Query         psy15905
Match_columns 60
No_of_seqs    100 out of 147
Neff          4.5 
Searched_HMMs 46136
Date          Sat Aug 17 00:36:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15905.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15905hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2460|consensus               99.6 4.7E-16   1E-20  119.9   0.9   54    1-57    539-593 (593)
  2 PF14804 Jag_N:  Jag N-terminus  80.5    0.46   1E-05   26.5  -0.2   12   48-59     33-44  (52)
  3 cd06399 PB1_P40 The PB1 domain  63.2       3 6.5E-05   26.3   0.4   16   11-26     44-59  (92)
  4 PF15246 NCKAP5:  Nck-associate  61.5     4.3 9.3E-05   30.4   1.1   14   46-59     37-50  (318)
  5 PF09469 Cobl:  Cordon-bleu ubi  48.7     5.8 0.00013   24.4   0.0   15   46-60     61-76  (79)
  6 PF10310 DUF2413:  Protein of u  46.6      16 0.00036   28.1   2.2   11   47-57    123-133 (444)
  7 PF11983 DUF3484:  Domain of un  46.4     3.4 7.4E-05   24.5  -1.2   16   39-54     54-69  (73)
  8 PF15118 DUF4560:  Domain of un  36.5     5.5 0.00012   23.6  -1.4   14    9-22     34-48  (65)
  9 PF15302 P33MONOX:  P33 mono-ox  28.0      55  0.0012   24.4   2.3   13   46-58    172-184 (294)
 10 PF13558 SbcCD_C:  Putative exo  23.8      57  0.0012   19.0   1.5   19    3-21     61-79  (90)
 11 PF13504 LRR_7:  Leucine rich r  23.6      48   0.001   14.1   0.9   10   10-19      5-14  (17)
 12 COG5201 SKP1 SCF ubiquitin lig  23.1      23  0.0005   24.1  -0.4   14   13-26    100-113 (158)
 13 PF03190 Thioredox_DsbH:  Prote  22.1      36 0.00079   22.9   0.4   14    6-19     37-50  (163)
 14 PF00128 Alpha-amylase:  Alpha   22.0      44 0.00096   21.8   0.8   16    9-24     68-83  (316)
 15 PRK09505 malS alpha-amylase; R  21.7      56  0.0012   26.4   1.5   16    9-24    308-323 (683)
 16 COG1993 PII-like signaling pro  21.3      49  0.0011   21.3   0.9   17   43-59     35-53  (109)

No 1  
>KOG2460|consensus
Probab=99.57  E-value=4.7e-16  Score=119.91  Aligned_cols=54  Identities=46%  Similarity=0.800  Sum_probs=41.0

Q ss_pred             CCccCCCceeeeeccccccCCCCcchhhhccCCCCCCCCCCCCCCCCceeeeee-ecC
Q psy15905          1 MQPIPAKPLFFDLAQNQLEFPSLEDKLDVKIKPAAGGGSGQPAGISGFVKGLWG-WGG   57 (60)
Q Consensus         1 ~~pvp~KPiffDlA~Nyi~yP~~~~~~~~~~~~a~~~~~~~~~g~~~~kkGwFG-fGr   57 (60)
                      |+||||||||||||+|||.||.++++.++.++.....   .+.|..+.++||+| ||+
T Consensus       539 ~~PIP~KPlFFDLA~~yl~~p~~edkleq~~k~~~~t---~~~G~~k~~~Gf~~sf~g  593 (593)
T KOG2460|consen  539 FLPIPCKPLFFDLAFNYLTYPKLEDKLEQVKKSGTET---TPTGEPKKKRGFLSSFGG  593 (593)
T ss_pred             cccCCCcchHHHHHHHhhcCCcccchhhhcCCCcccc---CCccccccchhhhhccCC
Confidence            6899999999999999999999999988653322111   23566777888886 553


No 2  
>PF14804 Jag_N:  Jag N-terminus; PDB: 3GKU_B.
Probab=80.46  E-value=0.46  Score=26.52  Aligned_cols=12  Identities=33%  Similarity=0.645  Sum_probs=1.4

