  Sum_probs=9.9

Q ss_pred             CCeEEEEecccc
Q psy15902          9 TQHFQVENFTIS   20 (93)
Q Consensus         9 g~~vTIIDftLS   20 (93)
                      +.++.||||+.|
T Consensus       160 ~~~v~iIDF~qa  171 (197)
T cd05146         160 DGKVWFIDVSQS  171 (197)
T ss_pred             CCcEEEEECCCc
Confidence            568999999955


No 204
>PLN00017 photosystem I reaction centre subunit VI; Provisional
Probab=21.96  E-value=33  Score=23.36  Aligned_cols=14  Identities=36%  Similarity=0.681  Sum_probs=11.9

Q ss_pred             ccccCCceEEecCC
Q psy15902         21 RCFVGEKICYYDLS   34 (93)
Q Consensus        21 R~~~~~~~~f~dL~   34 (93)
                      .++.+++.+|.||.
T Consensus         5 ~AKYGe~SvYFDL~   18 (90)
T PLN00017          5 SAKYGDKSVYFDLG   18 (90)
T ss_pred             ccccCcceeEEEhh
Confidence            46788999999996


No 205
>PF06658 DUF1168:  Protein of unknown function (DUF1168);  InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=21.95  E-value=66  Score=23.32  Aligned_cols=15  Identities=33%  Similarity=0.736  Sum_probs=12.3

Q ss_pred             CCchhhHHHHHHHHh
Q psy15902         43 EGDYQFDMYRMMRKQ   57 (93)
Q Consensus        43 ~gD~QfdiYr~MR~~   57 (93)
                      -|---|.|||.+|..
T Consensus        33 AGSGeFHvYR~~RRr   47 (142)
T PF06658_consen   33 AGSGEFHVYRASRRR   47 (142)
T ss_pred             cCccHHHHHHHHHHH
Confidence            366789999999974


No 206
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=21.72  E-value=97  Score=22.05  Aligned_cols=45  Identities=13%  Similarity=0.109  Sum_probs=25.1

Q ss_pred             CCeEEEEeccccccccCCceEEecC-------CCCcccccc-CCchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYDL-------SQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~dL-------~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      ...+.|+||++++........+...       -.-|+.+++ .-+..-|||..
T Consensus       145 ~~~~kL~dfg~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~sl  197 (279)
T cd05057         145 PQHVKITDFGLAKLLDVDEKEYHAEGGKVPIKWMALESILHRIYTHKSDVWSY  197 (279)
T ss_pred             CCeEEECCCcccccccCcccceecCCCcccccccCHHHhhcCCcCchhhHHHH
Confidence            4578999999998755332211100       013665553 33556667663


No 207
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=21.69  E-value=55  Score=23.13  Aligned_cols=16  Identities=0%  Similarity=0.071  Sum_probs=12.8

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      ...+.|+|||+++...
T Consensus       136 ~~~~kl~dfg~~~~~~  151 (269)
T cd05042         136 DLSVKIGDYGLALEQY  151 (269)
T ss_pred             CCcEEEeccccccccc
Confidence            4578999999998653


No 208
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=21.57  E-value=73  Score=21.66  Aligned_cols=45  Identities=11%  Similarity=0.132  Sum_probs=28.4

Q ss_pred             CCeEEEEeccccccccCCce------EEec-CCCCccccccC-CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKI------CYYD-LSQDEELFEGE-GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~------~f~d-L~~d~~~F~G~-gD~QfdiYr~   53 (93)
                      +.++.|+||+.++.......      .... .-..|+.+.+. .+.+.|||..
T Consensus       137 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~y~~pE~~~~~~~~~~~Dv~sl  189 (260)
T cd06606         137 DGVVKLADFGCAKRLGDIETGEGTGSVRGTPYWMAPEVIRGEEYGRAADIWSL  189 (260)
T ss_pred             CCCEEEcccccEEecccccccccccCCCCCccccCHhhhcCCCCCchhhHHHH
Confidence            57899999999987654321      0000 01147777654 6778888875


No 209
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=21.52  E-value=55  Score=24.61  Aligned_cols=44  Identities=14%  Similarity=0.182  Sum_probs=24.8

