Query psy15902
Match_columns 93
No_of_seqs 103 out of 162
Neff 4.5
Searched_HMMs 46136
Date Sat Aug 17 00:32:49 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy15902.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15902hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG5072 ALK1 Serine/threonine 100.0 1.1E-30 2.4E-35 214.0 4.6 80 8-89 356-435 (488)
2 PF12330 DUF3635: Domain of un 99.9 2.6E-28 5.7E-33 165.5 5.3 53 37-91 1-53 (98)
3 KOG2464|consensus 97.9 2.8E-06 6E-11 64.3 1.0 73 5-79 162-234 (246)
4 KOG0192|consensus 89.4 0.24 5.2E-06 39.9 2.0 49 3-53 174-232 (362)
5 KOG0593|consensus 80.0 0.66 1.4E-05 38.6 0.4 26 7-32 135-160 (396)
6 KOG0583|consensus 78.7 1.6 3.4E-05 35.1 2.2 37 5-45 153-198 (370)
7 KOG0594|consensus 77.3 0.5 1.1E-05 38.3 -1.0 54 9-62 156-245 (323)
8 PF00069 Pkinase: Protein kina 71.2 1.7 3.7E-05 30.3 0.6 50 4-54 130-186 (260)
9 TIGR03724 arch_bud32 Kae1-asso 71.1 7 0.00015 26.9 3.6 16 9-24 125-140 (199)
10 cd07867 STKc_CDC2L6 Catalytic 71.0 4.6 0.0001 29.4 2.8 46 8-53 147-202 (317)
11 PRK14879 serine/threonine prot 70.8 7 0.00015 27.1 3.6 15 9-23 130-144 (211)
12 cd07868 STKc_CDK8 Catalytic do 68.5 5 0.00011 29.4 2.6 45 8-52 147-201 (317)
13 PLN00009 cyclin-dependent kina 68.1 5.1 0.00011 29.0 2.5 50 4-53 134-190 (294)
14 KOG0581|consensus 67.4 2.7 5.8E-05 34.8 1.0 18 8-25 214-231 (364)
15 cd05145 RIO1_like RIO kinase f 63.5 5.1 0.00011 28.2 1.8 16 9-24 153-168 (190)
16 cd07874 STKc_JNK3 Catalytic do 63.1 7.1 0.00015 29.4 2.6 45 8-52 154-203 (355)
17 KOG0199|consensus 61.3 4.7 0.0001 37.0 1.5 17 10-26 249-265 (1039)
18 KOG1187|consensus 61.2 5.7 0.00012 31.7 1.8 39 3-42 208-252 (361)
19 cd05612 STKc_PRKX_like Catalyt 59.5 9 0.00019 28.0 2.5 46 8-53 136-184 (291)
20 PTZ00283 serine/threonine prot 58.8 9.6 0.00021 31.2 2.8 42 8-53 178-231 (496)
21 cd07876 STKc_JNK2 Catalytic do 56.1 13 0.00027 28.2 2.9 46 8-53 158-208 (359)
22 COG3642 Mn2+-dependent serine/ 55.7 4.9 0.00011 30.9 0.6 20 7-26 125-144 (204)
23 cd07875 STKc_JNK1 Catalytic do 55.4 11 0.00024 28.5 2.5 45 8-52 161-210 (364)
24 cd07870 STKc_PFTAIRE2 Catalyti 54.2 19 0.00041 26.0 3.4 45 9-53 139-190 (291)
25 KOG0984|consensus 53.7 6.5 0.00014 31.4 1.0 17 9-25 185-201 (282)
26 cd05037 PTK_Jak_rpt1 Pseudokin 52.1 14 0.00031 25.7 2.4 44 10-53 145-192 (259)
27 cd05119 RIO RIO kinase family, 51.6 11 0.00023 25.7 1.7 17 9-25 150-166 (187)
28 cd05147 RIO1_euk RIO kinase fa 51.3 9.1 0.0002 27.4 1.4 13 9-21 153-165 (190)
29 cd07871 STKc_PCTAIRE3 Catalyti 50.6 16 0.00035 26.6 2.6 45 9-53 139-190 (288)
30 KOG0663|consensus 50.2 8.3 0.00018 32.5 1.1 65 2-66 206-306 (419)
31 PHA02882 putative serine/threo 49.4 18 0.00039 26.5 2.7 64 9-72 162-243 (294)
32 cd07869 STKc_PFTAIRE1 Catalyti 48.9 13 0.00029 27.1 1.9 44 9-52 139-189 (303)
33 cd07872 STKc_PCTAIRE2 Catalyti 48.8 19 0.00042 26.4 2.8 45 9-53 140-191 (309)
34 PRK09188 serine/threonine prot 48.5 11 0.00024 30.5 1.6 15 9-23 148-162 (365)
35 PTZ00036 glycogen synthase kin 48.5 11 0.00023 30.2 1.5 50 3-52 201-256 (440)
36 cd00180 PKc Catalytic domain o 48.3 21 0.00046 23.0 2.7 45 9-53 129-180 (215)
37 PTZ00263 protein kinase A cata 47.8 9.3 0.0002 28.7 1.0 18 8-25 153-170 (329)
38 cd05631 STKc_GRK4 Catalytic do 47.6 16 0.00034 26.6 2.1 16 9-24 138-153 (285)
39 PHA02988 hypothetical protein; 46.9 12 0.00025 27.5 1.4 40 9-52 159-207 (283)
40 KOG0197|consensus 46.5 12 0.00027 31.9 1.6 17 9-25 339-355 (468)
41 KOG0659|consensus 46.1 14 0.00031 30.1 1.9 36 8-43 136-176 (318)
42 cd07844 STKc_PCTAIRE_like Cata 46.1 19 0.0004 25.9 2.3 45 8-52 138-189 (291)
43 cd05611 STKc_Rim15_like Cataly 46.0 21 0.00046 25.1 2.6 45 9-53 133-179 (260)
44 KOG1026|consensus 46.0 10 0.00022 34.3 1.1 17 8-24 638-654 (774)
45 cd05108 PTKc_EGFR Catalytic do 46.0 19 0.00042 26.5 2.4 17 8-24 144-160 (316)
46 cd05595 STKc_PKB_beta Catalyti 45.5 17 0.00036 27.3 2.0 45 8-52 130-180 (323)
47 cd05584 STKc_p70S6K Catalytic 45.3 14 0.00031 27.5 1.6 45 8-52 135-185 (323)
48 cd07853 STKc_NLK Catalytic dom 44.0 16 0.00034 27.9 1.7 46 8-53 138-191 (372)
49 PTZ00426 cAMP-dependent protei 43.6 14 0.00031 28.2 1.5 17 8-24 166-182 (340)
50 cd07836 STKc_Pho85 Catalytic d 43.0 29 0.00063 24.6 2.9 46 8-53 135-187 (284)
51 cd06618 PKc_MKK7 Catalytic dom 43.0 25 0.00054 25.5 2.6 17 8-24 150-166 (296)
52 cd07839 STKc_CDK5 Catalytic do 42.9 22 0.00048 25.3 2.3 46 8-53 134-186 (284)
53 cd05118 STKc_CMGC Catalytic do 42.5 23 0.00051 25.0 2.3 46 8-53 133-185 (283)
54 KOG0658|consensus 42.4 19 0.00042 29.9 2.1 23 3-25 156-178 (364)
55 KOG0194|consensus 42.4 14 0.0003 31.4 1.3 14 11-24 300-313 (474)
56 KOG0667|consensus 41.5 18 0.00039 31.8 1.9 17 10-26 328-344 (586)
57 cd05109 PTKc_HER2 Catalytic do 41.4 29 0.00062 24.8 2.7 46 9-54 145-198 (279)
58 cd07835 STKc_CDK1_like Catalyt 41.1 40 0.00086 24.0 3.4 45 9-53 135-186 (283)
59 PHA03390 pk1 serine/threonine- 40.7 30 0.00064 24.9 2.7 50 4-54 141-193 (267)
60 cd06649 PKc_MEK2 Catalytic dom 40.4 23 0.00049 26.5 2.1 45 9-53 140-188 (331)
61 cd07846 STKc_CDKL2_3 Catalytic 39.3 31 0.00068 24.5 2.6 45 8-52 135-186 (286)
62 PHA03210 serine/threonine kina 39.2 33 0.00071 28.0 3.0 44 9-52 303-353 (501)
63 PTZ00284 protein kinase; Provi 38.7 33 0.00072 27.3 2.9 43 11-53 286-331 (467)
64 KOG1164|consensus 38.6 30 0.00066 26.4 2.6 12 10-21 164-175 (322)
65 cd05085 PTKc_Fer Catalytic dom 38.2 30 0.00065 24.1 2.3 46 8-53 128-180 (250)
66 cd05614 STKc_MSK2_N N-terminal 38.0 20 0.00044 26.6 1.5 15 9-23 141-155 (332)
67 cd06624 STKc_ASK Catalytic dom 37.9 35 0.00076 24.1 2.6 21 3-23 139-159 (268)
68 PLN03225 Serine/threonine-prot 37.8 23 0.00051 29.9 2.0 20 4-23 287-306 (566)
69 cd05059 PTKc_Tec_like Catalyti 37.8 35 0.00076 24.0 2.7 44 9-52 136-186 (256)
70 cd07863 STKc_CDK4 Catalytic do 37.7 25 0.00053 25.1 1.9 46 8-53 143-193 (288)
71 KOG0660|consensus 37.6 17 0.00037 30.2 1.1 15 10-24 162-176 (359)
72 cd07861 STKc_CDK1_euk Catalyti 37.4 32 0.00069 24.4 2.4 46 8-53 136-188 (285)
73 PHA03212 serine/threonine kina 37.1 37 0.00081 26.7 2.9 45 9-53 218-269 (391)
74 cd05577 STKc_GRK Catalytic dom 36.9 30 0.00066 24.7 2.2 46 9-54 131-181 (277)
75 cd05607 STKc_GRK7 Catalytic do 36.8 40 0.00086 24.4 2.8 44 9-52 131-179 (277)
76 cd07840 STKc_CDK9_like Catalyt 36.6 39 0.00084 23.8 2.7 45 9-53 136-188 (287)
77 cd05068 PTKc_Frk_like Catalyti 36.2 33 0.00071 24.2 2.3 45 9-53 139-190 (261)
78 cd05116 PTKc_Syk Catalytic dom 36.0 52 0.0011 23.2 3.3 45 9-53 131-184 (257)
79 KOG1345|consensus 35.6 20 0.00044 29.7 1.3 15 10-24 160-174 (378)
80 cd08220 STKc_Nek8 Catalytic do 35.6 36 0.00078 23.6 2.4 50 4-53 133-187 (256)
81 PHA03211 serine/threonine kina 35.1 27 0.00058 28.7 1.9 16 9-24 296-311 (461)
82 cd05041 PTKc_Fes_like Catalyti 34.8 53 0.0011 22.8 3.1 45 9-53 129-181 (251)
83 cd05062 PTKc_IGF-1R Catalytic 34.8 59 0.0013 23.2 3.4 46 8-53 154-207 (277)
84 cd05604 STKc_SGK3 Catalytic do 34.7 25 0.00054 26.2 1.5 15 9-23 132-146 (325)
85 KOG0575|consensus 34.6 19 0.00041 31.7 1.0 15 8-22 153-167 (592)
86 KOG3087|consensus 34.4 20 0.00044 28.1 1.0 39 10-52 153-202 (229)
87 smart00090 RIO RIO-like kinase 34.3 24 0.00053 26.2 1.4 16 9-24 184-199 (237)
88 cd05592 STKc_nPKC_theta_delta 34.2 23 0.0005 26.4 1.3 17 8-24 131-147 (316)
89 PRK12274 serine/threonine prot 34.2 26 0.00057 26.9 1.6 15 8-22 127-141 (218)
90 KOG0662|consensus 33.8 19 0.00041 28.5 0.8 17 8-24 136-152 (292)
91 cd05586 STKc_Sck1_like Catalyt 33.7 26 0.00057 26.0 1.5 16 8-23 131-146 (330)
92 cd05585 STKc_YPK1_like Catalyt 33.7 28 0.00061 25.8 1.6 16 9-24 129-144 (312)
93 cd05084 PTKc_Fes Catalytic dom 33.5 66 0.0014 22.4 3.5 45 9-53 130-182 (252)
94 PHA03209 serine/threonine kina 33.5 47 0.001 25.3 2.9 45 9-53 193-242 (357)
95 cd05081 PTKc_Jak2_Jak3_rpt2 Ca 33.5 46 0.00099 23.8 2.7 45 9-53 144-197 (284)
96 cd07873 STKc_PCTAIRE1 Catalyti 33.5 42 0.00092 24.4 2.5 46 8-53 139-191 (301)
97 cd05618 STKc_aPKC_iota Catalyt 33.3 27 0.00058 26.3 1.5 16 8-23 131-146 (329)
98 cd05600 STKc_Sid2p_Dbf2p Catal 33.3 28 0.0006 26.0 1.6 17 8-24 136-152 (333)
99 cd06629 STKc_MAPKKK_Bck1_like 32.4 44 0.00095 23.6 2.4 46 8-53 143-198 (272)
100 cd07832 STKc_CCRK Catalytic do 32.3 51 0.0011 23.3 2.8 45 9-53 135-187 (286)
101 cd05571 STKc_PKB Catalytic dom 32.1 30 0.00064 25.8 1.6 16 8-23 130-145 (323)
102 cd05594 STKc_PKB_alpha Catalyt 32.0 28 0.0006 25.9 1.4 16 8-23 131-146 (325)
103 cd05122 PKc_STE Catalytic doma 31.9 45 0.00097 22.6 2.3 45 9-53 134-183 (253)
104 cd05615 STKc_cPKC_alpha Cataly 31.8 28 0.00061 26.0 1.4 16 8-23 136-151 (323)
105 PLN00034 mitogen-activated pro 30.8 27 0.00058 26.4 1.1 17 8-24 203-219 (353)
106 cd06654 STKc_PAK1 Catalytic do 30.8 35 0.00075 25.0 1.7 45 9-53 152-202 (296)
107 KOG0664|consensus 30.8 27 0.00059 29.2 1.2 17 8-24 191-207 (449)
108 cd05628 STKc_NDR1 Catalytic do 30.3 33 0.00071 26.1 1.6 14 9-22 137-150 (363)
109 cd05096 PTKc_DDR1 Catalytic do 30.2 27 0.00059 25.4 1.1 46 8-53 173-226 (304)
110 cd07860 STKc_CDK2_3 Catalytic 30.1 58 0.0013 23.1 2.8 46 8-53 135-187 (284)
111 cd05123 STKc_AGC Catalytic dom 30.0 49 0.0011 22.8 2.3 45 9-53 129-179 (250)
112 cd05602 STKc_SGK1 Catalytic do 30.0 30 0.00065 25.8 1.3 16 8-23 131-146 (325)
113 cd05591 STKc_nPKC_epsilon Cata 29.9 33 0.00071 25.5 1.5 16 8-23 131-146 (321)
114 cd06644 STKc_STK10_LOK Catalyt 29.8 51 0.0011 23.7 2.5 16 9-24 146-161 (292)
115 PRK01723 3-deoxy-D-manno-octul 29.8 41 0.00088 25.0 2.0 51 10-78 179-231 (239)
116 cd05616 STKc_cPKC_beta Catalyt 29.7 30 0.00065 25.7 1.2 16 8-23 136-151 (323)
117 cd07862 STKc_CDK6 Catalytic do 29.6 27 0.00059 25.0 1.0 16 9-24 146-161 (290)
118 cd07866 STKc_BUR1 Catalytic do 29.5 43 0.00093 24.0 2.0 18 8-25 150-167 (311)
119 cd08219 STKc_Nek3 Catalytic do 29.4 40 0.00087 23.6 1.8 17 9-25 136-152 (255)
120 cd05629 STKc_NDR_like_fungal C 29.4 34 0.00074 26.1 1.5 14 8-21 136-149 (377)
121 cd06616 PKc_MKK4 Catalytic dom 29.2 39 0.00085 24.1 1.8 16 9-24 144-159 (288)
122 PF12705 PDDEXK_1: PD-(D/E)XK 29.0 45 0.00097 22.8 1.9 39 8-59 142-180 (257)
123 cd05590 STKc_nPKC_eta Catalyti 28.9 35 0.00076 25.5 1.5 16 8-23 131-146 (320)
124 PF03244 PSI_PsaH: Photosystem 28.8 14 0.00029 27.1 -0.7 13 22-34 45-57 (140)
125 cd05587 STKc_cPKC Catalytic do 28.7 35 0.00075 25.4 1.4 15 9-23 137-151 (324)
126 cd05603 STKc_SGK2 Catalytic do 28.2 34 0.00074 25.3 1.3 15 9-23 132-146 (321)
127 PRK09605 bifunctional UGMP fam 28.2 38 0.00083 28.0 1.7 17 8-24 462-478 (535)
128 cd06626 STKc_MEKK4 Catalytic d 28.2 58 0.0013 22.7 2.4 45 9-53 135-192 (264)
129 cd05102 PTKc_VEGFR3 Catalytic 28.1 35 0.00076 25.3 1.4 15 9-23 210-224 (338)
130 cd05060 PTKc_Syk_like Catalyti 27.9 56 0.0012 22.9 2.3 46 8-53 130-184 (257)
131 cd05072 PTKc_Lyn Catalytic dom 27.9 59 0.0013 22.8 2.4 45 9-53 139-190 (261)
132 KOG4278|consensus 27.4 28 0.0006 32.2 0.8 17 10-26 402-418 (1157)
133 cd05572 STKc_cGK_PKG Catalytic 27.3 64 0.0014 22.6 2.5 17 9-25 129-145 (262)
134 KOG0200|consensus 27.3 33 0.00072 29.2 1.2 15 8-22 453-467 (609)
135 cd05144 RIO2_C RIO kinase fami 27.2 57 0.0012 22.7 2.3 17 9-25 161-177 (198)
136 cd07833 STKc_CDKL Catalytic do 27.1 81 0.0018 22.3 3.0 46 8-53 135-188 (288)
137 cd05617 STKc_aPKC_zeta Catalyt 27.0 36 0.00078 25.5 1.3 45 8-52 131-181 (327)
138 cd06613 STKc_MAP4K3_like Catal 27.0 69 0.0015 22.2 2.6 45 8-52 136-189 (262)
139 cd05621 STKc_ROCK2 Catalytic d 26.9 39 0.00085 26.2 1.5 16 8-23 177-192 (370)
140 cd05625 STKc_LATS1 Catalytic d 26.8 42 0.00092 25.6 1.6 14 8-21 136-149 (382)
141 cd05593 STKc_PKB_gamma Catalyt 26.7 40 0.00087 25.3 1.5 16 8-23 130-145 (328)
142 cd07837 STKc_CdkB_plant Cataly 26.7 45 0.00098 23.9 1.7 51 3-53 141-198 (295)
143 cd05575 STKc_SGK Catalytic dom 26.7 40 0.00088 25.0 1.5 15 9-23 132-146 (323)
144 smart00221 STYKc Protein kinas 26.7 77 0.0017 21.1 2.8 44 10-53 135-186 (225)
145 cd06625 STKc_MEKK3_like Cataly 26.7 45 0.00098 23.3 1.7 16 8-23 139-154 (263)
146 cd07842 STKc_CDK8_like Catalyt 26.7 62 0.0013 23.3 2.4 44 9-52 148-201 (316)
147 cd05624 STKc_MRCK_beta Catalyt 26.7 39 0.00084 25.4 1.4 17 8-24 137-153 (331)
148 cd05619 STKc_nPKC_theta Cataly 26.5 37 0.0008 25.4 1.2 45 8-52 131-181 (316)
149 KOG0598|consensus 26.5 42 0.0009 27.9 1.6 65 9-78 161-238 (357)
150 cd07843 STKc_CDC2L1 Catalytic 26.5 80 0.0017 22.7 3.0 46 8-53 141-193 (293)
151 cd07878 STKc_p38beta_MAPK11 Ca 26.5 35 0.00075 25.5 1.1 45 8-52 153-201 (343)
152 cd08528 STKc_Nek10 Catalytic d 26.3 70 0.0015 22.5 2.6 44 9-52 150-198 (269)
153 cd05601 STKc_CRIK Catalytic do 26.2 36 0.00079 25.2 1.2 17 8-24 137-153 (330)
154 cd05623 STKc_MRCK_alpha Cataly 26.2 44 0.00096 25.0 1.6 16 8-23 137-152 (332)
155 cd05111 PTK_HER3 Pseudokinase 26.2 36 0.00078 24.5 1.1 45 8-52 144-196 (279)
156 cd05151 ChoK Choline Kinase (C 26.2 55 0.0012 21.5 1.9 14 9-22 123-136 (170)
157 cd05620 STKc_nPKC_delta Cataly 26.2 36 0.00079 25.3 1.2 15 9-23 132-146 (316)
158 cd05040 PTKc_Ack_like Catalyti 26.2 62 0.0013 22.5 2.3 16 10-25 134-149 (257)
159 cd05101 PTKc_FGFR2 Catalytic d 26.1 79 0.0017 23.0 2.9 41 9-53 173-225 (304)
160 cd05610 STKc_MASTL Catalytic d 26.1 63 0.0014 27.6 2.7 18 9-26 140-157 (669)
161 cd08217 STKc_Nek2 Catalytic do 26.0 1E+02 0.0023 21.2 3.4 45 9-53 146-196 (265)
162 cd05052 PTKc_Abl Catalytic dom 25.9 68 0.0015 22.6 2.5 46 8-53 139-191 (263)
163 cd05622 STKc_ROCK1 Catalytic d 25.7 43 0.00093 25.9 1.5 17 8-24 177-193 (371)
164 cd07859 STKc_TDY_MAPK_plant Ca 25.7 39 0.00084 24.8 1.2 17 8-24 138-154 (338)
165 KOG1094|consensus 25.7 34 0.00074 31.0 1.1 13 9-21 673-685 (807)
166 cd07848 STKc_CDKL5 Catalytic d 25.7 44 0.00096 23.9 1.5 45 8-52 135-186 (287)
167 KOG1163|consensus 25.6 42 0.00092 27.5 1.5 19 6-24 147-165 (341)
168 cd05120 APH_ChoK_like Aminogly 25.6 54 0.0012 20.2 1.7 16 9-24 125-140 (155)
169 cd07864 STKc_CDK12 Catalytic d 25.5 79 0.0017 22.7 2.8 45 8-52 151-203 (302)
170 cd05113 PTKc_Btk_Bmx Catalytic 25.4 88 0.0019 22.1 3.0 45 9-53 136-187 (256)
171 KOG0983|consensus 25.2 36 0.00079 28.4 1.1 15 10-24 229-243 (391)
172 PF01163 RIO1: RIO1 family; I 25.0 37 0.00081 24.8 1.0 14 9-22 142-155 (188)
173 COG0515 SPS1 Serine/threonine 25.0 96 0.0021 20.7 2.9 47 5-51 134-195 (384)
174 cd07845 STKc_CDK10 Catalytic d 24.9 79 0.0017 23.0 2.7 47 8-54 143-196 (309)
175 KOG4055|consensus 24.7 49 0.0011 25.6 1.6 16 43-58 77-92 (213)
176 cd07830 STKc_MAK_like Catalyti 24.4 63 0.0014 22.9 2.1 45 8-52 134-184 (283)
177 cd07879 STKc_p38delta_MAPK13 C 24.3 79 0.0017 23.7 2.7 46 8-53 152-201 (342)
178 cd05075 PTKc_Axl Catalytic dom 24.3 41 0.00089 23.7 1.1 17 8-24 147-163 (272)
179 cd07850 STKc_JNK Catalytic dom 24.3 55 0.0012 24.7 1.8 45 9-53 154-203 (353)
180 cd05589 STKc_PKN Catalytic dom 24.3 42 0.00091 24.9 1.2 16 8-23 136-151 (324)
181 cd06640 STKc_MST4 Catalytic do 24.3 71 0.0015 22.8 2.3 46 8-53 136-187 (277)
182 cd08222 STKc_Nek11 Catalytic d 24.3 72 0.0016 22.3 2.3 44 10-53 142-191 (260)
183 cd05078 PTK_Jak2_Jak3_rpt1 Pse 24.2 1.1E+02 0.0023 21.6 3.3 43 12-54 147-192 (258)
184 cd05597 STKc_DMPK_like Catalyt 24.2 48 0.001 24.9 1.5 16 8-23 137-152 (331)
185 cd08529 STKc_FA2-like Catalyti 24.0 48 0.001 23.0 1.4 46 8-53 136-187 (256)
186 COG0448 GlgC ADP-glucose pyrop 23.8 45 0.00096 28.0 1.3 17 9-25 34-50 (393)
187 cd05582 STKc_RSK_N N-terminal 23.8 52 0.0011 24.3 1.6 17 8-24 133-149 (318)
188 KOG4236|consensus 23.4 34 0.00074 30.9 0.6 15 10-24 704-718 (888)
189 cd08221 STKc_Nek9 Catalytic do 23.4 50 0.0011 23.0 1.4 16 9-24 137-152 (256)
190 cd05091 PTKc_Ror2 Catalytic do 23.3 45 0.00098 23.8 1.2 16 9-24 160-175 (283)
191 KOG0198|consensus 23.3 52 0.0011 26.3 1.6 54 4-57 149-212 (313)