Q ss_pred             CCeEEEEeccccccccCC---ceEEecCCCCccccccC-CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGE---KICYYDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~---~~~f~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ...+.|+|||+++...+.   ...-+..-.-||.+.|. -+..-|||-
T Consensus       140 ~~~~kL~Dfg~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dvws  187 (333)
T cd06650         140 RGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWS  187 (333)
T ss_pred             CCCEEEeeCCcchhhhhhccccCCCCccccCHHHhcCCCCCcHHHHHH
Confidence            457999999999854321   11111111247777763 345567665


No 210
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=21.51  E-value=1e+02  Score=22.55  Aligned_cols=45  Identities=11%  Similarity=0.189  Sum_probs=27.4

Q ss_pred             CCeEEEEeccccccccCCc--------eEEecCCCCccccccC--CchhhHHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGE--GDYQFDMYRM   53 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~--gD~QfdiYr~   53 (93)
                      ...|.|+|||++.......        .+-+..-.-|+.+.+.  .+..-|||..
T Consensus       139 ~~~~~L~dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~sDi~sl  193 (330)
T cd07834         139 NCDLKICDFGLARGVDPDEDEKGFLTEYVVTRWYRAPELLLSSSRYTKAIDIWSV  193 (330)
T ss_pred             CCCEEEcccCceEeecccccccccccccccccCcCCceeeecccCCCcchhHHHH
Confidence            4789999999999765432        1111112357777764  3456677764


No 211
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=21.47  E-value=56  Score=23.65  Aligned_cols=17  Identities=18%  Similarity=0.397  Sum_probs=13.4

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ....+.|+|||+++...
T Consensus       164 ~~~~~kl~dfg~~~~~~  180 (295)
T cd05097         164 NHYTIKIADFGMSRNLY  180 (295)
T ss_pred             CCCcEEecccccccccc
Confidence            34579999999998644


No 212
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=21.27  E-value=60  Score=23.43  Aligned_cols=44  Identities=16%  Similarity=0.277  Sum_probs=24.1

Q ss_pred             CCeEEEEeccccccccCCceE---E--ecCCCCccccccC-CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKIC---Y--YDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~---f--~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      +..+.|+|||+++.-......   +  +..-.-||.+++. -+.+-|||-
T Consensus       133 ~~~~~l~dfg~~~~~~~~~~~~~~~~g~~~y~aPE~~~~~~~~~~~Dvws  182 (280)
T cd05608         133 DGNVRISDLGLAVELKDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFA  182 (280)
T ss_pred             CCCEEEeeCccceecCCCCccccccCCCcCccCHHHhcCCCCCccccHHH
Confidence            467999999999753322110   0  0011247777653 345566665


No 213
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=21.08  E-value=62  Score=24.50  Aligned_cols=14  Identities=14%  Similarity=0.418  Sum_probs=11.9

Q ss_pred             CCeEEEEecccccc
Q psy15902          9 TQHFQVENFTISRC   22 (93)
Q Consensus         9 g~~vTIIDftLSR~   22 (93)
                      ..+|.|+|||+++.
T Consensus       137 ~~~vkL~DfG~~~~  150 (360)
T cd05627         137 KGHVKLSDFGLCTG  150 (360)
T ss_pred             CCCEEEeeccCCcc
Confidence            46799999999874


No 214
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=21.08  E-value=59  Score=24.12  Aligned_cols=17  Identities=12%  Similarity=0.374  Sum_probs=13.2

Q ss_pred             cCCeEEEEecccccccc
Q psy15902          8 RTQHFQVENFTISRCFV   24 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~   24 (93)
                      ...++.|+|||+++...
T Consensus       136 ~~~~~kL~Dfg~~~~~~  152 (350)
T cd05573         136 ADGHIKLADFGLCKKMN  152 (350)
T ss_pred             CCCCEEeecCCCCccCc
Confidence            34679999999998543


No 215
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]
Probab=21.06  E-value=49  Score=28.05  Aligned_cols=16  Identities=13%  Similarity=0.229  Sum_probs=13.8

Q ss_pred             CCeEEEEecccccccc
Q psy15902          9 TQHFQVENFTISRCFV   24 (93)
Q Consensus         9 g~~vTIIDftLSR~~~   24 (93)
                      -+.+||||+-|||...
T Consensus       151 ~g~~t~idldlsry~~  166 (531)
T COG4650         151 AGEVTIIDLDLSRYNA  166 (531)
T ss_pred             CCceEEEecchHHHHH
Confidence            4789999999999764


No 216
>PF08222 HTH_CodY:  CodY helix-turn-helix domain;  InterPro: IPR013198 This family consists of the C-terminal helix-turn-helix domain found in several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins. CodY has been found to repress the dipeptide transport operon (dpp) of Bacillus subtilis in nutrient-rich conditions []. The CodY protein also has a repressor effect on many genes in Lactococcus lactis during growth in milk [].; PDB: 2B0L_C.
Probab=20.97  E-value=42  Score=21.39  Aligned_cols=16  Identities=31%  Similarity=0.601  Sum_probs=13.4

Q ss_pred             HHhhhhhhhccCCccC
Q psy15902         77 LIESSQLLDVDGLIES   92 (93)
Q Consensus        77 L~~~l~Ll~~kgl~~~   92 (93)
                      ++..|+.|++.|+++|
T Consensus        21 IVNALRKleSaGvIes   36 (61)
T PF08222_consen   21 IVNALRKLESAGVIES   36 (61)
T ss_dssp             HHHHHHHHHHTTSEEE
T ss_pred             HHHHHHHHHhcCceee
Confidence            5667899999999986


No 217
>PF09178 DUF1945:  Domain of unknown function (DUF1945);  InterPro: IPR015261 Members of this entry, which are predominantly found in prokaryotic 4-alpha-glucanotransferase, adopt a structure composed of six antiparallel beta-strands, four of which form a beta-sheet and another two form a type I, beta-hairpin. The role of this family of domains, has not, as yet, been defined []. ; PDB: 1LWH_B 1LWJ_B.
Probab=20.94  E-value=49  Score=20.29  Aligned_cols=16  Identities=38%  Similarity=0.619  Sum_probs=12.5

Q ss_pred             eEEecCCCCccccccC
Q psy15902         28 ICYYDLSQDEELFEGE   43 (93)
Q Consensus        28 ~~f~dL~~d~~~F~G~   43 (93)
                      .+|.+|+.++..|+|.
T Consensus        26 kv~HNlSg~E~vFEGv   41 (51)
T PF09178_consen   26 KVFHNLSGEEVVFEGV   41 (51)
T ss_dssp             EEEEE-SSS-EEETTE
T ss_pred             EEEEecCCCEEEEEEE
Confidence            5899999999999994


No 218
>PF06688 DUF1187:  Protein of unknown function (DUF1187);  InterPro: IPR009572 This family consists of several short, hypothetical bacterial proteins of around 62 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi. The function of this family is unknown.
Probab=20.93  E-value=57  Score=20.81  Aligned_cols=16  Identities=19%  Similarity=0.156  Sum_probs=13.5

Q ss_pred             cCCeEEEEeccccccc
Q psy15902          8 RTQHFQVENFTISRCF   23 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~   23 (93)
                      ++.+|.+.||.+++..
T Consensus        44 ~~~kV~vedF~C~~v~   59 (61)
T PF06688_consen   44 FGVKVHVEDFICEEVP   59 (61)
T ss_pred             ccceeEEEEEEEEecC
Confidence            6788999999998764


No 219
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=20.89  E-value=51  Score=23.45  Aligned_cols=46  Identities=11%  Similarity=0.093  Sum_probs=25.3

Q ss_pred             cCCeEEEEeccccccccCCce--EEec----C-CCCcccccc-CCchhhHHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI--CYYD----L-SQDEELFEG-EGDYQFDMYRM   53 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~--~f~d----L-~~d~~~F~G-~gD~QfdiYr~   53 (93)
                      .+..+.|+|||+++.......  ....    + -.-||.+.+ .-+..-|||-.
T Consensus       159 ~~~~~~L~dfg~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~sDv~sl  212 (283)
T cd05048         159 EGLTVKISDFGLSRDIYSADYYRVQSKSLLPVRWMPPEAILYGKFTTESDIWSF  212 (283)
T ss_pred             CCCcEEECCCcceeeccccccccccCCCcccccccCHHHhccCcCchhhhHHHH
Confidence            356799999999986432210  0000    0 013565543 44567788774