192 cd06652 STKc_MEKK2 Catalytic d 23.0 46 0.001 23.5 1.1 16 8-23 141-156 (265)
193 PF10134 RPA: Replication init 23.0 49 0.0011 25.1 1.3 49 8-61 139-187 (229)
194 cd05588 STKc_aPKC Catalytic do 23.0 45 0.00097 25.0 1.1 16 8-23 131-146 (329)
195 KOG0597|consensus 22.9 50 0.0011 30.0 1.5 31 8-42 135-174 (808)
196 cd05578 STKc_Yank1 Catalytic d 22.6 53 0.0012 23.0 1.4 45 8-52 135-184 (258)
197 cd05605 STKc_GRK4_like Catalyt 22.6 54 0.0012 23.7 1.5 16 9-24 138-153 (285)
198 cd05090 PTKc_Ror1 Catalytic do 22.3 53 0.0012 23.5 1.4 17 8-24 159-175 (283)
199 KOG0671|consensus 22.2 99 0.0021 26.3 3.1 18 8-25 247-264 (415)
200 CHL00073 chlN photochlorophyll 22.1 21 0.00045 30.1 -0.9 20 59-78 15-34 (457)
201 KOG1006|consensus 22.1 47 0.001 27.5 1.1 17 8-24 203-219 (361)
202 PF08685 GON: GON domain; Int 22.0 48 0.001 25.4 1.1 24 3-26 96-119 (201)
203 cd05146 RIO3_euk RIO kinase fa 22.0 57 0.0012 24.2 1.5 12 9-20 160-171 (197)
204 PLN00017 photosystem I reactio 22.0 33 0.00072 23.4 0.2 14 21-34 5-18 (90)
205 PF06658 DUF1168: Protein of u 22.0 66 0.0014 23.3 1.8 15 43-57 33-47 (142)
206 cd05057 PTKc_EGFR_like Catalyt 21.7 97 0.0021 22.0 2.6 45 9-53 145-197 (279)
207 cd05042 PTKc_Aatyk Catalytic d 21.7 55 0.0012 23.1 1.3 16 9-24 136-151 (269)
208 cd06606 STKc_MAPKKK Catalytic 21.6 73 0.0016 21.7 1.9 45 9-53 137-189 (260)
209 cd06650 PKc_MEK1 Catalytic dom 21.5 55 0.0012 24.6 1.4 44 9-52 140-187 (333)
210 cd07834 STKc_MAPK Catalytic do 21.5 1E+02 0.0023 22.6 2.8 45 9-53 139-193 (330)
211 cd05097 PTKc_DDR_like Catalyti 21.5 56 0.0012 23.7 1.4 17 8-24 164-180 (295)
212 cd05608 STKc_GRK1 Catalytic do 21.3 60 0.0013 23.4 1.5 44 9-52 133-182 (280)
213 cd05627 STKc_NDR2 Catalytic do 21.1 62 0.0013 24.5 1.6 14 9-22 137-150 (360)
214 cd05573 STKc_ROCK_NDR_like Cat 21.1 59 0.0013 24.1 1.4 17 8-24 136-152 (350)
215 COG4650 RtcR Sigma54-dependent 21.1 49 0.0011 28.0 1.1 16 9-24 151-166 (531)
216 PF08222 HTH_CodY: CodY helix- 21.0 42 0.00092 21.4 0.5 16 77-92 21-36 (61)
217 PF09178 DUF1945: Domain of un 20.9 49 0.0011 20.3 0.8 16 28-43 26-41 (51)
218 PF06688 DUF1187: Protein of u 20.9 57 0.0012 20.8 1.1 16 8-23 44-59 (61)
219 cd05048 PTKc_Ror Catalytic Dom 20.9 51 0.0011 23.4 1.0 46 8-53 159-212 (283)
220 KOG0666|consensus 20.6 56 0.0012 27.7 1.3 15 10-24 173-187 (438)
221 cd05580 STKc_PKA Catalytic dom 20.4 95 0.0021 22.4 2.4 44 9-52 137-183 (290)
222 cd05626 STKc_LATS2 Catalytic d 20.4 63 0.0014 24.8 1.5 14 9-22 137-150 (381)
223 PRK13184 pknD serine/threonine 20.3 88 0.0019 28.9 2.6 15 9-23 149-163 (932)
224 cd05082 PTKc_Csk Catalytic dom 20.3 55 0.0012 22.9 1.1 45 8-52 137-184 (256)
225 cd06612 STKc_MST1_2 Catalytic 20.0 82 0.0018 21.8 1.9 44 9-52 135-184 (256)
No 1
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=99.96 E-value=1.1e-30 Score=214.05 Aligned_cols=80 Identities=33% Similarity=0.573 Sum_probs=73.2
Q ss_pred cCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcCCCCCCCchhHHHHHHHHHhhhhhhhcc
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIESSQLLDVD 87 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~~W~~f~P~TNvlWL~YL~~~l~Ll~~k 87 (93)
..++||||||+|||+..++++++++..+||.||+|.+||||||||.||.+++++|+.|+|.|||||||||.+ +||.++
T Consensus 356 d~GnvtLIDfklsRl~~~q~~isy~rldhp~lF~G~dd~QFeIYrlMr~l~~g~wa~F~P~TNvlWL~yLs~--~llkk~ 433 (488)
T COG5072 356 DEGNVTLIDFKLSRLSYSQGIISYNRLDHPDLFNGVDDYQFEIYRLMRRLLKGRWAQFEPITNVLWLYYLSH--QLLKKK 433 (488)
T ss_pred ecCceEEEEeeeeecccCCceeeccccCchhhhcCccceeeeHHHHHHHHhcCcHHhcccchhhHHHHHHHH--HHHhhc
Confidence 389999999999999999988877777899999999999999999999999999999999999999999999 666555
Q ss_pred CC
Q psy15902 88 GL 89 (93)
Q Consensus 88 gl 89 (93)
-+
T Consensus 434 ~~ 435 (488)
T COG5072 434 NL 435 (488)
T ss_pred cc
Confidence 43
No 2
>PF12330 DUF3635: Domain of unknown function (DUF3635); InterPro: IPR024604 This domain may be a potential Haspin-related leucine-zipper. A leucine zipper was proposed to be present towards the C terminus of human Haspin, (up-stream of the current family) []; however, as this domain would appear to span several helices and be largely within a loop structure [], the actual zipper might be further downstream, and be represented by this entry, which is the very C-terminal part of the Schizosaccharomyces pombe sequence.; PDB: 2WB8_A 3F2N_A 3FMD_A 3DLZ_A 2VUW_A 3IQ7_A 3E7V_A.
Probab=99.95 E-value=2.6e-28 Score=165.55 Aligned_cols=53 Identities=51% Similarity=0.923 Sum_probs=43.1
Q ss_pred ccccccCCchhhHHHHHHHHhhcCCCCCCCchhHHHHHHHHHhhhhhhhccCCcc
Q psy15902 37 EELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIESSQLLDVDGLIE 91 (93)
Q Consensus 37 ~~~F~G~gD~QfdiYr~MR~~~~~~W~~f~P~TNvlWL~YL~~~l~Ll~~kgl~~ 91 (93)
++||+|+|||||||||+||++++++|+.|+|+|||||||||++ +|+.+++.+.
T Consensus 1 ~~~F~g~gD~QfdiYr~Mr~~~~~~W~~f~P~TNvlWL~YL~~--kLl~~~~~~~ 53 (98)
T PF12330_consen 1 EELFEGRGDYQFDIYRLMRSLTKNDWSEFEPKTNVLWLHYLAD--KLLDKKKYKK 53 (98)
T ss_dssp SGGGS--SSHHHHHHHHHHHHHTT-TTS--THHHHHHHHHHHH--HHHHS--BSS
T ss_pred CccccCCCccHHHHHHHHHHHhhCcchhcCCHHHHHHHHHHHH--HHHHHccCCC
Confidence 5899999999999999999999999999999999999999999 8887777654
No 3
>KOG2464|consensus
Probab=97.95 E-value=2.8e-06 Score=64.31 Aligned_cols=73 Identities=23% Similarity=0.344 Sum_probs=63.9
Q ss_pred ecccCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcCCCCCCCchhHHHHHHHHHh
Q psy15902 5 TDIRTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIE 79 (93)
Q Consensus 5 ~~~~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~~W~~f~P~TNvlWL~YL~~ 79 (93)
-|++.++|=|-..+ |...+....+.+..++...+.+.++.|+|+|+.|+......|..|.|.+|+.|++|+.+
T Consensus 162 rdl~~gnili~k~~--~~~~~~~~~~~n~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 234 (246)
T KOG2464|consen 162 RDLHLGNILIKKTG--RLLIPLIKDSINLKDDAKKIKGNGNGVFDIYRLMFVKFDMSASLFKPADNLLWLDYLSD 234 (246)
T ss_pred cccCcCcEEEeccc--ccccccceeEecchhhhhhhcccceeEEEEeeecccccCcceeccccchhHHHHHHhhc
Confidence 46667777666666 66667778888888899999999999999999999999999999999999999999998
No 4
>KOG0192|consensus
Probab=89.41 E-value=0.24 Score=39.91 Aligned_cols=49 Identities=27% Similarity=0.417 Sum_probs=32.6
Q ss_pred ceecccCCeEEEEeccccccccCCc---e----EEecCCCCccccccC---CchhhHHHHH
Q psy15902 3 ALTDIRTQHFQVENFTISRCFVGEK---I----CYYDLSQDEELFEGE---GDYQFDMYRM 53 (93)
Q Consensus 3 ~~~~~~g~~vTIIDftLSR~~~~~~---~----~f~dL~~d~~~F~G~---gD~QfdiYr~ 53 (93)
.|++-++..+.|+|||+||...... . -+.=. =||+|+++ -+-.-|||--
T Consensus 174 iLv~~~~~~~KI~DFGlsr~~~~~~~~~~~~~GT~~wM--APEv~~~~~~~~~~K~DvySF 232 (362)
T KOG0192|consen 174 ILVDLKGKTLKIADFGLSREKVISKTSMTSVAGTYRWM--APEVLRGEKSPYTEKSDVYSF 232 (362)
T ss_pred EEEcCCCCEEEECCCccceeeccccccccCCCCCcccc--ChhhhcCCCCcCCccchhhhH
Confidence 3566667899999999999887421 0 11112 58999964 4566666653
No 5
>KOG0593|consensus
Probab=80.04 E-value=0.66 Score=38.56 Aligned_cols=26 Identities=15% Similarity=0.234 Sum_probs=18.9
Q ss_pred ccCCeEEEEeccccccccCCceEEec
Q psy15902 7 IRTQHFQVENFTISRCFVGEKICYYD 32 (93)
Q Consensus 7 ~~g~~vTIIDftLSR~~~~~~~~f~d 32 (93)
++++.|.|||||+.|.-.+.+-.|+|
T Consensus 135 t~~gvvKLCDFGFAR~L~~pgd~YTD 160 (396)
T KOG0593|consen 135 TQNGVVKLCDFGFARTLSAPGDNYTD 160 (396)
T ss_pred ecCCcEEeccchhhHhhcCCcchhhh
Confidence 46788999999999987744334443
No 6
>KOG0583|consensus
Probab=78.73 E-value=1.6 Score=35.06 Aligned_cols=37 Identities=19% Similarity=0.315 Sum_probs=26.3
Q ss_pred ecccCCeEEEEecccccccc-C--------CceEEecCCCCccccccCCc
Q psy15902 5 TDIRTQHFQVENFTISRCFV-G--------EKICYYDLSQDEELFEGEGD 45 (93)
Q Consensus 5 ~~~~g~~vTIIDftLSR~~~-~--------~~~~f~dL~~d~~~F~G~gD 45 (93)
+|....+|.|+|||+|+... . +...|. -||+|.|.+.
T Consensus 153 ld~~~~~~Kl~DFG~s~~~~~~~~~l~t~cGsp~Y~----aPEvl~~~~~ 198 (370)
T KOG0583|consen 153 LDGNEGNLKLSDFGLSAISPGEDGLLKTFCGSPAYA----APEVLSGKGT 198 (370)
T ss_pred ecCCCCCEEEeccccccccCCCCCcccCCCCCcccC----CHHHhCCCCC
Confidence 44444899999999999873 2 123444 6899998774
No 7
>KOG0594|consensus
Probab=77.26 E-value=0.5 Score=38.35 Aligned_cols=54 Identities=19% Similarity=0.541 Sum_probs=36.6
Q ss_pred CCeEEEEecccccccc-CC---------------------------------ceEEecCCCCccccccCC--chhhHHHH
Q psy15902 9 TQHFQVENFTISRCFV-GE---------------------------------KICYYDLSQDEELFEGEG--DYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~-~~---------------------------------~~~f~dL~~d~~~F~G~g--D~QfdiYr 52 (93)
.+.+.|+||||+|+.. +. +++|..+..-..+|.|.- |-.+-|+|
T Consensus 156 ~G~lKlaDFGlAra~~ip~~~yt~evvTlWYRaPEvLlGs~~Ys~~vDiWs~GcIfaEm~~~~~LFpG~se~~ql~~If~ 235 (323)
T KOG0594|consen 156 SGVLKLADFGLARAFSIPMRTYTPEVVTLWYRAPEVLLGSTSYSTSVDIWSLGCIFAEMFTRRPLFPGDSEIDQLFRIFR 235 (323)
T ss_pred CCcEeeeccchHHHhcCCcccccccEEEeeccCHHHhcCCCcCCCCcchHhHHHHHHHHHhCCCCCCCCcHHHHHHHHHH
Confidence 6788999999999876 11 133344444567787753 45677777
Q ss_pred HHHHhhcCCC
Q psy15902 53 MMRKQCQNNW 62 (93)
Q Consensus 53 ~MR~~~~~~W 62 (93)
.+..-+..+|
T Consensus 236 ~lGtP~e~~W 245 (323)
T KOG0594|consen 236 LLGTPNEKDW 245 (323)
T ss_pred HcCCCCccCC
Confidence 7777666777
No 8
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain; InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=71.23 E-value=1.7 Score=30.31 Aligned_cols=50 Identities=14% Similarity=0.142 Sum_probs=31.8
Q ss_pred eecccCCeEEEEeccccccc-c-C---CceEEecCCCCccccc-c-CCchhhHHHHHH
Q psy15902 4 LTDIRTQHFQVENFTISRCF-V-G---EKICYYDLSQDEELFE-G-EGDYQFDMYRMM 54 (93)
Q Consensus 4 ~~~~~g~~vTIIDftLSR~~-~-~---~~~~f~dL~~d~~~F~-G-~gD~QfdiYr~M 54 (93)
+++ ...++.|||||+|... . . .....+..-..|+..+ + .-+...|||-.=
T Consensus 130 l~~-~~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Di~slG 186 (260)
T PF00069_consen 130 LLD-ENGEVKLIDFGSSVKLSENNENFNPFVGTPEYMAPEVLQQGKKYTRKSDIWSLG 186 (260)
T ss_dssp EES-TTSEEEESSGTTTEESTSTTSEBSSSSSSGGGSCHHHHTTTSSBSTHHHHHHHH
T ss_pred ccc-cccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence 445 6788999999999752 1 1 1122333334788887 3 456788888653
No 9
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=71.06 E-value=7 Score=26.95 Aligned_cols=16 Identities=6% Similarity=0.183 Sum_probs=13.5
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
+.++++|||++++...
T Consensus 125 ~~~~~liDfg~a~~~~ 140 (199)
T TIGR03724 125 DDKLYLIDFGLGKYSD 140 (199)
T ss_pred CCcEEEEECCCCcCCC
Confidence 6789999999998744
No 10
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=71.01 E-value=4.6 Score=29.43 Aligned_cols=46 Identities=13% Similarity=0.242 Sum_probs=27.3
Q ss_pred cCCeEEEEeccccccccCCc--------eEEecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
....+.|+|||+||.-.... .+.+-.-.-||.+.|.+ +.+-|||-.
T Consensus 147 ~~~~~kl~DfG~a~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~DiwSl 202 (317)
T cd07867 147 ERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAI 202 (317)
T ss_pred CCCcEEEeeccceeccCCCcccccccCcceecccccCcHHhcCCCccCcHHHHHhH
Confidence 34679999999998643211 11111112588777643 456777763
No 11
>PRK14879 serine/threonine protein kinase; Provisional
Probab=70.84 E-value=7 Score=27.13 Aligned_cols=15 Identities=7% Similarity=0.129 Sum_probs=12.7
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
+..+.||||++++..
T Consensus 130 ~~~~~liDf~~a~~~ 144 (211)
T PRK14879 130 GGKIYLIDFGLAEFS 144 (211)
T ss_pred CCCEEEEECCcccCC
Confidence 567899999999873
No 12
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=68.51 E-value=5 Score=29.44 Aligned_cols=45 Identities=13% Similarity=0.228 Sum_probs=25.8
Q ss_pred cCCeEEEEeccccccccCCc--------eEEecCCCCccccccCC--chhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGEG--DYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~g--D~QfdiYr 52 (93)
....|.|+|||+||.-.... .+.+.--.-||.+.|.. +..-|||-
T Consensus 147 ~~~~~kl~DfG~a~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~Diws 201 (317)
T cd07868 147 ERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWA 201 (317)
T ss_pred CcCcEEEeecCceeccCCCCccccccCCccccccccCCHHHcCCCCcCchhhHHH
Confidence 34679999999998643211 11111112578777643 44556665
No 13
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=68.10 E-value=5.1 Score=28.96 Aligned_cols=50 Identities=20% Similarity=0.272 Sum_probs=29.5
Q ss_pred eecccCCeEEEEeccccccccCCce-----EEecCCCCccccccC--CchhhHHHHH
Q psy15902 4 LTDIRTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 4 ~~~~~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
+++-.+..|.|+|||+++....... +.+-.-..||.+.|. -+.+.|||..
T Consensus 134 ll~~~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl 190 (294)
T PLN00009 134 LIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDIWSV 190 (294)
T ss_pred EEECCCCEEEEcccccccccCCCccccccCceeecccCHHHHhCCCCCCcHHHHHHH
Confidence 4444567899999999986432111 111111257777663 3567888873
No 14
>KOG0581|consensus
Probab=67.36 E-value=2.7 Score=34.84 Aligned_cols=18 Identities=17% Similarity=0.337 Sum_probs=15.4
Q ss_pred cCCeEEEEeccccccccC
Q psy15902 8 RTQHFQVENFTISRCFVG 25 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~ 25 (93)
+.++|+|||||-|+.-.+
T Consensus 214 skGeVKicDFGVS~~lvn 231 (364)
T KOG0581|consen 214 SKGEVKICDFGVSGILVN 231 (364)
T ss_pred cCCCEEeccccccHHhhh
Confidence 578999999999997664
No 15
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=63.46 E-value=5.1 Score=28.18 Aligned_cols=16 Identities=0% Similarity=-0.172 Sum_probs=13.1
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
+.++.|||||+++.-.
T Consensus 153 ~~~~~liDFG~a~~~~ 168 (190)
T cd05145 153 DGKPYIIDVSQAVELD 168 (190)
T ss_pred CCCEEEEEcccceecC
Confidence 5789999999997543
No 16
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=63.07 E-value=7.1 Score=29.42 Aligned_cols=45 Identities=13% Similarity=0.199 Sum_probs=26.6
Q ss_pred cCCeEEEEeccccccccCCc----eEEecCCCCccccccCC-chhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGEG-DYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~g-D~QfdiYr 52 (93)
++..+.|+|||++|...... .+-+..-.-||.+.|.+ +.+-|||-
T Consensus 154 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~Diws 203 (355)
T cd07874 154 SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWS 203 (355)
T ss_pred CCCCEEEeeCcccccCCCccccCCccccCCccCHHHHcCCCCCchhhHHH
Confidence 35679999999999654321 11122223577777642 45556665
No 17
>KOG0199|consensus
Probab=61.31 E-value=4.7 Score=37.04 Aligned_cols=17 Identities=12% Similarity=0.323 Sum_probs=13.8
Q ss_pred CeEEEEeccccccccCC
Q psy15902 10 QHFQVENFTISRCFVGE 26 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~~ 26 (93)
--|+|+||||+|+-.++
T Consensus 249 rtVKI~DFGLmRaLg~n 265 (1039)
T KOG0199|consen 249 RTVKICDFGLMRALGEN 265 (1039)
T ss_pred ceeeeecccceeccCCC
Confidence 35899999999987643
No 18
>KOG1187|consensus
Probab=61.18 E-value=5.7 Score=31.74 Aligned_cols=39 Identities=10% Similarity=0.066 Sum_probs=25.5
Q ss_pred ceecccCCeEEEEeccccccccC-CceEEec----C-CCCcccccc
Q psy15902 3 ALTDIRTQHFQVENFTISRCFVG-EKICYYD----L-SQDEELFEG 42 (93)
Q Consensus 3 ~~~~~~g~~vTIIDftLSR~~~~-~~~~f~d----L-~~d~~~F~G 42 (93)
.|+| +..++.|+||||+|.... ...+.+. . --+|+..+.
T Consensus 208 ILLD-~~~~aKlsDFGLa~~~~~~~~~~~~~~~gt~gY~~PEy~~~ 252 (361)
T KOG1187|consen 208 ILLD-EDFNAKLSDFGLAKLGPEGDTSVSTTVMGTFGYLAPEYAST 252 (361)
T ss_pred eeEC-CCCCEEccCccCcccCCccccceeeecCCCCccCChhhhcc
Confidence 3566 789999999999987765 3322221 0 126888764
No 19
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=59.46 E-value=9 Score=28.03 Aligned_cols=46 Identities=11% Similarity=0.268 Sum_probs=27.3
Q ss_pred cCCeEEEEeccccccccCCceEE--ecCCCCccccccCC-chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICY--YDLSQDEELFEGEG-DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f--~dL~~d~~~F~G~g-D~QfdiYr~ 53 (93)
+...+.|+|||+++...+..... +..-.-||++.+.+ +.+-|||-.
T Consensus 136 ~~~~~kl~Dfg~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwSl 184 (291)
T cd05612 136 KEGHIKLTDFGFAKKLRDRTWTLCGTPEYLAPEVIQSKGHNKAVDWWAL 184 (291)
T ss_pred CCCCEEEEecCcchhccCCcccccCChhhcCHHHHcCCCCCchhhHHHH
Confidence 35689999999998655432111 00012578887743 556677653
No 20
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=58.81 E-value=9.6 Score=31.21 Aligned_cols=42 Identities=14% Similarity=0.339 Sum_probs=26.6
Q ss_pred cCCeEEEEeccccccccCC-----------ceEEecCCCCccccccC-CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGE-----------KICYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~-----------~~~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
+..++.|+|||+||..... ...|. -||.+.+. -+.+-|||-.
T Consensus 178 ~~~~vkL~DFGls~~~~~~~~~~~~~~~~Gt~~Y~----aPE~~~~~~~s~k~DVwSl 231 (496)
T PTZ00283 178 SNGLVKLGDFGFSKMYAATVSDDVGRTFCGTPYYV----APEIWRRKPYSKKADMFSL 231 (496)
T ss_pred CCCCEEEEecccCeeccccccccccccccCCccee----CHHHhCCCCCCcHHHHHHH
Confidence 3567999999999864321 12232 57777763 3566777753
No 21
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=56.12 E-value=13 Score=28.19 Aligned_cols=46 Identities=11% Similarity=0.158 Sum_probs=27.0
Q ss_pred cCCeEEEEeccccccccCCc----eEEecCCCCccccccC-CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
+++.+.|+|||+++...... ..-+..-.-||.+.|. -+.+-|||-.
T Consensus 158 ~~~~~kl~Dfg~a~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~DiwSl 208 (359)
T cd07876 158 SDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSV 208 (359)
T ss_pred CCCCEEEecCCCccccccCccCCCCcccCCCCCchhccCCCCCcchhhHHH
Confidence 35689999999998654321 1112212357777763 3455666654
No 22
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=55.68 E-value=4.9 Score=30.93 Aligned_cols=20 Identities=5% Similarity=0.007 Sum_probs=16.0
Q ss_pred ccCCeEEEEeccccccccCC
Q psy15902 7 IRTQHFQVENFTISRCFVGE 26 (93)
Q Consensus 7 ~~g~~vTIIDftLSR~~~~~ 26 (93)
+++.++-+|||||+..+...
T Consensus 125 l~~~~i~~IDfGLg~~s~~~ 144 (204)
T COG3642 125 LSGGRIYFIDFGLGEFSDEV 144 (204)
T ss_pred EeCCcEEEEECCcccccccH
Confidence 45677999999999977644
No 23
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=55.40 E-value=11 Score=28.55 Aligned_cols=45 Identities=11% Similarity=0.121 Sum_probs=26.5
Q ss_pred cCCeEEEEeccccccccCCc----eEEecCCCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
.+..+.|+|||++|...... .+-+..-.-||.+.|. -+..-|||-
T Consensus 161 ~~~~~kL~DfG~a~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~DiwS 210 (364)
T cd07875 161 SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWS 210 (364)
T ss_pred CCCcEEEEeCCCccccCCCCcccCCcccCCcCCHHHHhCCCCCchhhHHh
Confidence 35679999999998654321 1111111257777764 345667665
No 24
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=54.24 E-value=19 Score=25.95 Aligned_cols=45 Identities=9% Similarity=0.140 Sum_probs=26.6
Q ss_pred CCeEEEEeccccccccCCc-----eEEecCCCCccccccCC--chhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
..++.|+|||+++...... .+.+-.-.-|+.+.|.. +.+-|||-.
T Consensus 139 ~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl 190 (291)
T cd07870 139 LGELKLADFGLARAKSIPSQTYSSEVVTLWYRPPDVLLGATDYSSALDIWGA 190 (291)
T ss_pred CCcEEEeccccccccCCCCCCCCCccccccccCCceeecCCCCCcHHHHHHH
Confidence 4579999999998643211 11111112577776532 456788874
No 25
>KOG0984|consensus
Probab=53.71 E-value=6.5 Score=31.43 Aligned_cols=17 Identities=24% Similarity=0.397 Sum_probs=14.1
Q ss_pred CCeEEEEeccccccccC
Q psy15902 9 TQHFQVENFTISRCFVG 25 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~ 25 (93)
.++|.|||||.|-.-.+
T Consensus 185 ~GqVKiCDFGIsG~L~d 201 (282)
T KOG0984|consen 185 DGQVKICDFGISGYLVD 201 (282)
T ss_pred CCcEEEcccccceeehh
Confidence 46899999999987664
No 26
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=52.13 E-value=14 Score=25.69 Aligned_cols=44 Identities=7% Similarity=-0.044 Sum_probs=26.6
Q ss_pred CeEEEEeccccccccCCceEEec-CCCCccccccC---CchhhHHHHH
Q psy15902 10 QHFQVENFTISRCFVGEKICYYD-LSQDEELFEGE---GDYQFDMYRM 53 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~~~~~f~d-L~~d~~~F~G~---gD~QfdiYr~ 53 (93)
..+.|+|||+++........-.. .-.-|+.+.+. -..+-|||-.
T Consensus 145 ~~~kl~Dfg~a~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~~Di~sl 192 (259)
T cd05037 145 PFIKLSDPGIPITVLSREERVERIPWIAPECIRNGQASLTIAADKWSF 192 (259)
T ss_pred eeEEeCCCCcccccccccccccCCCccChhhhcCCCCCcchhhHHHHH
Confidence 36999999999874432110000 01258888765 3567888874
No 27
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=51.63 E-value=11 Score=25.68 Aligned_cols=17 Identities=0% Similarity=-0.160 Sum_probs=13.4
Q ss_pred CCeEEEEeccccccccC
Q psy15902 9 TQHFQVENFTISRCFVG 25 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~ 25 (93)
+..+.|||||+++-..+
T Consensus 150 ~~~~~liDfg~a~~~~~ 166 (187)
T cd05119 150 DGKVYIIDVPQAVEIDH 166 (187)
T ss_pred CCcEEEEECcccccccC
Confidence 67889999999975443
No 28
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=51.28 E-value=9.1 Score=27.38 Aligned_cols=13 Identities=8% Similarity=0.064 Sum_probs=11.0
Q ss_pred CCeEEEEeccccc
Q psy15902 9 TQHFQVENFTISR 21 (93)
Q Consensus 9 g~~vTIIDftLSR 21 (93)
+.+|.|||||+|-
T Consensus 153 ~~~v~LiDFG~a~ 165 (190)
T cd05147 153 DGKLYIIDVSQSV 165 (190)
T ss_pred CCcEEEEEccccc
Confidence 3579999999985
No 29
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=50.62 E-value=16 Score=26.58 Aligned_cols=45 Identities=11% Similarity=0.162 Sum_probs=25.7
Q ss_pred CCeEEEEeccccccccCCc-----eEEecCCCCccccccC--CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
..++.|+|||+++...... .+-+-.-.-||++.|. -...-|||-.
T Consensus 139 ~~~~kl~DfG~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl 190 (288)
T cd07871 139 KGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGV 190 (288)
T ss_pred CCCEEECcCcceeeccCCCccccCceecccccChHHhcCCcccCcHHHHHHH
Confidence 4579999999998654221 1111111247777653 2456676653
No 30
>KOG0663|consensus
Probab=50.21 E-value=8.3 Score=32.49 Aligned_cols=65 Identities=17% Similarity=0.412 Sum_probs=39.8
Q ss_pred cceecccCCeEEEEeccccccccCC--------ceEEec--------------------------CCCCccccccCC--c
Q psy15902 2 SALTDIRTQHFQVENFTISRCFVGE--------KICYYD--------------------------LSQDEELFEGEG--D 45 (93)
Q Consensus 2 ~~~~~~~g~~vTIIDftLSR~~~~~--------~~~f~d--------------------------L~~d~~~F~G~g--D 45 (93)
|-++=.+.+.+.|+||||.|.--.. -++|++ +-...-+|.|++ |
T Consensus 206 SNLLm~~~G~lKiaDFGLAR~ygsp~k~~T~lVVTLWYRaPELLLG~~tyst~iDMWSvGCI~aE~l~~kPlf~G~sE~d 285 (419)
T KOG0663|consen 206 SNLLLSHKGILKIADFGLAREYGSPLKPYTPLVVTLWYRAPELLLGAKTYSTAVDMWSVGCIFAELLTQKPLFPGKSEID 285 (419)
T ss_pred hheeeccCCcEEecccchhhhhcCCcccCcceEEEeeecCHHHhcCCcccCcchhhhhHHHHHHHHHhcCCCCCCCchHH
Confidence 4455567789999999999975432 123332 223445677755 3
Q ss_pred hhhHHHHHHHHhhcCCCCCCC
Q psy15902 46 YQFDMYRMMRKQCQNNWQNFT 66 (93)
Q Consensus 46 ~QfdiYr~MR~~~~~~W~~f~ 66 (93)
--..|++.|=.=+...|..|.
T Consensus 286 Ql~~If~llGtPte~iwpg~~ 306 (419)
T KOG0663|consen 286 QLDKIFKLLGTPSEAIWPGYS 306 (419)
T ss_pred HHHHHHHHhCCCccccCCCcc
Confidence 333466666665667886654
No 31
>PHA02882 putative serine/threonine kinase; Provisional
Probab=49.44 E-value=18 Score=26.53 Aligned_cols=64 Identities=14% Similarity=0.145 Sum_probs=34.0
Q ss_pred CCeEEEEeccccccccCCc----------eEE--ecCCCCccccccC-CchhhHHHHH---HHHhh--cCCCCCCCchhH
Q psy15902 9 TQHFQVENFTISRCFVGEK----------ICY--YDLSQDEELFEGE-GDYQFDMYRM---MRKQC--QNNWQNFTPKNN 70 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~----------~~f--~dL~~d~~~F~G~-gD~QfdiYr~---MR~~~--~~~W~~f~P~TN 70 (93)
..++.|+|||+||.-.... ..+ +..-.-|+.+.|. -+.+-|||.. |=.+. +-.|+.+....+
T Consensus 162 ~~~~~l~DFGla~~~~~~~~~~~~~~~~~~~~~gt~~y~ape~~~~~~~~~~~DiwSlG~~l~el~~g~~P~~~~~~~~~ 241 (294)
T PHA02882 162 NNRGYIIDYGIASHFIIHGKHIEYSKEQKDLHRGTLYYAGLDAHNGACVTRRGDLESLGYCMLKWAGIKLPWKGFGHNGN 241 (294)
T ss_pred CCcEEEEEcCCceeeccCCcccccccccccccCCCccccCHHHhCCCCCCcHHHHHHHHHHHHHHHhCCCCCCccccchH
Confidence 4578899999998542110 000 0000146666653 3567788874 22222 357777755455
Q ss_pred HH
Q psy15902 71 AL 72 (93)
Q Consensus 71 vl 72 (93)
++
T Consensus 242 ~~ 243 (294)
T PHA02882 242 LI 243 (294)
T ss_pred HH
Confidence 43
No 32
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=48.92 E-value=13 Score=27.13 Aligned_cols=44 Identities=14% Similarity=0.185 Sum_probs=24.5
Q ss_pred CCeEEEEeccccccccCCc-----eEEecCCCCccccccCC--chhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGEG--DYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~g--D~QfdiYr 52 (93)
..++.|+|||+++...... ...+..-.-||++.+.. +..-|||-
T Consensus 139 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diws 189 (303)
T cd07869 139 TGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWG 189 (303)
T ss_pred CCCEEECCCCcceeccCCCccCCCCcccCCCCChHHHcCCCCCCcHHHHHH
Confidence 4679999999998643221 11111112577776543 33456555
No 33
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=48.83 E-value=19 Score=26.36 Aligned_cols=45 Identities=13% Similarity=0.186 Sum_probs=26.6
Q ss_pred CCeEEEEeccccccccCCce-----EEecCCCCccccccC--CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
..++.|+|||+++....... +-+-.-.-|+.+.+. -+.+-|||..
T Consensus 140 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl 191 (309)
T cd07872 140 RGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGV 191 (309)
T ss_pred CCCEEECccccceecCCCccccccccccccccCCHHHhCCCCCCcHHHHHHH
Confidence 45799999999986542211 111111257777653 3567788764
No 34
>PRK09188 serine/threonine protein kinase; Provisional
Probab=48.53 E-value=11 Score=30.47 Aligned_cols=15 Identities=20% Similarity=0.390 Sum_probs=12.4
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
..++.|||||+||..
T Consensus 148 ~~~ikLiDFGlA~~~ 162 (365)
T PRK09188 148 DGEAAVIDFQLASVF 162 (365)
T ss_pred CCCEEEEECccceec
Confidence 457999999999944
No 35
>PTZ00036 glycogen synthase kinase; Provisional
Probab=48.51 E-value=11 Score=30.20 Aligned_cols=50 Identities=16% Similarity=0.317 Sum_probs=28.5
Q ss_pred ceecccCCeEEEEeccccccccCCc--e--EEecCCCCccccccCC--chhhHHHH
Q psy15902 3 ALTDIRTQHFQVENFTISRCFVGEK--I--CYYDLSQDEELFEGEG--DYQFDMYR 52 (93)
Q Consensus 3 ~~~~~~g~~vTIIDftLSR~~~~~~--~--~f~dL~~d~~~F~G~g--D~QfdiYr 52 (93)
.+++-.+..|.|+|||+|+.-..+. . +-+..-.-|+++.|.. +..-|||-
T Consensus 201 ILl~~~~~~vkL~DFGla~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~DiwS 256 (440)
T PTZ00036 201 LLIDPNTHTLKLCDFGSAKNLLAGQRSVSYICSRFYRAPELMLGATNYTTHIDLWS 256 (440)
T ss_pred EEEcCCCCceeeeccccchhccCCCCcccCCCCcCccCHHHhcCCCCCCcHHHHHH
Confidence 3556567789999999998643221 1 1111112577766532 34566665
No 36
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=48.33 E-value=21 Score=22.97 Aligned_cols=45 Identities=16% Similarity=0.250 Sum_probs=28.2
Q ss_pred CCeEEEEeccccccccCCc-----eEEecCCCCcccccc--CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEG--EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G--~gD~QfdiYr~ 53 (93)
+.++.|+||++++...... .........|+.+.+ ..+.+.|+|..
T Consensus 129 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~~pe~~~~~~~~~~~~D~~~l 180 (215)
T cd00180 129 NGKVKLADFGLSKLLTSDKSLLKTIVGTPAYMAPEVLLGKGYYSEKSDIWSL 180 (215)
T ss_pred CCcEEEecCCceEEccCCcchhhcccCCCCccChhHhcccCCCCchhhhHHH
Confidence 5789999999998665432 122222235677665 44566777764
No 37
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=47.82 E-value=9.3 Score=28.70 Aligned_cols=18 Identities=17% Similarity=0.350 Sum_probs=14.2
Q ss_pred cCCeEEEEeccccccccC
Q psy15902 8 RTQHFQVENFTISRCFVG 25 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~ 25 (93)
+..++.|+|||+++...+
T Consensus 153 ~~~~~kl~Dfg~~~~~~~ 170 (329)
T PTZ00263 153 NKGHVKVTDFGFAKKVPD 170 (329)
T ss_pred CCCCEEEeeccCceEcCC
Confidence 456799999999986543
No 38
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=47.57 E-value=16 Score=26.59 Aligned_cols=16 Identities=6% Similarity=0.260 Sum_probs=12.8
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
...+.|+|||+|+...
T Consensus 138 ~~~~kl~Dfg~~~~~~ 153 (285)
T cd05631 138 RGHIRISDLGLAVQIP 153 (285)
T ss_pred CCCEEEeeCCCcEEcC
Confidence 4569999999998643
No 39
>PHA02988 hypothetical protein; Provisional
Probab=46.92 E-value=12 Score=27.52 Aligned_cols=40 Identities=10% Similarity=0.280 Sum_probs=23.8
Q ss_pred CCeEEEEeccccccccCC------ceEEecCCCCcccccc---CCchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGE------KICYYDLSQDEELFEG---EGDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~------~~~f~dL~~d~~~F~G---~gD~QfdiYr 52 (93)
+..+.|+|||+++...+. ...|. .|++..+ .-+.+-|||-
T Consensus 159 ~~~~kl~dfg~~~~~~~~~~~~~~~~~y~----aPE~~~~~~~~~~~k~Di~S 207 (283)
T PHA02988 159 NYKLKIICHGLEKILSSPPFKNVNFMVYF----SYKMLNDIFSEYTIKDDIYS 207 (283)
T ss_pred CCcEEEcccchHhhhccccccccCccccc----CHHHhhhccccccchhhhhH
Confidence 467999999999964321 22332 4666654 2244556654
No 40
>KOG0197|consensus
Probab=46.55 E-value=12 Score=31.87 Aligned_cols=17 Identities=12% Similarity=0.282 Sum_probs=13.6
Q ss_pred CCeEEEEeccccccccC
Q psy15902 9 TQHFQVENFTISRCFVG 25 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~ 25 (93)
+.-|+|.||||+|...+
T Consensus 339 ~~~vKIsDFGLAr~~~d 355 (468)
T KOG0197|consen 339 DLVVKISDFGLARLIGD 355 (468)
T ss_pred CceEEEcccccccccCC
Confidence 45899999999996443
No 41
>KOG0659|consensus
Probab=46.11 E-value=14 Score=30.15 Aligned_cols=36 Identities=17% Similarity=0.299 Sum_probs=25.9
Q ss_pred cCCeEEEEeccccccccCC-----ceEEecCCCCccccccC
Q psy15902 8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGE 43 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~ 43 (93)
+.+.++|.||||+|.-... ..|+++.=.-||++-|.
T Consensus 136 ~~g~lKiADFGLAr~f~~p~~~~~~~V~TRWYRAPELLfGs 176 (318)
T KOG0659|consen 136 SDGQLKIADFGLARFFGSPNRIQTHQVVTRWYRAPELLFGS 176 (318)
T ss_pred CCCcEEeecccchhccCCCCcccccceeeeeccChHHhccc
Confidence 5678999999999977632 23677776677766553
No 42
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the
Probab=46.06 E-value=19 Score=25.89 Aligned_cols=45 Identities=11% Similarity=0.188 Sum_probs=25.9
Q ss_pred cCCeEEEEeccccccccCC-----ceEEecCCCCccccccCC--chhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGEG--DYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~g--D~QfdiYr 52 (93)
+...+.|+|||++|..... ....+..-.-|+.+.|.. +.+-|||.
T Consensus 138 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Dv~s 189 (291)
T cd07844 138 ERGELKLADFGLARAKSVPSKTYSNEVVTLWYRPPDVLLGSTEYSTSLDMWG 189 (291)
T ss_pred CCCCEEECccccccccCCCCccccccccccccCCcHHhhcCcccCcHHHHHH
Confidence 3457999999999865311 111121123578776533 44567765
No 43
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=46.04 E-value=21 Score=25.07 Aligned_cols=45 Identities=24% Similarity=0.248 Sum_probs=27.2
Q ss_pred CCeEEEEeccccccccCCceEEec-CCCCccccccCC-chhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYD-LSQDEELFEGEG-DYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~d-L~~d~~~F~G~g-D~QfdiYr~ 53 (93)
..++.|+||++++........... .-.-|+.+++.. +..-|||..
T Consensus 133 ~~~~~l~dfg~~~~~~~~~~~~~~~~y~~pe~~~~~~~~~~~Dv~sl 179 (260)
T cd05611 133 TGHLKLTDFGLSRNGLENKKFVGTPDYLAPETILGVGDDKMSDWWSL 179 (260)
T ss_pred CCcEEEeecccceeccccccCCCCcCccChhhhcCCCCcchhhhHHH
Confidence 457999999999976532211111 112577777643 566777764
No 44
>KOG1026|consensus
Probab=46.03 E-value=10 Score=34.29 Aligned_cols=17 Identities=18% Similarity=0.329 Sum_probs=14.7
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
.+..|+|.||||||--+
T Consensus 638 e~l~VKIsDfGLsRdiY 654 (774)
T KOG1026|consen 638 ENLVVKISDFGLSRDIY 654 (774)
T ss_pred cceEEEecccccchhhh
Confidence 36789999999999776
No 45
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=45.99 E-value=19 Score=26.51 Aligned_cols=17 Identities=18% Similarity=0.493 Sum_probs=13.7
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
+...+.|+|||+++...
T Consensus 144 ~~~~~kl~DfG~a~~~~ 160 (316)
T cd05108 144 TPQHVKITDFGLAKLLG 160 (316)
T ss_pred CCCcEEEcccccccccc
Confidence 34679999999999654
No 46
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=45.45 E-value=17 Score=27.27 Aligned_cols=45 Identities=11% Similarity=0.231 Sum_probs=25.0
Q ss_pred cCCeEEEEeccccccccCCceE---E--ecCCCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKIC---Y--YDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~---f--~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
.+..+.|+|||+++........ + +..---||.+.+. -+..-|||-
T Consensus 130 ~~~~~kL~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwS 180 (323)
T cd05595 130 KDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWG 180 (323)
T ss_pred CCCCEEecccHHhccccCCCCccccccCCcCcCCcccccCCCCCchhchhh
Confidence 3467999999999864321110 0 1111257777653 345566665
No 47
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=45.25 E-value=14 Score=27.54 Aligned_cols=45 Identities=11% Similarity=0.163 Sum_probs=24.0
Q ss_pred cCCeEEEEeccccccccCCceE---E--ecCCCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKIC---Y--YDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~---f--~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
....+.|+|||+++........ + +-.-.-||.+.+. -+.+-|||-
T Consensus 135 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~Diws 185 (323)
T cd05584 135 AQGHVKLTDFGLCKESIHEGTVTHTFCGTIEYMAPEILMRSGHGKAVDWWS 185 (323)
T ss_pred CCCCEEEeeCcCCeecccCCCcccccCCCccccChhhccCCCCCCcceecc
Confidence 3467999999999854322110 0 0001247777653 234555554
No 48
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=44.00 E-value=16 Score=27.92 Aligned_cols=46 Identities=11% Similarity=0.216 Sum_probs=27.3
Q ss_pred cCCeEEEEeccccccccCCc------eEEecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
.+..+.|+|||++|...... .+.+..-.-||.+.|.. +..-|||-.
T Consensus 138 ~~~~~kL~Dfg~a~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl 191 (372)
T cd07853 138 SNCVLKICDFGLARVEEPDESKHMTQEVVTQYYRAPEILMGSRHYTSAVDIWSV 191 (372)
T ss_pred CCCCEEeccccceeecccCccccCCCCCcCCCcCCHHHHcCCCCCCcHHHHHhH
Confidence 34689999999999754221 11111112577777643 455677764
No 49
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=43.65 E-value=14 Score=28.15 Aligned_cols=17 Identities=6% Similarity=0.309 Sum_probs=13.6
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
...++.|+|||+++...
T Consensus 166 ~~~~ikL~DFG~a~~~~ 182 (340)
T PTZ00426 166 KDGFIKMTDFGFAKVVD 182 (340)
T ss_pred CCCCEEEecCCCCeecC
Confidence 45689999999998643
No 50
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment.
Probab=43.04 E-value=29 Score=24.62 Aligned_cols=46 Identities=11% Similarity=0.250 Sum_probs=27.3
Q ss_pred cCCeEEEEeccccccccCC-----ceEEecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
+..++.|+|||+++..... ..+.+..-.-|+.+.+.. +.+-|||..