No 220
>KOG0666|consensus
Probab=20.57  E-value=56  Score=27.71  Aligned_cols=15  Identities=13%  Similarity=0.430  Sum_probs=13.6

Q ss_pred             CeEEEEecccccccc
Q psy15902         10 QHFQVENFTISRCFV   24 (93)
Q Consensus        10 ~~vTIIDftLSR~~~   24 (93)
                      +.|.|.|+||+|+-.
T Consensus       173 G~VKIaDlGlaR~~~  187 (438)
T KOG0666|consen  173 GRVKIADLGLARLFN  187 (438)
T ss_pred             CeeEeecccHHHHhh
Confidence            789999999999865


No 221
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=20.43  E-value=95  Score=22.38  Aligned_cols=44  Identities=9%  Similarity=0.143  Sum_probs=24.4

Q ss_pred             CCeEEEEeccccccccCCceEEecC--CCCccccccC-CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEKICYYDL--SQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~~~f~dL--~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ...+.|+||++++...+........  -..|+.+.+. .+.+-|||.
T Consensus       137 ~~~~kl~dfg~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~s  183 (290)
T cd05580         137 DGYIKITDFGFAKRVKGRTYTLCGTPEYLAPEIILSKGYGKAVDWWA  183 (290)
T ss_pred             CCCEEEeeCCCccccCCCCCCCCCCccccChhhhcCCCCCccccHHH
Confidence            4568999999998765432111110  1246766653 334456555


No 222
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=20.39  E-value=63  Score=24.79  Aligned_cols=14  Identities=14%  Similarity=0.430  Sum_probs=11.6

Q ss_pred             CCeEEEEecccccc
Q psy15902          9 TQHFQVENFTISRC   22 (93)
Q Consensus         9 g~~vTIIDftLSR~   22 (93)
                      ...+.|+|||+|+.
T Consensus       137 ~~~~kL~DFGl~~~  150 (381)
T cd05626         137 DGHIKLTDFGLCTG  150 (381)
T ss_pred             CCCEEEeeCcCCcc
Confidence            45799999999864


No 223
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=20.34  E-value=88  Score=28.90  Aligned_cols=15  Identities=0%  Similarity=-0.117  Sum_probs=12.5

Q ss_pred             CCeEEEEeccccccc
Q psy15902          9 TQHFQVENFTISRCF   23 (93)
Q Consensus         9 g~~vTIIDftLSR~~   23 (93)
                      ..++.|+|||+++..
T Consensus       149 dg~vKLiDFGLAk~i  163 (932)
T PRK13184        149 FGEVVILDWGAAIFK  163 (932)
T ss_pred             CCCEEEEecCcceec
Confidence            457899999999865


No 224
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=20.32  E-value=55  Score=22.94  Aligned_cols=45  Identities=9%  Similarity=0.070  Sum_probs=24.2

Q ss_pred             cCCeEEEEeccccccccCCce-EEecC-CCCccccccC-CchhhHHHH
Q psy15902          8 RTQHFQVENFTISRCFVGEKI-CYYDL-SQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         8 ~g~~vTIIDftLSR~~~~~~~-~f~dL-~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ....+.|+|||+++....... ..... -.-|+.+++. -+..-|||.
T Consensus       137 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~s  184 (256)
T cd05082         137 EDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWS  184 (256)
T ss_pred             CCCcEEecCCccceeccccCCCCccceeecCHHHHccCCCCchhhhHH
Confidence            356799999999986543211 10000 1247777653 234455554


No 225
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=20.01  E-value=82  Score=21.76  Aligned_cols=44  Identities=9%  Similarity=0.121  Sum_probs=26.2

Q ss_pred             CCeEEEEeccccccccCCc-----eEEecCCCCccccccC-CchhhHHHH
Q psy15902          9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGE-GDYQFDMYR   52 (93)
Q Consensus         9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~-gD~QfdiYr   52 (93)
                      ..++.|+||+++.......     ...+..-..|+.+.+. -+.+-|||.
T Consensus       135 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~s  184 (256)
T cd06612         135 EGQAKLADFGVSGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNNKADIWS  184 (256)
T ss_pred             CCcEEEcccccchhcccCccccccccCCccccCHHHHhcCCCCchhhHHH
Confidence            4578999999988654321     1111122357777764 355677775


Done!