T Consensus 135 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl 187 (284)
T cd07836 135 KRGELKLADFGLARAFGIPVNTFSNEVVTLWYRAPDVLLGSRTYSTSIDIWSV 187 (284)
T ss_pred CCCcEEEeecchhhhhcCCccccccccccccccChHHhcCCCCCCcHHHHHHH
Confidence 4568999999999854321 111111112577776642 457777774
No 51
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=43.01 E-value=25 Score=25.52 Aligned_cols=17 Identities=24% Similarity=0.354 Sum_probs=13.4
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
+...+.|+|||+++.-.
T Consensus 150 ~~~~~kL~dfg~~~~~~ 166 (296)
T cd06618 150 ASGNVKLCDFGISGRLV 166 (296)
T ss_pred CCCCEEECccccchhcc
Confidence 45689999999997543
No 52
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=42.90 E-value=22 Score=25.34 Aligned_cols=46 Identities=13% Similarity=0.223 Sum_probs=26.8
Q ss_pred cCCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
...++.|+|||+++....... +.+-.-.-||.+.|.. +.+-|||..
T Consensus 134 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Diwsl 186 (284)
T cd07839 134 KNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSA 186 (284)
T ss_pred CCCcEEECccchhhccCCCCCCcCCCccccCCcChHHHhCCcccCcHHHHHHH
Confidence 346799999999985432110 1111112577776642 567788765
No 53
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=42.53 E-value=23 Score=24.96 Aligned_cols=46 Identities=17% Similarity=0.312 Sum_probs=28.0
Q ss_pred cCCeEEEEeccccccccCCceEEec-----CCCCccccccC--CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYD-----LSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~d-----L~~d~~~F~G~--gD~QfdiYr~ 53 (93)
.+..+.|+||++++........+.. .-.-|+.+.+. -+.+-|+|-.
T Consensus 133 ~~~~~~l~df~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~~Di~sl 185 (283)
T cd05118 133 TEGVLKLADFGLARSFGSPVRPYTHYVVTRWYRAPELLLGDKGYSTPVDIWSV 185 (283)
T ss_pred CCCcEEEeeeeeeEecCCCcccccCccCcccccCcHHHhcCCCCCchhHHHHH
Confidence 4567999999999866543311111 11257777654 3567777774
No 54
>KOG0658|consensus
Probab=42.41 E-value=19 Score=29.88 Aligned_cols=23 Identities=22% Similarity=0.322 Sum_probs=19.2
Q ss_pred ceecccCCeEEEEeccccccccC
Q psy15902 3 ALTDIRTQHFQVENFTISRCFVG 25 (93)
Q Consensus 3 ~~~~~~g~~vTIIDftLSR~~~~ 25 (93)
.|+|-..+.+.|||||.++.-..
T Consensus 156 lLvD~~tg~LKicDFGSAK~L~~ 178 (364)
T KOG0658|consen 156 LLVDPDTGVLKICDFGSAKVLVK 178 (364)
T ss_pred EEEcCCCCeEEeccCCcceeecc
Confidence 47888889999999999986653
No 55
>KOG0194|consensus
Probab=42.39 E-value=14 Score=31.40 Aligned_cols=14 Identities=21% Similarity=0.358 Sum_probs=12.3
Q ss_pred eEEEEecccccccc
Q psy15902 11 HFQVENFTISRCFV 24 (93)
Q Consensus 11 ~vTIIDftLSR~~~ 24 (93)
-|.|.||||||...
T Consensus 300 ~vKISDFGLs~~~~ 313 (474)
T KOG0194|consen 300 VVKISDFGLSRAGS 313 (474)
T ss_pred eEEeCccccccCCc
Confidence 37999999999885
No 56
>KOG0667|consensus
Probab=41.45 E-value=18 Score=31.77 Aligned_cols=17 Identities=18% Similarity=0.081 Sum_probs=14.3
Q ss_pred CeEEEEeccccccccCC
Q psy15902 10 QHFQVENFTISRCFVGE 26 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~~ 26 (93)
-+|.|||||.|......
T Consensus 328 ~~vKVIDFGSSc~~~q~ 344 (586)
T KOG0667|consen 328 SRIKVIDFGSSCFESQR 344 (586)
T ss_pred CceeEEecccccccCCc
Confidence 48999999999987753
No 57
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=41.43 E-value=29 Score=24.82 Aligned_cols=46 Identities=15% Similarity=0.097 Sum_probs=26.1
Q ss_pred CCeEEEEeccccccccCCceEEecC-------CCCcccccc-CCchhhHHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYDL-------SQDEELFEG-EGDYQFDMYRMM 54 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~dL-------~~d~~~F~G-~gD~QfdiYr~M 54 (93)
..++.|+|||+++........+... -.-|+...+ .-+..-|||...
T Consensus 145 ~~~~kL~dfG~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~slG 198 (279)
T cd05109 145 PNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILHRRFTHQSDVWSYG 198 (279)
T ss_pred CCcEEECCCCceeecccccceeecCCCccchhhCCHHHhccCCCCchhHHHHHH
Confidence 4569999999998654222111100 013555543 346677888853
No 58
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=41.15 E-value=40 Score=23.99 Aligned_cols=45 Identities=13% Similarity=0.231 Sum_probs=26.7
Q ss_pred CCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
+..+.|+||++++....... +.+-.-.-|+.+.+.. +.+-|||..
T Consensus 135 ~~~~~l~df~~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~sl 186 (283)
T cd07835 135 EGALKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGSRQYSTPVDIWSI 186 (283)
T ss_pred CCcEEEeecccccccCCCccccCccccccCCCCCceeecCcccCcHHHHHHH
Confidence 56899999999985431111 1111112577776543 567888874
No 59
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=40.68 E-value=30 Score=24.93 Aligned_cols=50 Identities=16% Similarity=0.211 Sum_probs=29.2
Q ss_pred eecccCCeEEEEeccccccccCCceEEecC--CCCccccccC-CchhhHHHHHH
Q psy15902 4 LTDIRTQHFQVENFTISRCFVGEKICYYDL--SQDEELFEGE-GDYQFDMYRMM 54 (93)
Q Consensus 4 ~~~~~g~~vTIIDftLSR~~~~~~~~f~dL--~~d~~~F~G~-gD~QfdiYr~M 54 (93)
+++-.+..+.|+|||+++....... +... ---|+.+++. -+..-|||...
T Consensus 141 l~~~~~~~~~l~dfg~~~~~~~~~~-~~~~~~y~aPE~~~~~~~~~~~DvwslG 193 (267)
T PHA03390 141 LYDRAKDRIYLCDYGLCKIIGTPSC-YDGTLDYFSPEKIKGHNYDVSFDWWAVG 193 (267)
T ss_pred EEeCCCCeEEEecCccceecCCCcc-CCCCCcccChhhhcCCCCCchhhHHHHH
Confidence 4444455899999999986543321 1110 0147777653 45667887754
No 60
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=40.35 E-value=23 Score=26.54 Aligned_cols=45 Identities=16% Similarity=0.199 Sum_probs=27.0
Q ss_pred CCeEEEEeccccccccCCc---eEEecCCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK---ICYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~---~~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
...+.|+|||+++...+.. .+-+..-.-||.+.|. -+.+-|||-.
T Consensus 140 ~~~~kl~Dfg~~~~~~~~~~~~~~g~~~y~aPE~~~~~~~~~~~Diwsl 188 (331)
T cd06649 140 RGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSM 188 (331)
T ss_pred CCcEEEccCcccccccccccccCCCCcCcCCHhHhcCCCCCchHhHHHH
Confidence 4579999999998554321 1111111257887764 4567788764
No 61
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=39.25 E-value=31 Score=24.48 Aligned_cols=45 Identities=18% Similarity=0.347 Sum_probs=26.0
Q ss_pred cCCeEEEEeccccccccCCceEEec-----CCCCccccccCC--chhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYD-----LSQDEELFEGEG--DYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~d-----L~~d~~~F~G~g--D~QfdiYr 52 (93)
++..+.|+||++++.-......+.. .-.-|+.+.+.. ...-|||.
T Consensus 135 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~s 186 (286)
T cd07846 135 QSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDTKYGRAVDIWA 186 (286)
T ss_pred CCCcEEEEeeeeeeeccCCccccCcccceeeccCcHHhccccccCchHhHHH
Confidence 4568999999999865432221111 112477776532 34567776
No 62
>PHA03210 serine/threonine kinase US3; Provisional
Probab=39.24 E-value=33 Score=28.04 Aligned_cols=44 Identities=16% Similarity=0.229 Sum_probs=25.0
Q ss_pred CCeEEEEeccccccccCCc------eEEecCCCCccccccCC-chhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGEG-DYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~g-D~QfdiYr 52 (93)
...+.|+|||+++.-.... .+-+..-.-||++.|.+ +..-|||-
T Consensus 303 ~~~vkL~DFGla~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwS 353 (501)
T PHA03210 303 DGKIVLGDFGTAMPFEKEREAFDYGWVGTVATNSPEILAGDGYCEITDIWS 353 (501)
T ss_pred CCCEEEEeCCCceecCcccccccccccCCcCCCCchhhcCCCCCcHHHHHH
Confidence 4579999999998643221 11111112578877643 34456554
No 63
>PTZ00284 protein kinase; Provisional
Probab=38.73 E-value=33 Score=27.33 Aligned_cols=43 Identities=14% Similarity=0.067 Sum_probs=24.7
Q ss_pred eEEEEeccccccccCCceEE--ecCCCCccccccC-CchhhHHHHH
Q psy15902 11 HFQVENFTISRCFVGEKICY--YDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 11 ~vTIIDftLSR~~~~~~~~f--~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
.|.|+|||+++........+ +.--.-||++.|. -+..-|||-.
T Consensus 286 ~vkl~DfG~~~~~~~~~~~~~gt~~Y~APE~~~~~~~~~~~DiwSl 331 (467)
T PTZ00284 286 RVRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSM 331 (467)
T ss_pred eEEECCCCccccCccccccccCCccccCcHHhhcCCCCcHHHHHHH
Confidence 69999999987544322111 1111257777764 3455666663
No 64
>KOG1164|consensus
Probab=38.63 E-value=30 Score=26.36 Aligned_cols=12 Identities=17% Similarity=0.479 Sum_probs=10.8
Q ss_pred CeEEEEeccccc
Q psy15902 10 QHFQVENFTISR 21 (93)
Q Consensus 10 ~~vTIIDftLSR 21 (93)
-.|-||||||+|
T Consensus 164 ~~~~llDfGlar 175 (322)
T KOG1164|consen 164 RTLYLLDFGLAR 175 (322)
T ss_pred ceEEEEecCCCc
Confidence 468999999999
No 65
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=38.17 E-value=30 Score=24.05 Aligned_cols=46 Identities=13% Similarity=0.094 Sum_probs=26.0
Q ss_pred cCCeEEEEeccccccccCCceEEecC------CCCcccccc-CCchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYDL------SQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~dL------~~d~~~F~G-~gD~QfdiYr~ 53 (93)
....+.++|||+++....+..--... -.-|+.+.+ .-..+-|||-.
T Consensus 128 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 180 (250)
T cd05085 128 ENNVLKISDFGMSRQEDDGIYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSY 180 (250)
T ss_pred CCCeEEECCCccceeccccccccCCCCCCcccccCHHHhccCCCCchhHHHHH
Confidence 34578999999998644321100000 114666664 33566788874
No 66
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=37.95 E-value=20 Score=26.60 Aligned_cols=15 Identities=27% Similarity=0.556 Sum_probs=12.5
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
..++.|+|||+++.-
T Consensus 141 ~~~~kl~DfG~~~~~ 155 (332)
T cd05614 141 EGHVVLTDFGLSKEF 155 (332)
T ss_pred CCCEEEeeCcCCccc
Confidence 458999999999853
No 67
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=37.89 E-value=35 Score=24.14 Aligned_cols=21 Identities=14% Similarity=0.311 Sum_probs=15.6
Q ss_pred ceecccCCeEEEEeccccccc
Q psy15902 3 ALTDIRTQHFQVENFTISRCF 23 (93)
Q Consensus 3 ~~~~~~g~~vTIIDftLSR~~ 23 (93)
.+++-....+.|+||++++.-
T Consensus 139 il~~~~~~~~~l~dfg~~~~~ 159 (268)
T cd06624 139 VLVNTYSGVVKISDFGTSKRL 159 (268)
T ss_pred EEEcCCCCeEEEecchhheec
Confidence 345555678999999999754
No 68
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=37.83 E-value=23 Score=29.86 Aligned_cols=20 Identities=5% Similarity=0.139 Sum_probs=15.3
Q ss_pred eecccCCeEEEEeccccccc
Q psy15902 4 LTDIRTQHFQVENFTISRCF 23 (93)
Q Consensus 4 ~~~~~g~~vTIIDftLSR~~ 23 (93)
+++-....+.|+|||+|+.-
T Consensus 287 Ll~~~~~~~KL~DFGlA~~l 306 (566)
T PLN03225 287 IFSEGSGSFKIIDLGAAADL 306 (566)
T ss_pred EEeCCCCcEEEEeCCCcccc
Confidence 45545678999999999843
No 69
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=37.81 E-value=35 Score=24.01 Aligned_cols=44 Identities=14% Similarity=0.221 Sum_probs=25.5
Q ss_pred CCeEEEEeccccccccCCceEEec------CCCCccccccC-CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYD------LSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~d------L~~d~~~F~G~-gD~QfdiYr 52 (93)
...+.|+||+++|...++...-.. --.-|+.+.+. -+.+-|||.
T Consensus 136 ~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~y~~Pe~~~~~~~~~~~Di~s 186 (256)
T cd05059 136 DNVVKVSDFGLARYVLDDQYTSSQGTKFPVKWAPPEVFDYSRFSSKSDVWS 186 (256)
T ss_pred CCcEEECCcccceecccccccccCCCCCCccccCHHHhccCCCCchhhHHH
Confidence 457999999999866533211000 01146766653 345677776
No 70
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=37.72 E-value=25 Score=25.14 Aligned_cols=46 Identities=11% Similarity=0.194 Sum_probs=25.7
Q ss_pred cCCeEEEEeccccccccCCc----eEEecCCCCccccccC-CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK----ICYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~----~~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
....+.|+|||+++...... .+-+..-.-||.+.+. -+..-|||..
T Consensus 143 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Diwsl 193 (288)
T cd07863 143 SGGQVKLADFGLARIYSCQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSV 193 (288)
T ss_pred CCCCEEECccCccccccCcccCCCccccccccCchHhhCCCCCCcchhhhH
Confidence 35679999999998654221 1111111257777653 3455566653
No 71
>KOG0660|consensus
Probab=37.55 E-value=17 Score=30.18 Aligned_cols=15 Identities=13% Similarity=0.377 Sum_probs=12.5
Q ss_pred CeEEEEecccccccc
Q psy15902 10 QHFQVENFTISRCFV 24 (93)
Q Consensus 10 ~~vTIIDftLSR~~~ 24 (93)
-...||||||+|...
T Consensus 162 c~lKI~DFGLAR~~~ 176 (359)
T KOG0660|consen 162 CDLKICDFGLARYLD 176 (359)
T ss_pred CCEEeccccceeecc
Confidence 456999999999883
No 72
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=37.35 E-value=32 Score=24.45 Aligned_cols=46 Identities=15% Similarity=0.258 Sum_probs=26.2
Q ss_pred cCCeEEEEeccccccccCCceEE-----ecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICY-----YDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f-----~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
++.++.|+|||+++........+ +-.-.-|+.+.+.. +..-|||-.
T Consensus 136 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl 188 (285)
T cd07861 136 NKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSPRYSTPVDIWSI 188 (285)
T ss_pred CCCcEEECcccceeecCCCcccccCCcccccccChHHhcCCCCcCcHHHHHHH
Confidence 45689999999998543221111 11112477776532 456677763
No 73
>PHA03212 serine/threonine kinase US3; Provisional
Probab=37.07 E-value=37 Score=26.67 Aligned_cols=45 Identities=11% Similarity=0.039 Sum_probs=25.2
Q ss_pred CCeEEEEeccccccccCC--ce----EEecCCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGE--KI----CYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~--~~----~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
...|.|+|||+++...+. .. +-+..-.-||++.+. -+..-|||-.
T Consensus 218 ~~~vkL~DFG~a~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwSl 269 (391)
T PHA03212 218 PGDVCLGDFGAACFPVDINANKYYGWAGTIATNAPELLARDPYGPAVDIWSA 269 (391)
T ss_pred CCCEEEEeCCcccccccccccccccccCccCCCChhhhcCCCCCcHHHHHHH
Confidence 356899999999753321 10 111111257777663 3566677653
No 74
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of
Probab=36.93 E-value=30 Score=24.74 Aligned_cols=46 Identities=15% Similarity=0.226 Sum_probs=26.7
Q ss_pred CCeEEEEeccccccccCCceEEe----cCCCCccccccC-CchhhHHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYY----DLSQDEELFEGE-GDYQFDMYRMM 54 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~----dL~~d~~~F~G~-gD~QfdiYr~M 54 (93)
...+.|+|||+++....+...-. ..-.-|+.+.+. -+.+-|||...
T Consensus 131 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~slG 181 (277)
T cd05577 131 HGNVRISDLGLAVELKGGKKIKGRAGTPGYMAPEVLQGEVYDFSVDWFALG 181 (277)
T ss_pred CCCEEEccCcchhhhccCCccccccCCCCcCCHHHhcCCCCCchhhhHHHH
Confidence 45799999999985432211100 011247777653 45677888754
No 75
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=36.82 E-value=40 Score=24.35 Aligned_cols=44 Identities=11% Similarity=0.162 Sum_probs=25.1
Q ss_pred CCeEEEEeccccccccCCceEE----ecCCCCccccccC-CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICY----YDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f----~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
...+.|+|||+++....+...- +.--.-|+.+.+. -+.+-|||.
T Consensus 131 ~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dvws 179 (277)
T cd05607 131 QGNCRLSDLGLAVELKDGKTITQRAGTNGYMAPEILKEEPYSYPVDWFA 179 (277)
T ss_pred CCCEEEeeceeeeecCCCceeeccCCCCCccCHHHHccCCCCCchhHHH
Confidence 4578999999987544322110 0011247777653 356667775
No 76
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=36.62 E-value=39 Score=23.81 Aligned_cols=45 Identities=16% Similarity=0.242 Sum_probs=27.3
Q ss_pred CCeEEEEeccccccccCCc------eEEecCCCCccccccC--CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
+.++.|+|||+++...... ...+-.-..|+.+.|. ...+-|||..
T Consensus 136 ~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl 188 (287)
T cd07840 136 DGVLKLADFGLARPYTKRNSADYTNRVITLWYRPPELLLGATRYGPEVDMWSV 188 (287)
T ss_pred CCCEEEccccceeeccCCCcccccccccccccCCceeeEccccCChHHHHHHH
Confidence 5679999999998665332 1111111257766653 3567788863
No 77
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=36.19 E-value=33 Score=24.17 Aligned_cols=45 Identities=11% Similarity=0.051 Sum_probs=25.5
Q ss_pred CCeEEEEeccccccccCCc------eEEecCCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK------ICYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
...+.|+||++++...... ..+.-.-..|+.+.+. -+.+-|||..
T Consensus 139 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 190 (261)
T cd05068 139 NNICKVADFGLARVIKEDIYEAREGAKFPIKWTAPEAALYNRFSIKSDVWSF 190 (261)
T ss_pred CCCEEECCcceEEEccCCcccccCCCcCceeccCccccccCCCCchhhHHHH
Confidence 4579999999998654221 1000011257777653 3456677763
No 78
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=36.04 E-value=52 Score=23.16 Aligned_cols=45 Identities=11% Similarity=0.156 Sum_probs=25.6
Q ss_pred CCeEEEEeccccccccCCceEEec--------CCCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYD--------LSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~d--------L~~d~~~F~G-~gD~QfdiYr~ 53 (93)
+..+.|+|||+|+.-......+.. .-..|+.+.+ .-+.+-|||..
T Consensus 131 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 184 (257)
T cd05116 131 QHYAKISDFGLSKALGADENYYKAKTHGKWPVKWYAPECMNYYKFSSKSDVWSF 184 (257)
T ss_pred CCeEEECCCccccccCCCCCeeeecCCCCCCccccCHhHhccCCcCchhHHHHH
Confidence 457899999999865432211110 0114666654 33567777764
No 79
>KOG1345|consensus
Probab=35.60 E-value=20 Score=29.72 Aligned_cols=15 Identities=13% Similarity=0.233 Sum_probs=12.7
Q ss_pred CeEEEEecccccccc
Q psy15902 10 QHFQVENFTISRCFV 24 (93)
Q Consensus 10 ~~vTIIDftLSR~~~ 24 (93)
.+|.+||||++|-.-
T Consensus 160 ~rvKlcDFG~t~k~g 174 (378)
T KOG1345|consen 160 YRVKLCDFGLTRKVG 174 (378)
T ss_pred cEEEeeecccccccC
Confidence 479999999999654
No 80
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with
Probab=35.59 E-value=36 Score=23.59 Aligned_cols=50 Identities=22% Similarity=0.339 Sum_probs=27.9
Q ss_pred eecccCCeEEEEeccccccccCCceEE----ecCCCCccccccC-CchhhHHHHH
Q psy15902 4 LTDIRTQHFQVENFTISRCFVGEKICY----YDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 4 ~~~~~g~~vTIIDftLSR~~~~~~~~f----~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
+++-.+..+.|+||++++........+ +..-.-|+.+++. .+.+-|||-.
T Consensus 133 l~~~~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl 187 (256)
T cd08220 133 LLDKHKMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWAL 187 (256)
T ss_pred EEcCCCCEEEEccCCCceecCCCccccccccCCcccCchhccCCCCCcccchHHH
Confidence 444455668999999998654322111 1111246666653 3566777654
No 81
>PHA03211 serine/threonine kinase US3; Provisional
Probab=35.07 E-value=27 Score=28.70 Aligned_cols=16 Identities=6% Similarity=0.063 Sum_probs=12.9
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
..++.|+|||+|+...
T Consensus 296 ~~~vkL~DFGla~~~~ 311 (461)
T PHA03211 296 PEDICLGDFGAACFAR 311 (461)
T ss_pred CCCEEEcccCCceecc
Confidence 4579999999998653
No 82
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=34.83 E-value=53 Score=22.81 Aligned_cols=45 Identities=16% Similarity=0.142 Sum_probs=25.5
Q ss_pred CCeEEEEeccccccccCCceEEe-cC------CCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYY-DL------SQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~-dL------~~d~~~F~G-~gD~QfdiYr~ 53 (93)
...+.|+||++++....+..... .. -.-|+.+.+ ..+..-|+|-.
T Consensus 129 ~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~sl 181 (251)
T cd05041 129 NNVLKISDFGMSREEEGGIYTVSDGLKQIPIKWTAPEALNYGRYTSESDVWSY 181 (251)
T ss_pred CCcEEEeeccccccccCCcceeccccCcceeccCChHhhccCCCCcchhHHHH
Confidence 45799999999986542211100 00 114777665 34566677764
No 83
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=34.82 E-value=59 Score=23.16 Aligned_cols=46 Identities=9% Similarity=0.046 Sum_probs=25.7
Q ss_pred cCCeEEEEeccccccccCCceEEec-------CCCCcccccc-CCchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYD-------LSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~d-------L~~d~~~F~G-~gD~QfdiYr~ 53 (93)
+..++.|+|||+++........... .-.-|+.+.+ .-+..-|||..
T Consensus 154 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 207 (277)
T cd05062 154 EDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSF 207 (277)
T ss_pred CCCCEEECCCCCccccCCcceeecCCCCccCHhhcChhHhhcCCcCchhHHHHH
Confidence 3567999999999864322111000 0114666654 33566677773
No 84
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=34.71 E-value=25 Score=26.18 Aligned_cols=15 Identities=13% Similarity=0.242 Sum_probs=12.4
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
+.++.|+|||+++..
T Consensus 132 ~~~~kL~DfG~~~~~ 146 (325)
T cd05604 132 QGHVVLTDFGLCKEG 146 (325)
T ss_pred CCCEEEeecCCcccC
Confidence 457999999999853
No 85
>KOG0575|consensus
Probab=34.57 E-value=19 Score=31.73 Aligned_cols=15 Identities=7% Similarity=0.321 Sum_probs=12.7
Q ss_pred cCCeEEEEecccccc
Q psy15902 8 RTQHFQVENFTISRC 22 (93)
Q Consensus 8 ~g~~vTIIDftLSR~ 22 (93)
++.+|.|.||||+--
T Consensus 153 ~~~~VKIgDFGLAt~ 167 (592)
T KOG0575|consen 153 ENMNVKIGDFGLATQ 167 (592)
T ss_pred CcCcEEecccceeee
Confidence 567999999999853
No 86
>KOG3087|consensus
Probab=34.37 E-value=20 Score=28.10 Aligned_cols=39 Identities=21% Similarity=0.214 Sum_probs=24.1
Q ss_pred CeEEEEeccccccccC---Cce-E-------EecCCCCccccccCCchhhHHHH
Q psy15902 10 QHFQVENFTISRCFVG---EKI-C-------YYDLSQDEELFEGEGDYQFDMYR 52 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~---~~~-~-------f~dL~~d~~~F~G~gD~QfdiYr 52 (93)
..+-+||||||-.+.- ..+ + -+-.+..+.+|+| -.+.|+
T Consensus 153 ~~~~lIdfgls~~s~~~EDKgVDLYVlErA~lsTh~~~~~~fe~----~~~~Y~ 202 (229)
T KOG3087|consen 153 ITPILIDFGLSSVSRLPEDKGVDLYVLERAVLSTHDKKALLFEG----FLEGYR 202 (229)
T ss_pred CceEEEeecchhcccCcccccceeeeehHhHhccCcccHHHHHH----HHHHHH
Confidence 4457999999987762 221 2 2334556778887 345565
No 87
>smart00090 RIO RIO-like kinase.
Probab=34.27 E-value=24 Score=26.21 Aligned_cols=16 Identities=6% Similarity=-0.064 Sum_probs=12.7
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
+.+++||||++++...
T Consensus 184 ~~~i~LiDFg~a~~~~ 199 (237)
T smart00090 184 DGKVVIIDVSQSVELD 199 (237)
T ss_pred CCCEEEEEChhhhccC
Confidence 5689999999988543
No 88
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=34.20 E-value=23 Score=26.40 Aligned_cols=17 Identities=12% Similarity=0.436 Sum_probs=13.4
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
+...+.|+|||+|+...
T Consensus 131 ~~~~~kL~Dfg~a~~~~ 147 (316)
T cd05592 131 KDGHIKIADFGMCKENM 147 (316)
T ss_pred CCCCEEEccCcCCeECC
Confidence 45679999999998643
No 89
>PRK12274 serine/threonine protein kinase; Provisional
Probab=34.17 E-value=26 Score=26.87 Aligned_cols=15 Identities=13% Similarity=0.109 Sum_probs=12.3
Q ss_pred cCCeEEEEecccccc
Q psy15902 8 RTQHFQVENFTISRC 22 (93)
Q Consensus 8 ~g~~vTIIDftLSR~ 22 (93)
.+.++.|||||++..
T Consensus 127 ~~g~i~LIDFG~A~~ 141 (218)
T PRK12274 127 EDGSPAVIDFQLAVR 141 (218)
T ss_pred CCCCEEEEECCCcee
Confidence 456799999999964
No 90
>KOG0662|consensus
Probab=33.82 E-value=19 Score=28.52 Aligned_cols=17 Identities=24% Similarity=0.604 Sum_probs=14.7
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
++++..+.||||+|+--
T Consensus 136 ~ngelkladfglarafg 152 (292)
T KOG0662|consen 136 RNGELKLADFGLARAFG 152 (292)
T ss_pred cCCcEEecccchhhhcC
Confidence 57899999999999854
No 91
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=33.75 E-value=26 Score=26.05 Aligned_cols=16 Identities=25% Similarity=0.412 Sum_probs=12.9
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
.+.++.|+|||+++..
T Consensus 131 ~~~~~kl~Dfg~a~~~ 146 (330)
T cd05586 131 ATGHIALCDFGLSKAN 146 (330)
T ss_pred CCCCEEEecCCcCcCC
Confidence 3467999999999864
No 92
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=33.73 E-value=28 Score=25.76 Aligned_cols=16 Identities=13% Similarity=0.320 Sum_probs=12.9
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
..++.|+|||+++...
T Consensus 129 ~~~~kl~Dfg~~~~~~ 144 (312)
T cd05585 129 QGHIALCDFGLCKLNM 144 (312)
T ss_pred CCcEEEEECcccccCc
Confidence 4579999999998643
No 93
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular
Probab=33.53 E-value=66 Score=22.40 Aligned_cols=45 Identities=11% Similarity=0.085 Sum_probs=24.9
Q ss_pred CCeEEEEeccccccccCCce-EEecC------CCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKI-CYYDL------SQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~-~f~dL------~~d~~~F~G-~gD~QfdiYr~ 53 (93)
..++.|+|||+++...++.. ..... -.-|+.+.+ .-..+-|||..
T Consensus 130 ~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl 182 (252)
T cd05084 130 KNVLKISDFGMSREEEDGVYASTGGMKQIPVKWTAPEALNYGRYSSESDVWSF 182 (252)
T ss_pred CCcEEECccccCcccccccccccCCCCCCceeecCchhhcCCCCChHHHHHHH
Confidence 34699999999985432211 00000 013666654 34567777773
No 94
>PHA03209 serine/threonine kinase US3; Provisional
Probab=33.51 E-value=47 Score=25.30 Aligned_cols=45 Identities=7% Similarity=0.050 Sum_probs=25.0
Q ss_pred CCeEEEEeccccccccCCce----EEecCCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
...+.|+|||+++....... .-+-.-.-||.+.+. -+.+-|||-.
T Consensus 193 ~~~~kl~DfG~a~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwSl 242 (357)
T PHA03209 193 VDQVCIGDLGAAQFPVVAPAFLGLAGTVETNAPEVLARDKYNSKADIWSA 242 (357)
T ss_pred CCCEEEecCccccccccCcccccccccccccCCeecCCCCCCchhhHHHH
Confidence 45689999999986442211 001111257777653 3456666653
No 95
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=33.50 E-value=46 Score=23.76 Aligned_cols=45 Identities=11% Similarity=0.218 Sum_probs=25.1
Q ss_pred CCeEEEEeccccccccCCceEEe--cC------CCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYY--DL------SQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~--dL------~~d~~~F~G-~gD~QfdiYr~ 53 (93)
...+.|+|||+++....+...+. .. ---|+...+ .-+.+-|||..
T Consensus 144 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 197 (284)
T cd05081 144 ENRVKIGDFGLTKVLPQDKEYYKVREPGESPIFWYAPESLTESKFSVASDVWSF 197 (284)
T ss_pred CCeEEECCCcccccccCCCcceeecCCCCCceEeeCHHHhccCCcChHHHHHHH
Confidence 45799999999996543221111 00 013555544 34566777774
No 96
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=33.48 E-value=42 Score=24.37 Aligned_cols=46 Identities=13% Similarity=0.204 Sum_probs=26.5
Q ss_pred cCCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
...++.|+|||+++....... .-+-.-.-|+.+.+.. ..+-|||..
T Consensus 139 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Dv~sl 191 (301)
T cd07873 139 ERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGV 191 (301)
T ss_pred CCCcEEECcCcchhccCCCCCcccccceeecccCcHHHhCCCCCccHHHHHHH
Confidence 346799999999986542211 1111112577776543 356777764
No 97
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=33.34 E-value=27 Score=26.27 Aligned_cols=16 Identities=6% Similarity=0.256 Sum_probs=12.9
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+..+|.|+|||+++..
T Consensus 131 ~~~~~kL~DfG~~~~~ 146 (329)
T cd05618 131 SEGHIKLTDYGMCKEG 146 (329)
T ss_pred CCCCEEEeeCCccccc
Confidence 3467999999999864
No 98
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis.
Probab=33.33 E-value=28 Score=25.97 Aligned_cols=17 Identities=24% Similarity=0.556 Sum_probs=13.5
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
+..++.|+|||+++...
T Consensus 136 ~~~~~kL~Dfg~a~~~~ 152 (333)
T cd05600 136 ASGHIKLTDFGLSKGIV 152 (333)
T ss_pred CCCCEEEEeCcCCcccc
Confidence 45679999999998643
No 99
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=32.36 E-value=44 Score=23.60 Aligned_cols=46 Identities=11% Similarity=0.067 Sum_probs=26.4
Q ss_pred cCCeEEEEeccccccccCCceE-----E--ecCCCCccccccCC---chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKIC-----Y--YDLSQDEELFEGEG---DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~-----f--~dL~~d~~~F~G~g---D~QfdiYr~ 53 (93)
.+..+.|+||++++........ . +..-..|+.+.+.. +.+-|+|..
T Consensus 143 ~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~~Dv~sl 198 (272)
T cd06629 143 ADGICKISDFGISKKSDDIYDNDQNMSMQGSVFWMAPEVIHSYSQGYSAKVDIWSL 198 (272)
T ss_pred CCCeEEEeeccccccccccccccccccccCCccccCHHHhccccCCCCccchhHHH
Confidence 3567999999999864321100 0 00011477776543 567788764
No 100
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=32.35 E-value=51 Score=23.32 Aligned_cols=45 Identities=22% Similarity=0.409 Sum_probs=26.5
Q ss_pred CCeEEEEeccccccccCCc-eEEec-----CCCCccccccCC--chhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-ICYYD-----LSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-~~f~d-----L~~d~~~F~G~g--D~QfdiYr~ 53 (93)
...+.|+||++++...... ..+.. --.-||.+.+.. +.+-|||-.
T Consensus 135 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Di~sl 187 (286)
T cd07832 135 DGVLKIADFGLARLFSEEEPRLYSHQVATRWYRAPELLYGARKYDPGVDLWAV 187 (286)
T ss_pred CCcEEEeeeeecccccCCCCCccccccCcccccCceeeeccccCCchhHHHHH
Confidence 4568999999998765332 11111 012467766532 567788774
No 101
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=32.13 E-value=30 Score=25.83 Aligned_cols=16 Identities=13% Similarity=0.391 Sum_probs=12.9
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
....+.|+|||+++..
T Consensus 130 ~~~~~kl~DfG~a~~~ 145 (323)
T cd05571 130 KDGHIKITDFGLCKEG 145 (323)
T ss_pred CCCCEEEeeCCCCccc
Confidence 3567999999999864
No 102
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=32.00 E-value=28 Score=25.94 Aligned_cols=16 Identities=13% Similarity=0.391 Sum_probs=12.7
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+...+.|+|||+++..
T Consensus 131 ~~~~~kL~Dfg~~~~~ 146 (325)
T cd05594 131 KDGHIKITDFGLCKEG 146 (325)
T ss_pred CCCCEEEecCCCCeec
Confidence 3457999999999853
No 103
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core
Probab=31.86 E-value=45 Score=22.61 Aligned_cols=45 Identities=18% Similarity=0.296 Sum_probs=27.1
Q ss_pred CCeEEEEeccccccccCCc--eEEec--CCCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK--ICYYD--LSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~--~~f~d--L~~d~~~F~G-~gD~QfdiYr~ 53 (93)
+.+++|+||+.++...... ..+.. .-.-|+...+ ..+++-|+|..
T Consensus 134 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~Dv~sl 183 (253)
T cd05122 134 DGEVKLIDFGLSAQLSDTKARNTMVGTPYWMAPEVINGKPYDYKADIWSL 183 (253)
T ss_pred CCeEEEeeccccccccccccccceecCCcccCHHHHcCCCCCccccHHHH
Confidence 5689999999998765432 11111 1124665554 34677788874
No 104
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=31.81 E-value=28 Score=26.03 Aligned_cols=16 Identities=13% Similarity=0.430 Sum_probs=13.0
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
++..+.|+|||+++..
T Consensus 136 ~~~~ikL~Dfg~~~~~ 151 (323)
T cd05615 136 SEGHIKIADFGMCKEH 151 (323)
T ss_pred CCCCEEEecccccccc
Confidence 4567999999999864
No 105
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=30.80 E-value=27 Score=26.43 Aligned_cols=17 Identities=18% Similarity=0.528 Sum_probs=13.5
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
.+.++.|+|||+++...
T Consensus 203 ~~~~~kL~DfG~~~~~~ 219 (353)
T PLN00034 203 SAKNVKIADFGVSRILA 219 (353)
T ss_pred CCCCEEEcccccceecc
Confidence 35689999999998643
No 106
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding
Probab=30.77 E-value=35 Score=24.98 Aligned_cols=45 Identities=9% Similarity=0.103 Sum_probs=25.3
Q ss_pred CCeEEEEeccccccccCCceEEe---c--CCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYY---D--LSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~---d--L~~d~~~F~G~-gD~QfdiYr~ 53 (93)
+..+.|+|||+++.......... . .-.-|+.+.+. -+.+-|||-.
T Consensus 152 ~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~s~ 202 (296)
T cd06654 152 DGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL 202 (296)
T ss_pred CCCEEECccccchhccccccccCcccCCccccCHHHHcCCCCCccchHHHH
Confidence 44799999999886432211100 0 01147777653 3467777764
No 107
>KOG0664|consensus
Probab=30.76 E-value=27 Score=29.22 Aligned_cols=17 Identities=12% Similarity=0.319 Sum_probs=13.7
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
|+--.+||||||.|.+.
T Consensus 191 SNCvLKICDFGLARvee 207 (449)
T KOG0664|consen 191 SNCILKICDFGLARTWD 207 (449)
T ss_pred cCceEEecccccccccc
Confidence 44457899999999876
No 108
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=30.26 E-value=33 Score=26.12 Aligned_cols=14 Identities=14% Similarity=0.418 Sum_probs=11.8
Q ss_pred CCeEEEEecccccc
Q psy15902 9 TQHFQVENFTISRC 22 (93)
Q Consensus 9 g~~vTIIDftLSR~ 22 (93)
..+|.|+|||+++.
T Consensus 137 ~~~vkL~DFGla~~ 150 (363)
T cd05628 137 KGHVKLSDFGLCTG 150 (363)
T ss_pred CCCEEEeeccCccc
Confidence 45799999999975
No 109
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=30.21 E-value=27 Score=25.42 Aligned_cols=46 Identities=11% Similarity=0.000 Sum_probs=25.2
Q ss_pred cCCeEEEEeccccccccCCceEE-------ecCCCCcccccc-CCchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICY-------YDLSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f-------~dL~~d~~~F~G-~gD~QfdiYr~ 53 (93)
....+.|+|||+++......... +..---|+.+.+ .-+..-|||..
T Consensus 173 ~~~~~kl~DfG~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl 226 (304)
T cd05096 173 ENLTIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAF 226 (304)
T ss_pred CCccEEECCCccceecccCceeEecCcCCCCccccCHHHHhcCCCCchhhhHHH
Confidence 34679999999998643321100 000013565543 44566777764
No 110
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex
Probab=30.13 E-value=58 Score=23.15 Aligned_cols=46 Identities=13% Similarity=0.196 Sum_probs=26.6
Q ss_pred cCCeEEEEeccccccccCCce-----EEecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
....+.|+||++++....... ..+..-.-||.+.|.. +.+-|||-.
T Consensus 135 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl 187 (284)
T cd07860 135 TEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSL 187 (284)
T ss_pred CCCCEEEeeccchhhcccCccccccccccccccCCeEEecCCCCCcHHHHHHH
Confidence 345799999999985432211 1111112577776643 567787773
No 111
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the
Probab=30.03 E-value=49 Score=22.83 Aligned_cols=45 Identities=16% Similarity=0.300 Sum_probs=26.0
Q ss_pred CCeEEEEeccccccccCCc-----eEEecCCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
..++.|+||++++...... ..-.-.-..|+.+.+. .+.+-|+|..
T Consensus 129 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~~Pe~~~~~~~~~~~D~~sl 179 (250)
T cd05123 129 DGHIKLTDFGLAKELSSEGSRTNTFCGTPEYLAPEVLLGKGYGKAVDWWSL 179 (250)
T ss_pred CCcEEEeecCcceecccCCCcccCCcCCccccChHHhCCCCCCchhhHHHH
Confidence 3579999999998765431 0101111256766653 4566777763
No 112
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt
Probab=30.02 E-value=30 Score=25.76 Aligned_cols=16 Identities=13% Similarity=0.285 Sum_probs=12.8
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
....+.|+|||+++..
T Consensus 131 ~~~~~kl~DfG~a~~~ 146 (325)
T cd05602 131 SQGHIVLTDFGLCKEN 146 (325)
T ss_pred CCCCEEEccCCCCccc
Confidence 3567999999999853
No 113
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=29.92 E-value=33 Score=25.50 Aligned_cols=16 Identities=13% Similarity=0.252 Sum_probs=12.8
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+...+.|+|||+++..
T Consensus 131 ~~~~~kL~Dfg~~~~~ 146 (321)
T cd05591 131 AEGHCKLADFGMCKEG 146 (321)
T ss_pred CCCCEEEeecccceec
Confidence 3467999999999854
No 114
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=29.84 E-value=51 Score=23.74 Aligned_cols=16 Identities=19% Similarity=0.293 Sum_probs=13.0
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
+.++.|+|||+++...
T Consensus 146 ~~~~kl~dfg~~~~~~ 161 (292)
T cd06644 146 DGDIKLADFGVSAKNV 161 (292)
T ss_pred CCCEEEccCccceecc
Confidence 5679999999988644
No 115
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=29.77 E-value=41 Score=25.00 Aligned_cols=51 Identities=12% Similarity=-0.021 Sum_probs=29.7
Q ss_pred CeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcC--CCCCCCchhHHHHHHHHH
Q psy15902 10 QHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQN--NWQNFTPKNNALDIDGLI 78 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~--~W~~f~P~TNvlWL~YL~ 78 (93)
.+|.||||+.++...+ ..+-+.|+.|+-|.+.+. .=+.| +.++-.|=..+.
T Consensus 179 ~~v~LIDfg~~~~~~~-----------------~~~~~~nl~rl~rs~~~~~~~~~~~-~~~~~~~~~~~~ 231 (239)
T PRK01723 179 GKFWLIDFDRGELRTP-----------------TRWKQANLARLLRSFNKEQGKRPIL-AFSEQDWQALLA 231 (239)
T ss_pred CCEEEEECCCcccCCC-----------------HHHHHHHHHHHHHHHHHHhccCCcc-cccHHHHHHHHH
Confidence 4799999999887531 124567777777766431 21222 255566654443
No 116
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=29.73 E-value=30 Score=25.73 Aligned_cols=16 Identities=13% Similarity=0.368 Sum_probs=12.7
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+...+.|+|||+++..
T Consensus 136 ~~~~~kL~DfG~~~~~ 151 (323)
T cd05616 136 SEGHIKIADFGMCKEN 151 (323)
T ss_pred CCCcEEEccCCCceec
Confidence 3457999999999853
No 117
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=29.64 E-value=27 Score=25.02 Aligned_cols=16 Identities=13% Similarity=0.536 Sum_probs=13.0
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
...+.|+|||+++...
T Consensus 146 ~~~~kl~Dfg~~~~~~ 161 (290)
T cd07862 146 SGQIKLADFGLARIYS 161 (290)
T ss_pred CCCEEEccccceEecc
Confidence 4579999999998643
No 118
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic
Probab=29.51 E-value=43 Score=24.04 Aligned_cols=18 Identities=17% Similarity=0.484 Sum_probs=14.2
Q ss_pred cCCeEEEEeccccccccC
Q psy15902 8 RTQHFQVENFTISRCFVG 25 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~ 25 (93)
+++++.|+||+++|....
T Consensus 150 ~~~~~~l~dfg~~~~~~~ 167 (311)
T cd07866 150 NQGILKIADFGLARPYDG 167 (311)
T ss_pred CCCCEEECcCccchhccC
Confidence 456799999999997653
No 119
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=29.42 E-value=40 Score=23.57 Aligned_cols=17 Identities=12% Similarity=0.309 Sum_probs=13.3
Q ss_pred CCeEEEEeccccccccC
Q psy15902 9 TQHFQVENFTISRCFVG 25 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~ 25 (93)
...+.|+|||+++....
T Consensus 136 ~~~~~l~dfg~~~~~~~ 152 (255)
T cd08219 136 NGKVKLGDFGSARLLTS 152 (255)
T ss_pred CCcEEEcccCcceeecc
Confidence 45789999999986543
No 120
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of
Probab=29.41 E-value=34 Score=26.08 Aligned_cols=14 Identities=29% Similarity=0.619 Sum_probs=11.8
Q ss_pred cCCeEEEEeccccc
Q psy15902 8 RTQHFQVENFTISR 21 (93)
Q Consensus 8 ~g~~vTIIDftLSR 21 (93)
+...+.|+|||+|+
T Consensus 136 ~~~~~kl~DfGla~ 149 (377)
T cd05629 136 RGGHIKLSDFGLST 149 (377)
T ss_pred CCCCEEEeeccccc
Confidence 35679999999997
No 121
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=29.24 E-value=39 Score=24.15 Aligned_cols=16 Identities=25% Similarity=0.382 Sum_probs=12.4
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
...+.|+|||+++...
T Consensus 144 ~~~~kl~dfg~~~~~~ 159 (288)
T cd06616 144 NGNIKLCDFGISGQLV 159 (288)
T ss_pred CCcEEEeecchhHHhc
Confidence 4568999999997543
No 122
>PF12705 PDDEXK_1: PD-(D/E)XK nuclease superfamily; PDB: 1W36_B 3K70_B 3U4Q_A 3U44_A.
Probab=28.97 E-value=45 Score=22.81 Aligned_cols=39 Identities=13% Similarity=0.209 Sum_probs=26.4
Q ss_pred cCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhc
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQ 59 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~ 59 (93)
.++++.|+||+-++...... .+. -+.|--+|..|=....
T Consensus 142 ~~g~~~IvDyKt~~~~~~~~----------~~~---~~~Ql~~Y~~~l~~~~ 180 (257)
T PF12705_consen 142 KDGRVRIVDYKTGSSPDDKS----------DLK---YDLQLALYALALEQQF 180 (257)
T ss_dssp ESSTEEEEEEESSS-SSSHH----------HHH---CHHHHHHHHHHHHHHH
T ss_pred CCCcEEEEEEcCCCCCCccc----------hhh---hHHHHHHHHHHHHhcc
Confidence 37789999999988744332 111 4789999998866543
No 123
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=28.95 E-value=35 Score=25.45 Aligned_cols=16 Identities=13% Similarity=0.276 Sum_probs=12.9
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+...+.|+|||+++..
T Consensus 131 ~~~~~kL~DfG~~~~~ 146 (320)
T cd05590 131 HEGHCKLADFGMCKEG 146 (320)
T ss_pred CCCcEEEeeCCCCeec
Confidence 3567999999999864
No 124
>PF03244 PSI_PsaH: Photosystem I reaction centre subunit VI; InterPro: IPR004928 Photosystem I, a membrane complex found in the chloroplasts of plants and cyanobacteria uses light energy to transfer electrons from plastocyanin to ferredoxin []. The electron transfer components of the photosystem include the primary electron donor chlorophyll P-700 and 5 electron acceptors: chlorophyll (A0), phylloquinone (A1) and three 4Fe-4S iron-sulphur centres, designated Fx, Fa and Fb. The role of this protein, subunit VI or PsaH, may be in docking of the light harvesting complex I antenna to the core complex.; GO: 0015979 photosynthesis, 0009522 photosystem I, 0009538 photosystem I reaction center; PDB: 2WSF_H 2WSE_H 2WSC_H 2O01_H.
Probab=28.84 E-value=14 Score=27.07 Aligned_cols=13 Identities=38% Similarity=0.733 Sum_probs=0.6
Q ss_pred cccCCceEEecCC
Q psy15902 22 CFVGEKICYYDLS 34 (93)
Q Consensus 22 ~~~~~~~~f~dL~ 34 (93)
++.|+..+|+||+
T Consensus 45 AKYGdkSvYFDL~ 57 (140)
T PF03244_consen 45 AKYGDKSVYFDLE 57 (140)
T ss_dssp ------------S
T ss_pred eecccceeEEehh
Confidence 4457789999996
No 125
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=28.74 E-value=35 Score=25.41 Aligned_cols=15 Identities=13% Similarity=0.397 Sum_probs=12.3
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
...+.|+|||+++..
T Consensus 137 ~~~~kL~Dfg~~~~~ 151 (324)
T cd05587 137 EGHIKIADFGMCKEN 151 (324)
T ss_pred CCCEEEeecCcceec
Confidence 457999999999853
No 126
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=28.24 E-value=34 Score=25.33 Aligned_cols=15 Identities=13% Similarity=0.242 Sum_probs=12.3
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
..++.|+|||+++..
T Consensus 132 ~~~~kl~Dfg~~~~~ 146 (321)
T cd05603 132 QGHVVLTDFGLCKEG 146 (321)
T ss_pred CCCEEEccCCCCccC
Confidence 457999999999863
No 127
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=28.19 E-value=38 Score=27.96 Aligned_cols=17 Identities=12% Similarity=0.264 Sum_probs=14.1
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
.+.++.||||++||...
T Consensus 462 ~~~~~~liDFGla~~~~ 478 (535)
T PRK09605 462 RDDRLYLIDFGLGKYSD 478 (535)
T ss_pred ECCcEEEEeCcccccCC
Confidence 46789999999999854
No 128
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=28.16 E-value=58 Score=22.66 Aligned_cols=45 Identities=9% Similarity=0.142 Sum_probs=26.4
Q ss_pred CCeEEEEeccccccccCCceEEec---------CCCCccccccC----CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYD---------LSQDEELFEGE----GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~d---------L~~d~~~F~G~----gD~QfdiYr~ 53 (93)
+.++.|+||++++........... .-..|+.+.+. .+.+-|||..
T Consensus 135 ~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~~~~Dv~s~ 192 (264)
T cd06626 135 NGVIKLGDFGCAVKLKNNTTTMGEEVQSLAGTPAYMAPEVITGGKGKGHGRAADIWSL 192 (264)
T ss_pred CCCEEEcccccccccCCCCCcccccccCCcCCcCccChhhccCCCCCCCCcccchHHH
Confidence 567999999999876543211110 11246766653 3556677764
No 129
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=28.08 E-value=35 Score=25.33 Aligned_cols=15 Identities=13% Similarity=0.343 Sum_probs=12.3
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
...+.|+|||++|..
T Consensus 210 ~~~~kl~DfG~a~~~ 224 (338)
T cd05102 210 NNVVKICDFGLARDI 224 (338)
T ss_pred CCcEEEeeccccccc
Confidence 457999999999854
No 130
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=27.93 E-value=56 Score=22.92 Aligned_cols=46 Identities=13% Similarity=0.122 Sum_probs=26.8
Q ss_pred cCCeEEEEeccccccccCCceEEe-c-------CCCCccccccC-CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYY-D-------LSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~-d-------L~~d~~~F~G~-gD~QfdiYr~ 53 (93)
...++.|+||++++........+. . .-.-|+.+.+. -+..-|||..
T Consensus 130 ~~~~~kl~df~~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 184 (257)
T cd05060 130 NRHQAKISDFGMSRALGAGSDYYRATTAGRWPLKWYAPECINYGKFSSKSDVWSY 184 (257)
T ss_pred CCCcEEeccccccceeecCCcccccccCccccccccCHHHhcCCCCCccchHHHH
Confidence 345799999999986643322111 0 01247777653 4556777763
No 131
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=27.91 E-value=59 Score=22.79 Aligned_cols=45 Identities=9% Similarity=0.101 Sum_probs=25.8
Q ss_pred CCeEEEEeccccccccCCceE-EecC-----CCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKIC-YYDL-----SQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~-f~dL-----~~d~~~F~G-~gD~QfdiYr~ 53 (93)
...+.|+|||+++...+.... .... -.-|+.+.+ ..+.+-|||..
T Consensus 139 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 190 (261)
T cd05072 139 SLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSF 190 (261)
T ss_pred CCcEEECCCccceecCCCceeccCCCccceecCCHHHhccCCCChhhhhhhh
Confidence 456899999999976533211 1110 113565554 34567788773
No 132
>KOG4278|consensus
Probab=27.41 E-value=28 Score=32.18 Aligned_cols=17 Identities=29% Similarity=0.612 Sum_probs=14.0
Q ss_pred CeEEEEeccccccccCC
Q psy15902 10 QHFQVENFTISRCFVGE 26 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~~ 26 (93)
.-|.|.||||||+-.++
T Consensus 402 hiVKvADFGLsRlMtgD 418 (1157)
T KOG4278|consen 402 HIVKVADFGLSRLMTGD 418 (1157)
T ss_pred ceEEeeccchhhhhcCC
Confidence 45899999999987754
No 133
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=27.29 E-value=64 Score=22.64 Aligned_cols=17 Identities=6% Similarity=0.190 Sum_probs=13.9
Q ss_pred CCeEEEEeccccccccC
Q psy15902 9 TQHFQVENFTISRCFVG 25 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~ 25 (93)
...+.|+||++++....
T Consensus 129 ~~~~~l~df~~~~~~~~ 145 (262)
T cd05572 129 NGYVKLVDFGFAKKLKS 145 (262)
T ss_pred CCCEEEeeCCcccccCc
Confidence 46799999999997654
No 134
>KOG0200|consensus
Probab=27.27 E-value=33 Score=29.20 Aligned_cols=15 Identities=13% Similarity=0.485 Sum_probs=12.6
Q ss_pred cCCeEEEEecccccc
Q psy15902 8 RTQHFQVENFTISRC 22 (93)
Q Consensus 8 ~g~~vTIIDftLSR~ 22 (93)
++.-+.|+||||+|-
T Consensus 453 ~~~~~kIaDFGlar~ 467 (609)
T KOG0200|consen 453 KNKVIKIADFGLARD 467 (609)
T ss_pred CCCEEEEccccceec
Confidence 456789999999994
No 135
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=27.17 E-value=57 Score=22.71 Aligned_cols=17 Identities=0% Similarity=-0.072 Sum_probs=13.3
Q ss_pred CCeEEEEeccccccccC
Q psy15902 9 TQHFQVENFTISRCFVG 25 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~ 25 (93)
+.++.|||||+++....
T Consensus 161 ~~~~~liDfg~~~~~~~ 177 (198)
T cd05144 161 DEKIYIIDWPQMVSTDH 177 (198)
T ss_pred CCcEEEEECCccccCCC
Confidence 56889999999965543
No 136
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning
Probab=27.07 E-value=81 Score=22.31 Aligned_cols=46 Identities=13% Similarity=0.241 Sum_probs=27.7
Q ss_pred cCCeEEEEeccccccccCCce------EEecCCCCccccccC--CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI------CYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~------~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
++.+|.|+|||+++.-..... +.+..-.-||.+.+. -+..-|||..
T Consensus 135 ~~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~~~~PE~~~~~~~~~~~~Dv~sl 188 (288)
T cd07833 135 ESGVLKLCDFGFARALRARPASPLTDYVATRWYRAPELLVGDTNYGKPVDVWAI 188 (288)
T ss_pred CCCCEEEEeeecccccCCCccccccCcccccCCcCCchhcCCCCcCchhhHHHH
Confidence 367899999999886553321 111222356766654 2466777763
No 137
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=27.04 E-value=36 Score=25.50 Aligned_cols=45 Identities=13% Similarity=0.310 Sum_probs=24.8
Q ss_pred cCCeEEEEeccccccccCC--c-eEEe--cCCCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGE--K-ICYY--DLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~--~-~~f~--dL~~d~~~F~G~-gD~QfdiYr 52 (93)
+...+.|||||+|+..... . ..+. ..-.-||.+.+. -+.+-|||-
T Consensus 131 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~Diws 181 (327)
T cd05617 131 ADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWA 181 (327)
T ss_pred CCCCEEEeccccceeccCCCCceecccCCcccCCHHHHCCCCCCchheeeh
Confidence 3467999999999853321 1 1111 111257777663 345566555
No 138
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=26.97 E-value=69 Score=22.24 Aligned_cols=45 Identities=13% Similarity=0.171 Sum_probs=25.4
Q ss_pred cCCeEEEEeccccccccCCc---eEEec--CCCCccccccC----CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK---ICYYD--LSQDEELFEGE----GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~---~~f~d--L~~d~~~F~G~----gD~QfdiYr 52 (93)
...++.|+|||+++.-.... ..+.. .--.|+++.+. .+.+-|||.
T Consensus 136 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~y~~Pe~~~~~~~~~~~~~~Di~s 189 (262)
T cd06613 136 EDGDVKLADFGVSAQLTATIAKRKSFIGTPYWMAPEVAAVERKGGYDGKCDIWA 189 (262)
T ss_pred CCCCEEECccccchhhhhhhhccccccCCccccCchhhcccccCCcCchhhhHH
Confidence 45679999999987533211 11111 01257777653 455667776
No 139
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found
Probab=26.91 E-value=39 Score=26.15 Aligned_cols=16 Identities=13% Similarity=0.364 Sum_probs=13.1
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+..++.|||||+|+..
T Consensus 177 ~~~~~kL~DFG~a~~~ 192 (370)
T cd05621 177 KHGHLKLADFGTCMKM 192 (370)
T ss_pred CCCCEEEEecccceec
Confidence 4568999999999864
No 140
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=26.84 E-value=42 Score=25.63 Aligned_cols=14 Identities=21% Similarity=0.589 Sum_probs=11.6
Q ss_pred cCCeEEEEeccccc
Q psy15902 8 RTQHFQVENFTISR 21 (93)
Q Consensus 8 ~g~~vTIIDftLSR 21 (93)
+...+.|+|||+++
T Consensus 136 ~~g~~kL~DFGla~ 149 (382)
T cd05625 136 RDGHIKLTDFGLCT 149 (382)
T ss_pred CCCCEEEeECCCCc
Confidence 35679999999986
No 141
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=26.74 E-value=40 Score=25.32 Aligned_cols=16 Identities=13% Similarity=0.391 Sum_probs=13.0
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
...++.|+|||+++..
T Consensus 130 ~~~~~kL~DfG~~~~~ 145 (328)
T cd05593 130 KDGHIKITDFGLCKEG 145 (328)
T ss_pred CCCcEEEecCcCCccC
Confidence 4567999999999863
No 142
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=26.74 E-value=45 Score=23.87 Aligned_cols=51 Identities=14% Similarity=0.185 Sum_probs=27.4
Q ss_pred ceecccCCeEEEEeccccccccCCce-----EEecCCCCccccccC--CchhhHHHHH
Q psy15902 3 ALTDIRTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 3 ~~~~~~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
++++-.+..+.|+|||+++.-..... +-+-.-.-|+.+.+. -+.+-|||-.
T Consensus 141 il~~~~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~sl 198 (295)
T cd07837 141 LLVDKQKGLLKIADLGLGRAFSIPVKSYTHEIVTLWYRAPEVLLGSTHYSTPVDIWSV 198 (295)
T ss_pred EEEecCCCeEEEeecccceecCCCccccCCcccccCCCChHHhhCCCCCCchHHHHHH
Confidence 34554477899999999985321110 000001146666542 2556777763
No 143
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=26.70 E-value=40 Score=25.03 Aligned_cols=15 Identities=13% Similarity=0.242 Sum_probs=12.5
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
...+.|+|||+++..
T Consensus 132 ~~~~kl~Dfg~~~~~ 146 (323)
T cd05575 132 QGHVVLTDFGLCKEG 146 (323)
T ss_pred CCcEEEeccCCCccc
Confidence 457999999999854
No 144
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=26.69 E-value=77 Score=21.14 Aligned_cols=44 Identities=11% Similarity=0.184 Sum_probs=25.2
Q ss_pred CeEEEEeccccccccCCc------eEEecCCCCccccc-c-CCchhhHHHHH
Q psy15902 10 QHFQVENFTISRCFVGEK------ICYYDLSQDEELFE-G-EGDYQFDMYRM 53 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~~~------~~f~dL~~d~~~F~-G-~gD~QfdiYr~ 53 (93)
..+.||||++++...... ......-..|+.+. + .-...-|+|..
T Consensus 135 ~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~~~pe~~~~~~~~~~~~Dv~~l 186 (225)
T smart00221 135 GLVKLADFGLARFIHRDLAALLKTVKGTPFYLAPEVLLGGKGYGEAVDIWSL 186 (225)
T ss_pred CCEEEeeCceeeEecCcccccccceeccCCcCCHhHhcCCCCCCchhhHHHH
Confidence 789999999999775432 22222223566662 2 12345666653
No 145
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=26.66 E-value=45 Score=23.27 Aligned_cols=16 Identities=13% Similarity=0.318 Sum_probs=13.0
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
...++.|+|||+++.-
T Consensus 139 ~~~~~~l~dfg~~~~~ 154 (263)
T cd06625 139 SAGNVKLGDFGASKRL 154 (263)
T ss_pred CCCCEEEeecccceec
Confidence 4568999999999754
No 146
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the
Probab=26.66 E-value=62 Score=23.34 Aligned_cols=44 Identities=14% Similarity=0.205 Sum_probs=26.1
Q ss_pred CCeEEEEeccccccccCCc--------eEEecCCCCccccccC--CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGE--GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~--gD~QfdiYr 52 (93)
...+.|+|||+++.-.... .+.+-.-.-|+.+.|. -+.+-|||.
T Consensus 148 ~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~s 201 (316)
T cd07842 148 RGVVKIGDLGLARLFNAPLKPLADLDPVVVTIWYRAPELLLGARHYTKAIDIWA 201 (316)
T ss_pred cceEEECCCccccccCCCcccccccCCccccccccCHHHHhCCCCCCcHHHHHH
Confidence 5779999999998643211 1111111257777663 356778887
No 147
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=26.65 E-value=39 Score=25.36 Aligned_cols=17 Identities=12% Similarity=0.176 Sum_probs=13.0
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
...++.|+|||+++...
T Consensus 137 ~~~~~kl~DfG~a~~~~ 153 (331)
T cd05624 137 MNGHIRLADFGSCLKMN 153 (331)
T ss_pred CCCCEEEEeccceeecc
Confidence 34579999999997543
No 148
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in
Probab=26.55 E-value=37 Score=25.37 Aligned_cols=45 Identities=11% Similarity=0.187 Sum_probs=24.7
Q ss_pred cCCeEEEEeccccccccCCc---eEE--ecCCCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK---ICY--YDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~---~~f--~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
++..|.|+|||+++...... .-+ +.--.-||.+.+. -+.+-|||-
T Consensus 131 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~Dvws 181 (316)
T cd05619 131 TDGHIKIADFGMCKENMLGDAKTCTFCGTPDYIAPEILLGQKYNTSVDWWS 181 (316)
T ss_pred CCCCEEEccCCcceECCCCCCceeeecCCccccCHHHHcCCCCCchhhhhh
Confidence 35679999999998532111 001 1111257777764 245556664
No 149
>KOG0598|consensus
Probab=26.53 E-value=42 Score=27.88 Aligned_cols=65 Identities=17% Similarity=0.360 Sum_probs=37.1
Q ss_pred CCeEEEEeccccccccCCc---eEEecCCC--CccccccCC-chhhH-------HHHHHHHhhcCCCCCCCchhHHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK---ICYYDLSQ--DEELFEGEG-DYQFD-------MYRMMRKQCQNNWQNFTPKNNALDID 75 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~---~~f~dL~~--d~~~F~G~g-D~Qfd-------iYr~MR~~~~~~W~~f~P~TNvlWL~ 75 (93)
.++|.|+|||||+.....+ .-|+.... -||+..+.| +..-| .|.|+. .|.+|.-...--|..
T Consensus 161 ~GHi~LtDFgL~k~~~~~~~~t~tfcGT~eYmAPEil~~~gy~~~vDWWsLGillYeML~-----G~pPF~~~~~~~~~~ 235 (357)
T KOG0598|consen 161 QGHIKLTDFGLCKEDLKDGDATRTFCGTPEYMAPEILLGKGYDKAVDWWSLGILLYEMLT-----GKPPFYAEDVKKMYD 235 (357)
T ss_pred CCcEEEeccccchhcccCCCccccccCCccccChHHHhcCCCCcccchHhHHHHHHHHhh-----CCCCCcCccHHHHHH
Confidence 4789999999999766431 12333211 488888865 22222 344433 466666555555544
Q ss_pred HHH
Q psy15902 76 GLI 78 (93)
Q Consensus 76 YL~ 78 (93)
=++
T Consensus 236 ~I~ 238 (357)
T KOG0598|consen 236 KIL 238 (357)
T ss_pred HHh
Confidence 443
No 150
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=26.51 E-value=80 Score=22.67 Aligned_cols=46 Identities=17% Similarity=0.254 Sum_probs=27.0
Q ss_pred cCCeEEEEeccccccccCCceEE-----ecCCCCccccccCC--chhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICY-----YDLSQDEELFEGEG--DYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f-----~dL~~d~~~F~G~g--D~QfdiYr~ 53 (93)
.++.+.|+|||+++........+ +-.-..|+.+.+.. +..-|+|..
T Consensus 141 ~~~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~sl 193 (293)
T cd07843 141 NRGILKICDFGLAREYGSPLKPYTQLVVTLWYRAPELLLGAKEYSTAIDMWSV 193 (293)
T ss_pred CCCcEEEeecCceeeccCCccccccccccccccCchhhcCCccccchhhHHHH
Confidence 34679999999999655431111 11112578777642 455677763
No 151
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is
Probab=26.50 E-value=35 Score=25.47 Aligned_cols=45 Identities=13% Similarity=0.178 Sum_probs=24.5
Q ss_pred cCCeEEEEeccccccccCCceEE--ecCCCCccccccC--CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICY--YDLSQDEELFEGE--GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f--~dL~~d~~~F~G~--gD~QfdiYr 52 (93)
...++.|+|||+++.......-+ +..-.-||++.+. -...-|||-
T Consensus 153 ~~~~~kl~Dfg~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~~~Diws 201 (343)
T cd07878 153 EDCELRILDFGLARQADDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWS 201 (343)
T ss_pred CCCCEEEcCCccceecCCCcCCccccccccCchHhcCCccCCchhhhHh
Confidence 35679999999998654332111 1111247776652 223445554
No 152
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=26.28 E-value=70 Score=22.51 Aligned_cols=44 Identities=14% Similarity=0.117 Sum_probs=25.4
Q ss_pred CCeEEEEeccccccccCCce----EEecCCCCccccccC-CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
...+.|+|||+++....... .-+..-..|+.+.+. -+.+-|||-
T Consensus 150 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~Pe~~~~~~~~~~~Dv~s 198 (269)
T cd08528 150 DDKVTITDFGLAKQKQPESKLTSVVGTILYSCPEIVKNEPYGEKADVWA 198 (269)
T ss_pred CCcEEEecccceeecccccccccccCcccCcChhhhcCCCCchHHHHHH
Confidence 45799999999987554321 001111257777653 245667765
No 153
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=26.25 E-value=36 Score=25.22 Aligned_cols=17 Identities=24% Similarity=0.454 Sum_probs=13.4
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
...+|.|+|||+++.-.
T Consensus 137 ~~~~~kL~Dfg~a~~~~ 153 (330)
T cd05601 137 RTGHIKLADFGSAARLT 153 (330)
T ss_pred CCCCEEeccCCCCeECC
Confidence 35689999999998543
No 154
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=26.22 E-value=44 Score=24.98 Aligned_cols=16 Identities=13% Similarity=0.241 Sum_probs=12.6
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
...++.|+|||+++.-
T Consensus 137 ~~~~~kL~DfG~a~~~ 152 (332)
T cd05623 137 MNGHIRLADFGSCLKL 152 (332)
T ss_pred CCCCEEEeecchheec
Confidence 4567999999998753
No 155
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=26.20 E-value=36 Score=24.53 Aligned_cols=45 Identities=13% Similarity=0.092 Sum_probs=24.9
Q ss_pred cCCeEEEEeccccccccCCc-eE-EecC-----CCCcccccc-CCchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK-IC-YYDL-----SQDEELFEG-EGDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~-~~-f~dL-----~~d~~~F~G-~gD~QfdiYr 52 (93)
.+..+.|+|||++|...++. .. +... -..|+.+.+ .-+..-|||-
T Consensus 144 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~~y~~pE~~~~~~~~~~~Dv~s 196 (279)
T cd05111 144 SDSIVQIADFGVADLLYPDDKKYFYSEHKTPIKWMALESILFGRYTHQSDVWS 196 (279)
T ss_pred CCCcEEEcCCccceeccCCCcccccCCCCCcccccCHHHhccCCcCchhhHHH
Confidence 45679999999998654321 11 1110 114666654 3345566665
No 156
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=26.19 E-value=55 Score=21.54 Aligned_cols=14 Identities=0% Similarity=0.055 Sum_probs=8.9
Q ss_pred CCeEEEEecccccc
Q psy15902 9 TQHFQVENFTISRC 22 (93)
Q Consensus 9 g~~vTIIDftLSR~ 22 (93)
+.++.+|||+.++.
T Consensus 123 ~~~~~liDf~~a~~ 136 (170)
T cd05151 123 DGRLWLIDWEYAGM 136 (170)
T ss_pred CCeEEEEecccccC
Confidence 34567777777654
No 157
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=26.19 E-value=36 Score=25.32 Aligned_cols=15 Identities=13% Similarity=0.399 Sum_probs=12.3
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
+..+.|+|||+++..
T Consensus 132 ~~~~kl~Dfg~~~~~ 146 (316)
T cd05620 132 DGHIKIADFGMCKEN 146 (316)
T ss_pred CCCEEeCccCCCeec
Confidence 457999999999853
No 158
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=26.15 E-value=62 Score=22.54 Aligned_cols=16 Identities=13% Similarity=0.403 Sum_probs=13.1
Q ss_pred CeEEEEeccccccccC
Q psy15902 10 QHFQVENFTISRCFVG 25 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~ 25 (93)
..+.|+|||+++....
T Consensus 134 ~~~kl~dfg~~~~~~~ 149 (257)
T cd05040 134 DKVKIGDFGLMRALPQ 149 (257)
T ss_pred CEEEeccccccccccc
Confidence 6799999999986543
No 159
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=26.14 E-value=79 Score=22.97 Aligned_cols=41 Identities=12% Similarity=0.186 Sum_probs=25.3
Q ss_pred CCeEEEEeccccccccCCc-----------eEEecCCCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-----------ICYYDLSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-----------~~f~dL~~d~~~F~G-~gD~QfdiYr~ 53 (93)
+..+.|+|||+++...... ..|. -|+.+.+ .-+.+-|||..
T Consensus 173 ~~~~kl~D~g~~~~~~~~~~~~~~~~~~~~~~y~----aPE~~~~~~~~~~~Di~sl 225 (304)
T cd05101 173 NNVMKIADFGLARDVNNIDYYKKTTNGRLPVKWM----APEALFDRVYTHQSDVWSF 225 (304)
T ss_pred CCcEEECCCccceecccccccccccCCCCCceee----CchhhccCCCCchhhHHHH
Confidence 4578999999998543211 1222 4666554 34567788874
No 160
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=26.13 E-value=63 Score=27.64 Aligned_cols=18 Identities=17% Similarity=0.469 Sum_probs=14.5
Q ss_pred CCeEEEEeccccccccCC
Q psy15902 9 TQHFQVENFTISRCFVGE 26 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~ 26 (93)
...|.|+|||+||.....
T Consensus 140 ~g~vkL~DFGls~~~~~~ 157 (669)
T cd05610 140 EGHIKLTDFGLSKVTLNR 157 (669)
T ss_pred CCCEEEEeCCCCccccCC
Confidence 357999999999977643
No 161
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=25.99 E-value=1e+02 Score=21.16 Aligned_cols=45 Identities=9% Similarity=0.174 Sum_probs=26.8
Q ss_pred CCeEEEEeccccccccCCceEEec-----CCCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYD-----LSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~d-----L~~d~~~F~G-~gD~QfdiYr~ 53 (93)
...+.|+||++++........... .-.-|+.+.+ ..+.+-|+|..
T Consensus 146 ~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~~~pE~~~~~~~~~~~Dv~sl 196 (265)
T cd08217 146 NNNVKLGDFGLAKILGHDSSFAKTYVGTPYYMSPEQLNHMSYDEKSDIWSL 196 (265)
T ss_pred CCCEEEecccccccccCCcccccccccCCCccChhhhcCCCCCchhHHHHH
Confidence 468999999999976533211110 0113666654 34677788874
No 162
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=25.91 E-value=68 Score=22.64 Aligned_cols=46 Identities=15% Similarity=0.208 Sum_probs=25.5
Q ss_pred cCCeEEEEeccccccccCCceE------EecCCCCccccccC-CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKIC------YYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~------f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
....+.|+||++++........ ++-.-.-|+.+.+. -+.+-|||-.
T Consensus 139 ~~~~~kl~df~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~sl 191 (263)
T cd05052 139 ENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAF 191 (263)
T ss_pred CCCcEEeCCCccccccccceeeccCCCCCccccCCHHHhccCCCCchhHHHHH
Confidence 4457999999999876543210 00001136666653 3456677663
No 163
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=25.71 E-value=43 Score=25.88 Aligned_cols=17 Identities=12% Similarity=0.335 Sum_probs=13.3
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
+..++.|+|||+++.-.
T Consensus 177 ~~~~ikL~DfG~a~~~~ 193 (371)
T cd05622 177 KSGHLKLADFGTCMKMN 193 (371)
T ss_pred CCCCEEEEeCCceeEcC
Confidence 35679999999998543
No 164
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=25.69 E-value=39 Score=24.81 Aligned_cols=17 Identities=12% Similarity=0.309 Sum_probs=13.5
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
....+.|+|||+++...
T Consensus 138 ~~~~~kL~Dfg~~~~~~ 154 (338)
T cd07859 138 ADCKLKICDFGLARVAF 154 (338)
T ss_pred CCCcEEEccCccccccc
Confidence 35679999999998653
No 165
>KOG1094|consensus
Probab=25.69 E-value=34 Score=30.99 Aligned_cols=13 Identities=23% Similarity=0.516 Sum_probs=11.9
Q ss_pred CCeEEEEeccccc
Q psy15902 9 TQHFQVENFTISR 21 (93)
Q Consensus 9 g~~vTIIDftLSR 21 (93)
..+|+|+|||+||
T Consensus 673 e~~iKiadfgmsR 685 (807)
T KOG1094|consen 673 EFTIKIADFGMSR 685 (807)
T ss_pred cccEEecCccccc
Confidence 4789999999999
No 166
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes
Probab=25.67 E-value=44 Score=23.86 Aligned_cols=45 Identities=16% Similarity=0.220 Sum_probs=25.0
Q ss_pred cCCeEEEEeccccccccCC-ce-----EEecCCCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGE-KI-----CYYDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~-~~-----~f~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
....+.|+|||+++.-... .. +-+..-.-||.+.+. -+..-|||-
T Consensus 135 ~~~~~kl~Dfg~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Diws 186 (287)
T cd07848 135 HNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLGAPYGKAVDMWS 186 (287)
T ss_pred CCCcEEEeeccCcccccccccccccccccccccCCcHHHcCCCCCCchhHHh
Confidence 3457999999999864321 11 111111247776653 345666665
No 167
>KOG1163|consensus
Probab=25.63 E-value=42 Score=27.52 Aligned_cols=19 Identities=5% Similarity=0.239 Sum_probs=14.5
Q ss_pred cccCCeEEEEecccccccc
Q psy15902 6 DIRTQHFQVENFTISRCFV 24 (93)
Q Consensus 6 ~~~g~~vTIIDftLSR~~~ 24 (93)
+.+--++-+||||||.--.
T Consensus 147 grh~~kl~LIDFGLaKky~ 165 (341)
T KOG1163|consen 147 GRHCNKLYLIDFGLAKKYR 165 (341)
T ss_pred ccccceEEEEeccchhhhc
Confidence 4566789999999996433
No 168
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves
Probab=25.56 E-value=54 Score=20.18 Aligned_cols=16 Identities=0% Similarity=-0.056 Sum_probs=12.8
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
+..+.++||++++...
T Consensus 125 ~~~~~l~Df~~~~~~~ 140 (155)
T cd05120 125 GKILGIIDWEYAGYGP 140 (155)
T ss_pred CcEEEEEecccccCCC
Confidence 4679999999988644
No 169
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=25.51 E-value=79 Score=22.68 Aligned_cols=45 Identities=20% Similarity=0.322 Sum_probs=26.1
Q ss_pred cCCeEEEEeccccccccCCc-eEE-----ecCCCCccccccC--CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEK-ICY-----YDLSQDEELFEGE--GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~-~~f-----~dL~~d~~~F~G~--gD~QfdiYr 52 (93)
.+..+.|+|||+++.-.... ..+ ...-..|+.+.+. -...-|||-
T Consensus 151 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~~Di~s 203 (302)
T cd07864 151 NKGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYGPAIDVWS 203 (302)
T ss_pred CCCcEEeCcccccccccCCcccccccceeccCccChHHhcCCCCCCchhHHHH
Confidence 45689999999998654221 111 1111257777653 245677775
No 170
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds
Probab=25.40 E-value=88 Score=22.09 Aligned_cols=45 Identities=13% Similarity=0.119 Sum_probs=26.8
Q ss_pred CCeEEEEeccccccccCCceEE------ecCCCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICY------YDLSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f------~dL~~d~~~F~G-~gD~QfdiYr~ 53 (93)
+..+.|+||++++...+....- .-.-..|+.+.+ .-+..-|||..
T Consensus 136 ~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~y~~pe~~~~~~~~~~~Di~sl 187 (256)
T cd05113 136 QGCVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLLYSKFSSKSDVWAF 187 (256)
T ss_pred CCCEEECCCccceecCCCceeecCCCccChhhCCHHHHhcCcccchhHHHHH
Confidence 4579999999998654332110 001125777765 33566777773
No 171
>KOG0983|consensus
Probab=25.23 E-value=36 Score=28.35 Aligned_cols=15 Identities=27% Similarity=0.401 Sum_probs=11.9
Q ss_pred CeEEEEecccccccc
Q psy15902 10 QHFQVENFTISRCFV 24 (93)
Q Consensus 10 ~~vTIIDftLSR~~~ 24 (93)
++|.+||||.|-.-.
T Consensus 229 GniKlCDFGIsGrlv 243 (391)
T KOG0983|consen 229 GNIKLCDFGISGRLV 243 (391)
T ss_pred CCEEeecccccceee
Confidence 589999999985443
No 172
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date. Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=25.04 E-value=37 Score=24.85 Aligned_cols=14 Identities=7% Similarity=0.014 Sum_probs=8.5
Q ss_pred CCeEEEEecccccc
Q psy15902 9 TQHFQVENFTISRC 22 (93)
Q Consensus 9 g~~vTIIDftLSR~ 22 (93)
..++.||||+.+--
T Consensus 142 ~~~~~iIDf~qav~ 155 (188)
T PF01163_consen 142 DGKVYIIDFGQAVD 155 (188)
T ss_dssp TTCEEE--GTTEEE
T ss_pred cceEEEEecCccee
Confidence 34899999986643
No 173
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=24.98 E-value=96 Score=20.67 Aligned_cols=47 Identities=11% Similarity=0.092 Sum_probs=29.0
Q ss_pred ecccCCeEEEEeccccccccCC-----------ceEEecCCCCcccccc----CCchhhHHH
Q psy15902 5 TDIRTQHFQVENFTISRCFVGE-----------KICYYDLSQDEELFEG----EGDYQFDMY 51 (93)
Q Consensus 5 ~~~~g~~vTIIDftLSR~~~~~-----------~~~f~dL~~d~~~F~G----~gD~QfdiY 51 (93)
++..+..+.++|||+++..... ..+-+..-..|+...+ ....+-|+|
T Consensus 134 ~~~~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~~~~t~~~~~pe~~~~~~~~~~~~~~D~~ 195 (384)
T COG0515 134 LDRDGRVVKLIDFGLAKLLPDPGSTSSIPALPSTSVGTPGYMAPEVLLGLSLAYASSSSDIW 195 (384)
T ss_pred ecCCCCeEEEeccCcceecCCCCccccccccccccccccccCCHHHhcCCCCCCCCchHhHH
Confidence 3444447999999999844322 1223333346777776 456777887
No 174
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=24.94 E-value=79 Score=23.03 Aligned_cols=47 Identities=15% Similarity=0.154 Sum_probs=27.2
Q ss_pred cCCeEEEEeccccccccCC-----ceEEecCCCCccccccC--CchhhHHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGE-----KICYYDLSQDEELFEGE--GDYQFDMYRMM 54 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~-----~~~f~dL~~d~~~F~G~--gD~QfdiYr~M 54 (93)
....+.|+|||+++..... ....+-.-.-||.+.|. -+.+-|||...
T Consensus 143 ~~~~~kL~dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~DvwslG 196 (309)
T cd07845 143 DKGCLKIADFGLARTYGLPAKPMTPKVVTLWYRAPELLLGCTTYTTAIDMWAVG 196 (309)
T ss_pred CCCCEEECccceeeecCCccCCCCcccccccccChhhhcCCCCcCchHHHHHHH
Confidence 3467999999999865422 11111111257776553 35677777754
No 175
>KOG4055|consensus
Probab=24.73 E-value=49 Score=25.62 Aligned_cols=16 Identities=31% Similarity=0.702 Sum_probs=13.0
Q ss_pred CCchhhHHHHHHHHhh
Q psy15902 43 EGDYQFDMYRMMRKQC 58 (93)
Q Consensus 43 ~gD~QfdiYr~MR~~~ 58 (93)
-|--.|-|||.||.--
T Consensus 77 aGSgeFHvYR~lRRrE 92 (213)
T KOG4055|consen 77 AGSGEFHVYRHLRRRE 92 (213)
T ss_pred CCCchhHHHHHHHHHH
Confidence 4678899999999843
No 176
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=24.37 E-value=63 Score=22.88 Aligned_cols=45 Identities=9% Similarity=0.134 Sum_probs=25.6
Q ss_pred cCCeEEEEeccccccccCCce----EEecCCCCccccccC--CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE--GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~--gD~QfdiYr 52 (93)
.+.++.|+||++++....... +-+..-.-|+.+.+. -+.+-|+|.
T Consensus 134 ~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~aPE~~~~~~~~~~~~Di~s 184 (283)
T cd07830 134 GPEVVKIADFGLAREIRSRPPYTDYVSTRWYRAPEILLRSTSYSSPVDIWA 184 (283)
T ss_pred CCCCEEEeecccceeccCCCCcCCCCCcccccCceeeecCcCcCCccchhh
Confidence 367899999999985543211 111111246666442 356667666
No 177
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=24.34 E-value=79 Score=23.74 Aligned_cols=46 Identities=11% Similarity=0.135 Sum_probs=26.4
Q ss_pred cCCeEEEEeccccccccCCce--EEecCCCCccccccC--CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI--CYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~--~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
..+.+.|+|||+++....+.. +-+..-.-|+.+.+. .+.+-|||-.
T Consensus 152 ~~~~~kL~dfg~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~Dv~sl 201 (342)
T cd07879 152 EDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILNWMHYNQTVDIWSV 201 (342)
T ss_pred CCCCEEEeeCCCCcCCCCCCCCceeeecccChhhhcCccccCchHHHHHH
Confidence 356899999999987543221 111111247766542 3456677763
No 178
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=24.32 E-value=41 Score=23.69 Aligned_cols=17 Identities=18% Similarity=0.298 Sum_probs=13.5
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
....+.|+|||+++...
T Consensus 147 ~~~~~kl~Dfg~~~~~~ 163 (272)
T cd05075 147 ENMNVCVADFGLSKKIY 163 (272)
T ss_pred CCCCEEECCCCcccccC
Confidence 35678999999999654
No 179
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=24.31 E-value=55 Score=24.66 Aligned_cols=45 Identities=11% Similarity=0.158 Sum_probs=26.0
Q ss_pred CCeEEEEeccccccccCCce----EEecCCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKI----CYYDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~----~f~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
..++.|+|||+++....... ..+..-.-|+.+.+. -+.+-|||-.
T Consensus 154 ~~~~kL~Dfg~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dvwsl 203 (353)
T cd07850 154 DCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSV 203 (353)
T ss_pred CCCEEEccCccceeCCCCCCCCCCcccccccCHHHHhCCCCCCchhhHhH
Confidence 45799999999986543211 111111247777663 3456677653
No 180
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved
Probab=24.28 E-value=42 Score=24.95 Aligned_cols=16 Identities=6% Similarity=0.185 Sum_probs=12.8
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+...+.|+|||+++..
T Consensus 136 ~~~~~kL~Dfg~~~~~ 151 (324)
T cd05589 136 TEGFVKIADFGLCKEG 151 (324)
T ss_pred CCCcEEeCcccCCccC
Confidence 3568999999999853
No 181
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=24.28 E-value=71 Score=22.82 Aligned_cols=46 Identities=11% Similarity=0.211 Sum_probs=26.7
Q ss_pred cCCeEEEEeccccccccCCce-----EEecCCCCcccccc-CCchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI-----CYYDLSQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~-----~f~dL~~d~~~F~G-~gD~QfdiYr~ 53 (93)
++.++.|+||++++....... .-+..-.-||...+ .-+.+-|+|..
T Consensus 136 ~~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~apE~~~~~~~~~~~Dv~sl 187 (277)
T cd06640 136 EQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSL 187 (277)
T ss_pred CCCCEEEcccccceeccCCccccccccCcccccCHhHhccCCCccHHHHHHH
Confidence 345799999999987553221 11111124666655 34677888863
No 182
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=24.25 E-value=72 Score=22.32 Aligned_cols=44 Identities=16% Similarity=0.298 Sum_probs=25.4
Q ss_pred CeEEEEeccccccccCCceEEecCC-----CCccccccC-CchhhHHHHH
Q psy15902 10 QHFQVENFTISRCFVGEKICYYDLS-----QDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 10 ~~vTIIDftLSR~~~~~~~~f~dL~-----~d~~~F~G~-gD~QfdiYr~ 53 (93)
..+.|+||++++...+......... .-|+.+++. -+.+.|+|..
T Consensus 142 ~~~~l~d~g~~~~~~~~~~~~~~~~~~~~~~~pe~~~~~~~~~~~Dv~sl 191 (260)
T cd08222 142 NLLKIGDFGVSRLLMGSCDLATTFTGTPYYMSPEALKHQGYDSKSDIWSL 191 (260)
T ss_pred CCEeecccCceeecCCCcccccCCCCCcCccCHHHHccCCCCchhhHHHH
Confidence 4589999999987654332211110 136666653 2456777763
No 183
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity
Probab=24.23 E-value=1.1e+02 Score=21.60 Aligned_cols=43 Identities=14% Similarity=0.077 Sum_probs=26.2
Q ss_pred EEEEeccccccccCCceEEecC-CCCccccccC--CchhhHHHHHH
Q psy15902 12 FQVENFTISRCFVGEKICYYDL-SQDEELFEGE--GDYQFDMYRMM 54 (93)
Q Consensus 12 vTIIDftLSR~~~~~~~~f~dL-~~d~~~F~G~--gD~QfdiYr~M 54 (93)
+.++|||+++............ ---|+.+.+. .+..-|||-..
T Consensus 147 ~~l~d~g~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~~DiwslG 192 (258)
T cd05078 147 IKLSDPGISITVLPKEILLERIPWVPPECIENPQNLSLAADKWSFG 192 (258)
T ss_pred EEecccccccccCCchhccccCCccCchhccCCCCCCchhhHHHHH
Confidence 7899999998665433211111 1257777753 35677888754
No 184
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=24.16 E-value=48 Score=24.85 Aligned_cols=16 Identities=13% Similarity=0.345 Sum_probs=12.6
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
...++.|+|||+++..
T Consensus 137 ~~~~~kl~Dfg~~~~~ 152 (331)
T cd05597 137 KNGHIRLADFGSCLRL 152 (331)
T ss_pred CCCCEEEEECCceeec
Confidence 3457999999998754
No 185
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=24.03 E-value=48 Score=22.98 Aligned_cols=46 Identities=9% Similarity=0.152 Sum_probs=26.7
Q ss_pred cCCeEEEEeccccccccCCceEE-----ecCCCCccccccC-CchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICY-----YDLSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f-----~dL~~d~~~F~G~-gD~QfdiYr~ 53 (93)
...++.|+||++++.-....... ...-.-|+.+.+. -+.+-|||-.
T Consensus 136 ~~~~~~l~df~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~sl 187 (256)
T cd08529 136 AYDNVKIGDLGVAKLLSDNTNFANTIVGTPYYLSPELCEDKPYNEKSDVWAL 187 (256)
T ss_pred CCCCEEEcccccceeccCccchhhccccCccccCHHHhcCCCCCCccchHHH
Confidence 34678999999988644322111 1111257777654 3566777764
No 186
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]
Probab=23.80 E-value=45 Score=28.02 Aligned_cols=17 Identities=18% Similarity=0.597 Sum_probs=14.5
Q ss_pred CCeEEEEeccccccccC
Q psy15902 9 TQHFQVENFTISRCFVG 25 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~ 25 (93)
|++-.||||+||-+-..
T Consensus 34 gGkYRiIDF~LSN~vNS 50 (393)
T COG0448 34 GGKYRIIDFALSNCVNS 50 (393)
T ss_pred CceeEEEeEEccccccc
Confidence 78889999999987663
No 187
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=23.78 E-value=52 Score=24.33 Aligned_cols=17 Identities=18% Similarity=0.444 Sum_probs=13.3
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
...++.|+|||+++...
T Consensus 133 ~~~~~kL~Dfg~~~~~~ 149 (318)
T cd05582 133 EEGHIKLTDFGLSKESI 149 (318)
T ss_pred CCCcEEEeeccCCcccC
Confidence 34579999999998654
No 188
>KOG4236|consensus
Probab=23.41 E-value=34 Score=30.94 Aligned_cols=15 Identities=13% Similarity=0.288 Sum_probs=12.6
Q ss_pred CeEEEEecccccccc
Q psy15902 10 QHFQVENFTISRCFV 24 (93)
Q Consensus 10 ~~vTIIDftLSR~~~ 24 (93)
-+|+|||||..|+--
T Consensus 704 PQvKlCDFGfARiIg 718 (888)
T KOG4236|consen 704 PQVKLCDFGFARIIG 718 (888)
T ss_pred Cceeeccccceeecc
Confidence 369999999999754
No 189
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=23.38 E-value=50 Score=23.02 Aligned_cols=16 Identities=19% Similarity=0.331 Sum_probs=12.9
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
+..+.|+||++++...
T Consensus 137 ~~~~kl~d~~~~~~~~ 152 (256)
T cd08221 137 AGLIKLGDFGISKILG 152 (256)
T ss_pred CCCEEECcCcceEEcc
Confidence 4679999999998654
No 190
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=23.34 E-value=45 Score=23.78 Aligned_cols=16 Identities=6% Similarity=0.177 Sum_probs=13.0
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
..++.|+|||++|...
T Consensus 160 ~~~~kl~Dfg~~~~~~ 175 (283)
T cd05091 160 KLNVKISDLGLFREVY 175 (283)
T ss_pred CCceEecccccccccc
Confidence 4579999999999654
No 191
>KOG0198|consensus
Probab=23.28 E-value=52 Score=26.31 Aligned_cols=54 Identities=13% Similarity=0.180 Sum_probs=30.5
Q ss_pred eecccCCeEEEEeccccccccC--C------ceEEecCCCCccccc-cC-CchhhHHHHHHHHh
Q psy15902 4 LTDIRTQHFQVENFTISRCFVG--E------KICYYDLSQDEELFE-GE-GDYQFDMYRMMRKQ 57 (93)
Q Consensus 4 ~~~~~g~~vTIIDftLSR~~~~--~------~~~f~dL~~d~~~F~-G~-gD~QfdiYr~MR~~ 57 (93)
|++.++..+.|.|||+++...+ . ...=+-.--.|+.-. |. .++--||+-.+-.+
T Consensus 149 Ll~~~~~~~KlaDFG~a~~~~~~~~~~~~~~~~~Gtp~~maPEvi~~g~~~~~~sDiWSlGCtV 212 (313)
T KOG0198|consen 149 LLDPSNGDVKLADFGLAKKLESKGTKSDSELSVQGTPNYMAPEVIRNGEVARRESDIWSLGCTV 212 (313)
T ss_pred EEeCCCCeEEeccCccccccccccccccccccccCCccccCchhhcCCCcCCccchhhhcCCEE
Confidence 4555578999999999986653 0 011111112567766 32 23456666665543
No 192
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=23.03 E-value=46 Score=23.47 Aligned_cols=16 Identities=13% Similarity=0.306 Sum_probs=12.8
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
.+..+.|+|||+++..
T Consensus 141 ~~~~~~l~Dfg~~~~~ 156 (265)
T cd06652 141 SVGNVKLGDFGASKRL 156 (265)
T ss_pred CCCCEEECcCcccccc
Confidence 3567999999999853
No 193
>PF10134 RPA: Replication initiator protein A; InterPro: IPR018777 Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.
Probab=23.00 E-value=49 Score=25.12 Aligned_cols=49 Identities=16% Similarity=0.310 Sum_probs=32.1
Q ss_pred cCCeEEEEeccccccccCCceEEecCCCCccccccCCchhhHHHHHHHHhhcCC
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNN 61 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~dL~~d~~~F~G~gD~QfdiYr~MR~~~~~~ 61 (93)
..++|||.|.-.--+. ++.+... ||+.|.=++-.-.-+||.-|++++.+
T Consensus 139 ~~v~I~L~~wl~~~i~-~~~vltl----d~~yf~L~~pl~R~LYrlarkh~g~q 187 (229)
T PF10134_consen 139 STVEITLSDWLYRSIR-AGYVLTL----DPDYFRLRKPLERRLYRLARKHCGRQ 187 (229)
T ss_pred EEEEEEECHHHHHHHH-hCccEEe----cHHHhhCCChHHHHHHHHHHHhcCCC
Confidence 4456666666555554 3333333 77889656667777999999998653
No 194
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=22.99 E-value=45 Score=25.00 Aligned_cols=16 Identities=6% Similarity=0.247 Sum_probs=12.8
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
+...+.|+|||+++..
T Consensus 131 ~~~~~kL~Dfg~~~~~ 146 (329)
T cd05588 131 AEGHIKLTDYGMCKEG 146 (329)
T ss_pred CCCCEEECcCcccccc
Confidence 3467999999999853
No 195
>KOG0597|consensus
Probab=22.90 E-value=50 Score=29.98 Aligned_cols=31 Identities=19% Similarity=0.361 Sum_probs=22.5
Q ss_pred cCCeEEEEeccccccccCC---------ceEEecCCCCcccccc
Q psy15902 8 RTQHFQVENFTISRCFVGE---------KICYYDLSQDEELFEG 42 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~---------~~~f~dL~~d~~~F~G 42 (93)
.|+.+++|||||.|+...+ ..+|+ -||+.+|
T Consensus 135 ~~~~~KlcdFg~Ar~m~~~t~vltsikGtPlYm----APElv~e 174 (808)
T KOG0597|consen 135 KGGTLKLCDFGLARAMSTNTSVLTSIKGTPLYM----APELVEE 174 (808)
T ss_pred CCCceeechhhhhhhcccCceeeeeccCccccc----CHHHHcC
Confidence 5788999999999987643 34554 4666664
No 196
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=22.61 E-value=53 Score=22.98 Aligned_cols=45 Identities=11% Similarity=0.176 Sum_probs=24.9
Q ss_pred cCCeEEEEeccccccccCCceEEecC----CCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKICYYDL----SQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~~f~dL----~~d~~~F~G~-gD~QfdiYr 52 (93)
+..++.|+||++++........-... --.|+.+.+. .+.+-|+|.
T Consensus 135 ~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~s 184 (258)
T cd05578 135 EQGHVHITDFNIATKVTPDTLTTSTSGTPGYMAPEVLCRQGYSVAVDWWS 184 (258)
T ss_pred CCCCEEEeecccccccCCCccccccCCChhhcCHHHHcccCCCCcccchh
Confidence 34679999999998765432110000 0146666653 245555555
No 197
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5,
Probab=22.57 E-value=54 Score=23.73 Aligned_cols=16 Identities=6% Similarity=0.212 Sum_probs=13.0
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
...+.|+|||+++...
T Consensus 138 ~~~~~l~Dfg~~~~~~ 153 (285)
T cd05605 138 YGHIRISDLGLAVEIP 153 (285)
T ss_pred CCCEEEeeCCCceecC
Confidence 4679999999998643
No 198
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=22.34 E-value=53 Score=23.46 Aligned_cols=17 Identities=18% Similarity=0.382 Sum_probs=13.4
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
+...+.|+|||+++...
T Consensus 159 ~~~~~kl~dfg~~~~~~ 175 (283)
T cd05090 159 EQLHVKISDLGLSREIY 175 (283)
T ss_pred CCCcEEecccccccccc
Confidence 34679999999998653
No 199
>KOG0671|consensus
Probab=22.21 E-value=99 Score=26.29 Aligned_cols=18 Identities=11% Similarity=0.108 Sum_probs=15.1
Q ss_pred cCCeEEEEeccccccccC
Q psy15902 8 RTQHFQVENFTISRCFVG 25 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~ 25 (93)
..-+|.+||||-++....
T Consensus 247 ks~~I~vIDFGsAtf~~e 264 (415)
T KOG0671|consen 247 KSTAIKVIDFGSATFDHE 264 (415)
T ss_pred CCcceEEEecCCcceecc
Confidence 367899999999998774
No 200
>CHL00073 chlN photochlorophyllide reductase subunit N
Probab=22.13 E-value=21 Score=30.14 Aligned_cols=20 Identities=20% Similarity=0.263 Sum_probs=16.8
Q ss_pred cCCCCCCCchhHHHHHHHHH
Q psy15902 59 QNNWQNFTPKNNALDIDGLI 78 (93)
Q Consensus 59 ~~~W~~f~P~TNvlWL~YL~ 78 (93)
.|+-+.|||.|-|.|||.=+
T Consensus 15 ~g~~~~fc~~~~~~wl~~~I 34 (457)
T CHL00073 15 TGNYHTFCPISCVAWLYQKI 34 (457)
T ss_pred cCCccccCCcceEeeecccc
Confidence 36788999999999999643
No 201
>KOG1006|consensus
Probab=22.13 E-value=47 Score=27.53 Aligned_cols=17 Identities=24% Similarity=0.362 Sum_probs=13.1
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
+.+.|.+||||.|---.
T Consensus 203 r~G~vKLCDFGIcGqLv 219 (361)
T KOG1006|consen 203 RHGDVKLCDFGICGQLV 219 (361)
T ss_pred cCCCEeeecccchHhHH
Confidence 34689999999986443
No 202
>PF08685 GON: GON domain; InterPro: IPR012314 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. The ADAMTSs (a disintegrin and metalloproteinase domain with thrombospondin type-1 modules) are a family of zinc dependent metalloproteinases that play important roles in a variety of normal and pathological conditions. These enzymes show a complex domain organisation including signal sequence, propeptide, metalloproteinase domain (see PDOC50215 from PROSITEDOC), disintegrin-like domain (see PDOC00351 from PROSITEDOC), central TS-1 motif (see PDOC50092 from PROSITEDOC), cysteine-rich region, and a variable number of TS-like repeats at the C-terminal region. The GON domain is an approximately 200-residue module, whose presence is the hallmark of a subfamily of structurally and evolutionarily related ADAMTSs, called GON- ADAMTSs. The GON domain is characterised by the presence of several conserved cysteine residues and is likely to be globular [], []. Some proteins known to contain a GON domain are listed below: Mammalian ADAMTS-9 Mammalian ADAMTS-20 Caenorhabditis elegans gon-1, a protease required for gonadal morphogenesis Proteins containing the GON domain belong to MEROPS peptidase subfamily M12B (adamalysin, clan MA).; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding
Probab=22.04 E-value=48 Score=25.40 Aligned_cols=24 Identities=25% Similarity=0.289 Sum_probs=20.9
Q ss_pred ceecccCCeEEEEeccccccccCC
Q psy15902 3 ALTDIRTQHFQVENFTISRCFVGE 26 (93)
Q Consensus 3 ~~~~~~g~~vTIIDftLSR~~~~~ 26 (93)
+++|++.++|.+-||++|+-..+.
T Consensus 96 vRid~~tl~I~~~D~tFa~t~~G~ 119 (201)
T PF08685_consen 96 VRIDPSTLRIITNDFTFARTTGGN 119 (201)
T ss_pred EEEcccccEEEeCCceEeeccCCc
Confidence 578999999999999999988543
No 203
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=22.00 E-value=57 Score=24.24 Aligned_cols=12 Identities=8% Similarity=-0.039 Sum_probs=9.9
Q ss_pred CCeEEEEecccc
Q psy15902 9 TQHFQVENFTIS 20 (93)
Q Consensus 9 g~~vTIIDftLS 20 (93)
+.++.||||+.|
T Consensus 160 ~~~v~iIDF~qa 171 (197)
T cd05146 160 DGKVWFIDVSQS 171 (197)
T ss_pred CCcEEEEECCCc
Confidence 568999999955
No 204
>PLN00017 photosystem I reaction centre subunit VI; Provisional
Probab=21.96 E-value=33 Score=23.36 Aligned_cols=14 Identities=36% Similarity=0.681 Sum_probs=11.9
Q ss_pred ccccCCceEEecCC
Q psy15902 21 RCFVGEKICYYDLS 34 (93)
Q Consensus 21 R~~~~~~~~f~dL~ 34 (93)
.++.+++.+|.||.
T Consensus 5 ~AKYGe~SvYFDL~ 18 (90)
T PLN00017 5 SAKYGDKSVYFDLG 18 (90)
T ss_pred ccccCcceeEEEhh
Confidence 46788999999996
No 205
>PF06658 DUF1168: Protein of unknown function (DUF1168); InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=21.95 E-value=66 Score=23.32 Aligned_cols=15 Identities=33% Similarity=0.736 Sum_probs=12.3
Q ss_pred CCchhhHHHHHHHHh
Q psy15902 43 EGDYQFDMYRMMRKQ 57 (93)
Q Consensus 43 ~gD~QfdiYr~MR~~ 57 (93)
-|---|.|||.+|..
T Consensus 33 AGSGeFHvYR~~RRr 47 (142)
T PF06658_consen 33 AGSGEFHVYRASRRR 47 (142)
T ss_pred cCccHHHHHHHHHHH
Confidence 366789999999974
No 206
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=21.72 E-value=97 Score=22.05 Aligned_cols=45 Identities=13% Similarity=0.109 Sum_probs=25.1
Q ss_pred CCeEEEEeccccccccCCceEEecC-------CCCcccccc-CCchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYDL-------SQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~dL-------~~d~~~F~G-~gD~QfdiYr~ 53 (93)
...+.|+||++++........+... -.-|+.+++ .-+..-|||..
T Consensus 145 ~~~~kL~dfg~~~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~sl 197 (279)
T cd05057 145 PQHVKITDFGLAKLLDVDEKEYHAEGGKVPIKWMALESILHRIYTHKSDVWSY 197 (279)
T ss_pred CCeEEECCCcccccccCcccceecCCCcccccccCHHHhhcCCcCchhhHHHH
Confidence 4578999999998755332211100 013665553 33556667663
No 207
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=21.69 E-value=55 Score=23.13 Aligned_cols=16 Identities=0% Similarity=0.071 Sum_probs=12.8
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
...+.|+|||+++...
T Consensus 136 ~~~~kl~dfg~~~~~~ 151 (269)
T cd05042 136 DLSVKIGDYGLALEQY 151 (269)
T ss_pred CCcEEEeccccccccc
Confidence 4578999999998653
No 208
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=21.57 E-value=73 Score=21.66 Aligned_cols=45 Identities=11% Similarity=0.132 Sum_probs=28.4
Q ss_pred CCeEEEEeccccccccCCce------EEec-CCCCccccccC-CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKI------CYYD-LSQDEELFEGE-GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~------~f~d-L~~d~~~F~G~-gD~QfdiYr~ 53 (93)
+.++.|+||+.++....... .... .-..|+.+.+. .+.+.|||..
T Consensus 137 ~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~y~~pE~~~~~~~~~~~Dv~sl 189 (260)
T cd06606 137 DGVVKLADFGCAKRLGDIETGEGTGSVRGTPYWMAPEVIRGEEYGRAADIWSL 189 (260)
T ss_pred CCCEEEcccccEEecccccccccccCCCCCccccCHhhhcCCCCCchhhHHHH
Confidence 57899999999987654321 0000 01147777654 6778888875
No 209
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=21.52 E-value=55 Score=24.61 Aligned_cols=44 Identities=14% Similarity=0.182 Sum_probs=24.8
Q ss_pred CCeEEEEeccccccccCC---ceEEecCCCCccccccC-CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGE---KICYYDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~---~~~f~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
...+.|+|||+++...+. ...-+..-.-||.+.|. -+..-|||-
T Consensus 140 ~~~~kL~Dfg~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dvws 187 (333)
T cd06650 140 RGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWS 187 (333)
T ss_pred CCCEEEeeCCcchhhhhhccccCCCCccccCHHHhcCCCCCcHHHHHH
Confidence 457999999999854321 11111111247777763 345567665
No 210
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=21.51 E-value=1e+02 Score=22.55 Aligned_cols=45 Identities=11% Similarity=0.189 Sum_probs=27.4
Q ss_pred CCeEEEEeccccccccCCc--------eEEecCCCCccccccC--CchhhHHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK--------ICYYDLSQDEELFEGE--GDYQFDMYRM 53 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~--------~~f~dL~~d~~~F~G~--gD~QfdiYr~ 53 (93)
...|.|+|||++....... .+-+..-.-|+.+.+. .+..-|||..
T Consensus 139 ~~~~~L~dfg~~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~sDi~sl 193 (330)
T cd07834 139 NCDLKICDFGLARGVDPDEDEKGFLTEYVVTRWYRAPELLLSSSRYTKAIDIWSV 193 (330)
T ss_pred CCCEEEcccCceEeecccccccccccccccccCcCCceeeecccCCCcchhHHHH
Confidence 4789999999999765432 1111112357777764 3456677764
No 211
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including
Probab=21.47 E-value=56 Score=23.65 Aligned_cols=17 Identities=18% Similarity=0.397 Sum_probs=13.4
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
....+.|+|||+++...
T Consensus 164 ~~~~~kl~dfg~~~~~~ 180 (295)
T cd05097 164 NHYTIKIADFGMSRNLY 180 (295)
T ss_pred CCCcEEecccccccccc
Confidence 34579999999998644
No 212
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=21.27 E-value=60 Score=23.43 Aligned_cols=44 Identities=16% Similarity=0.277 Sum_probs=24.1
Q ss_pred CCeEEEEeccccccccCCceE---E--ecCCCCccccccC-CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKIC---Y--YDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~---f--~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
+..+.|+|||+++.-...... + +..-.-||.+++. -+.+-|||-
T Consensus 133 ~~~~~l~dfg~~~~~~~~~~~~~~~~g~~~y~aPE~~~~~~~~~~~Dvws 182 (280)
T cd05608 133 DGNVRISDLGLAVELKDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFA 182 (280)
T ss_pred CCCEEEeeCccceecCCCCccccccCCCcCccCHHHhcCCCCCccccHHH
Confidence 467999999999753322110 0 0011247777653 345566665
No 213
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=21.08 E-value=62 Score=24.50 Aligned_cols=14 Identities=14% Similarity=0.418 Sum_probs=11.9
Q ss_pred CCeEEEEecccccc
Q psy15902 9 TQHFQVENFTISRC 22 (93)
Q Consensus 9 g~~vTIIDftLSR~ 22 (93)
..+|.|+|||+++.
T Consensus 137 ~~~vkL~DfG~~~~ 150 (360)
T cd05627 137 KGHVKLSDFGLCTG 150 (360)
T ss_pred CCCEEEeeccCCcc
Confidence 46799999999874
No 214
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the
Probab=21.08 E-value=59 Score=24.12 Aligned_cols=17 Identities=12% Similarity=0.374 Sum_probs=13.2
Q ss_pred cCCeEEEEecccccccc
Q psy15902 8 RTQHFQVENFTISRCFV 24 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~ 24 (93)
...++.|+|||+++...
T Consensus 136 ~~~~~kL~Dfg~~~~~~ 152 (350)
T cd05573 136 ADGHIKLADFGLCKKMN 152 (350)
T ss_pred CCCCEEeecCCCCccCc
Confidence 34679999999998543
No 215
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]
Probab=21.06 E-value=49 Score=28.05 Aligned_cols=16 Identities=13% Similarity=0.229 Sum_probs=13.8
Q ss_pred CCeEEEEecccccccc
Q psy15902 9 TQHFQVENFTISRCFV 24 (93)
Q Consensus 9 g~~vTIIDftLSR~~~ 24 (93)
-+.+||||+-|||...
T Consensus 151 ~g~~t~idldlsry~~ 166 (531)
T COG4650 151 AGEVTIIDLDLSRYNA 166 (531)
T ss_pred CCceEEEecchHHHHH
Confidence 4789999999999764
No 216
>PF08222 HTH_CodY: CodY helix-turn-helix domain; InterPro: IPR013198 This family consists of the C-terminal helix-turn-helix domain found in several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins. CodY has been found to repress the dipeptide transport operon (dpp) of Bacillus subtilis in nutrient-rich conditions []. The CodY protein also has a repressor effect on many genes in Lactococcus lactis during growth in milk [].; PDB: 2B0L_C.
Probab=20.97 E-value=42 Score=21.39 Aligned_cols=16 Identities=31% Similarity=0.601 Sum_probs=13.4
Q ss_pred HHhhhhhhhccCCccC
Q psy15902 77 LIESSQLLDVDGLIES 92 (93)
Q Consensus 77 L~~~l~Ll~~kgl~~~ 92 (93)
++..|+.|++.|+++|
T Consensus 21 IVNALRKleSaGvIes 36 (61)
T PF08222_consen 21 IVNALRKLESAGVIES 36 (61)
T ss_dssp HHHHHHHHHHTTSEEE
T ss_pred HHHHHHHHHhcCceee
Confidence 5667899999999986
No 217
>PF09178 DUF1945: Domain of unknown function (DUF1945); InterPro: IPR015261 Members of this entry, which are predominantly found in prokaryotic 4-alpha-glucanotransferase, adopt a structure composed of six antiparallel beta-strands, four of which form a beta-sheet and another two form a type I, beta-hairpin. The role of this family of domains, has not, as yet, been defined []. ; PDB: 1LWH_B 1LWJ_B.
Probab=20.94 E-value=49 Score=20.29 Aligned_cols=16 Identities=38% Similarity=0.619 Sum_probs=12.5
Q ss_pred eEEecCCCCccccccC
Q psy15902 28 ICYYDLSQDEELFEGE 43 (93)
Q Consensus 28 ~~f~dL~~d~~~F~G~ 43 (93)
.+|.+|+.++..|+|.
T Consensus 26 kv~HNlSg~E~vFEGv 41 (51)
T PF09178_consen 26 KVFHNLSGEEVVFEGV 41 (51)
T ss_dssp EEEEE-SSS-EEETTE
T ss_pred EEEEecCCCEEEEEEE
Confidence 5899999999999994
No 218
>PF06688 DUF1187: Protein of unknown function (DUF1187); InterPro: IPR009572 This family consists of several short, hypothetical bacterial proteins of around 62 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi. The function of this family is unknown.
Probab=20.93 E-value=57 Score=20.81 Aligned_cols=16 Identities=19% Similarity=0.156 Sum_probs=13.5
Q ss_pred cCCeEEEEeccccccc
Q psy15902 8 RTQHFQVENFTISRCF 23 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~ 23 (93)
++.+|.+.||.+++..
T Consensus 44 ~~~kV~vedF~C~~v~ 59 (61)
T PF06688_consen 44 FGVKVHVEDFICEEVP 59 (61)
T ss_pred ccceeEEEEEEEEecC
Confidence 6788999999998764
No 219
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=20.89 E-value=51 Score=23.45 Aligned_cols=46 Identities=11% Similarity=0.093 Sum_probs=25.3
Q ss_pred cCCeEEEEeccccccccCCce--EEec----C-CCCcccccc-CCchhhHHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI--CYYD----L-SQDEELFEG-EGDYQFDMYRM 53 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~--~f~d----L-~~d~~~F~G-~gD~QfdiYr~ 53 (93)
.+..+.|+|||+++....... .... + -.-||.+.+ .-+..-|||-.
T Consensus 159 ~~~~~~L~dfg~~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~sDv~sl 212 (283)
T cd05048 159 EGLTVKISDFGLSRDIYSADYYRVQSKSLLPVRWMPPEAILYGKFTTESDIWSF 212 (283)
T ss_pred CCCcEEECCCcceeeccccccccccCCCcccccccCHHHhccCcCchhhhHHHH
Confidence 356799999999986432210 0000 0 013565543 44567788774
No 220
>KOG0666|consensus
Probab=20.57 E-value=56 Score=27.71 Aligned_cols=15 Identities=13% Similarity=0.430 Sum_probs=13.6
Q ss_pred CeEEEEecccccccc
Q psy15902 10 QHFQVENFTISRCFV 24 (93)
Q Consensus 10 ~~vTIIDftLSR~~~ 24 (93)
+.|.|.|+||+|+-.
T Consensus 173 G~VKIaDlGlaR~~~ 187 (438)
T KOG0666|consen 173 GRVKIADLGLARLFN 187 (438)
T ss_pred CeeEeecccHHHHhh
Confidence 789999999999865
No 221
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=20.43 E-value=95 Score=22.38 Aligned_cols=44 Identities=9% Similarity=0.143 Sum_probs=24.4
Q ss_pred CCeEEEEeccccccccCCceEEecC--CCCccccccC-CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEKICYYDL--SQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~~~f~dL--~~d~~~F~G~-gD~QfdiYr 52 (93)
...+.|+||++++...+........ -..|+.+.+. .+.+-|||.
T Consensus 137 ~~~~kl~dfg~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Di~s 183 (290)
T cd05580 137 DGYIKITDFGFAKRVKGRTYTLCGTPEYLAPEIILSKGYGKAVDWWA 183 (290)
T ss_pred CCCEEEeeCCCccccCCCCCCCCCCccccChhhhcCCCCCccccHHH
Confidence 4568999999998765432111110 1246766653 334456555
No 222
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=20.39 E-value=63 Score=24.79 Aligned_cols=14 Identities=14% Similarity=0.430 Sum_probs=11.6
Q ss_pred CCeEEEEecccccc
Q psy15902 9 TQHFQVENFTISRC 22 (93)
Q Consensus 9 g~~vTIIDftLSR~ 22 (93)
...+.|+|||+|+.
T Consensus 137 ~~~~kL~DFGl~~~ 150 (381)
T cd05626 137 DGHIKLTDFGLCTG 150 (381)
T ss_pred CCCEEEeeCcCCcc
Confidence 45799999999864
No 223
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=20.34 E-value=88 Score=28.90 Aligned_cols=15 Identities=0% Similarity=-0.117 Sum_probs=12.5
Q ss_pred CCeEEEEeccccccc
Q psy15902 9 TQHFQVENFTISRCF 23 (93)
Q Consensus 9 g~~vTIIDftLSR~~ 23 (93)
..++.|+|||+++..
T Consensus 149 dg~vKLiDFGLAk~i 163 (932)
T PRK13184 149 FGEVVILDWGAAIFK 163 (932)
T ss_pred CCCEEEEecCcceec
Confidence 457899999999865
No 224
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=20.32 E-value=55 Score=22.94 Aligned_cols=45 Identities=9% Similarity=0.070 Sum_probs=24.2
Q ss_pred cCCeEEEEeccccccccCCce-EEecC-CCCccccccC-CchhhHHHH
Q psy15902 8 RTQHFQVENFTISRCFVGEKI-CYYDL-SQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 8 ~g~~vTIIDftLSR~~~~~~~-~f~dL-~~d~~~F~G~-gD~QfdiYr 52 (93)
....+.|+|||+++....... ..... -.-|+.+++. -+..-|||.
T Consensus 137 ~~~~~kl~dfg~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~Dv~s 184 (256)
T cd05082 137 EDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWS 184 (256)
T ss_pred CCCcEEecCCccceeccccCCCCccceeecCHHHHccCCCCchhhhHH
Confidence 356799999999986543211 10000 1247777653 234455554
No 225
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a
Probab=20.01 E-value=82 Score=21.76 Aligned_cols=44 Identities=9% Similarity=0.121 Sum_probs=26.2
Q ss_pred CCeEEEEeccccccccCCc-----eEEecCCCCccccccC-CchhhHHHH
Q psy15902 9 TQHFQVENFTISRCFVGEK-----ICYYDLSQDEELFEGE-GDYQFDMYR 52 (93)
Q Consensus 9 g~~vTIIDftLSR~~~~~~-----~~f~dL~~d~~~F~G~-gD~QfdiYr 52 (93)
..++.|+||+++....... ...+..-..|+.+.+. -+.+-|||.
T Consensus 135 ~~~~~l~dfg~~~~~~~~~~~~~~~~~~~~y~~PE~~~~~~~~~~~Di~s 184 (256)
T cd06612 135 EGQAKLADFGVSGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNNKADIWS 184 (256)
T ss_pred CCcEEEcccccchhcccCccccccccCCccccCHHHHhcCCCCchhhHHH
Confidence 4578999999988654321 1111122357777764 355677775
Done!