Q ss_pred             ceeeeeeecCCC
Q psy15905         48 FVKGLWGWGGAK   59 (60)
Q Consensus        48 ~kkGwFGfGr~~   59 (60)
                      -++|+||||++.
T Consensus        33 g~kGf~G~g~k~   44 (52)
T PF14804_consen   33 GKKGFFGFGKKP   44 (52)
T ss_dssp             -B--------B-
T ss_pred             CCCcEEeeccee
Confidence            378999999763


No 3  
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=63.16  E-value=3  Score=26.30  Aligned_cols=16  Identities=19%  Similarity=-0.066  Sum_probs=13.1

Q ss_pred             eeeccccccCCCCcch
Q psy15905         11 FDLAQNQLEFPSLEDK   26 (60)
Q Consensus        11 fDlA~Nyi~yP~~~~~   26 (60)
                      .|||+||.++-..=-|
T Consensus        44 ~dIaLNYrD~EGDLIR   59 (92)
T cd06399          44 EDIALNYRDAEGDLIR   59 (92)
T ss_pred             hheeeeeecCCCCEEE
Confidence            5999999999876555


No 4  
>PF15246 NCKAP5:  Nck-associated protein 5, Peripheral clock protein
Probab=61.47  E-value=4.3  Score=30.40  Aligned_cols=14  Identities=14%  Similarity=0.344  Sum_probs=11.1

Q ss_pred             CCceeeeeeecCCC
Q psy15905         46 SGFVKGLWGWGGAK   59 (60)
Q Consensus        46 ~~~kkGwFGfGr~~   59 (60)
                      ....-.||||++||
T Consensus        37 gpsiAsWFG~rKSK   50 (318)
T PF15246_consen   37 GPSIASWFGFRKSK   50 (318)
T ss_pred             Ccchhhhhcccccc
Confidence            35577899999986


No 5  
>PF09469 Cobl:  Cordon-bleu ubiquitin-like domain;  InterPro: IPR019025  The Cordon-bleu protein domain is highly conserved among vertebrates. The sequence contains three repeated lysine, arginine, and proline-rich regions, the KKRAP motif. The exact function of the protein is unknown but it is thought to be involved in mid-brain neural tube closure. It is expressed specifically in the node []. ; PDB: 2DAJ_A.
Probab=48.67  E-value=5.8  Score=24.37  Aligned_cols=15  Identities=33%  Similarity=0.441  Sum_probs=0.0

Q ss_pred             CCceeeeee-ecCCCC
Q psy15905         46 SGFVKGLWG-WGGAKK   60 (60)
Q Consensus        46 ~~~kkGwFG-fGr~~~   60 (60)
                      ..-++|+|| |.++|+
T Consensus        61 ekE~Kgflg~F~~sKk   76 (79)
T PF09469_consen   61 EKENKGFLGFFRRSKK   76 (79)
T ss_dssp             ----------------
T ss_pred             chhhcchhhhhhcccc
Confidence            345789999 777764


No 6  
>PF10310 DUF2413:  Protein of unknown function (DUF2413);  InterPro: IPR018814  This entry represents a family of proteins conserved in fungi. Their function is not known. 
Probab=46.58  E-value=16  Score=28.13  Aligned_cols=11  Identities=36%  Similarity=1.129  Sum_probs=8.4

Q ss_pred             CceeeeeeecC
Q psy15905         47 GFVKGLWGWGG   57 (60)
Q Consensus        47 ~~kkGwFGfGr   57 (60)
                      +...||||||.
T Consensus       123 ~s~ggwWsWGs  133 (444)
T PF10310_consen  123 ASSGGWWSWGS  133 (444)
T ss_pred             cccCCcccccc
Confidence            45789998884


No 7  
>PF11983 DUF3484:  Domain of unknown function (DUF3484);  InterPro: IPR021873 FtsA is essential for bacterial cell division, and co-localizes to the septal ring with FtsZ. It has been suggested that the interaction of FtsA-FtsZ has arisen through coevolution in different bacterial strains [].  This C-terminal domain is found in FtsA from Firmicutes (Gram-positive bacteria). It is typically between 65 to 81 amino acids in length. 
Probab=46.37  E-value=3.4  Score=24.49  Aligned_cols=16  Identities=25%  Similarity=0.534  Sum_probs=12.1

Q ss_pred             CCCCCCCCCceeeeee
Q psy15905         39 SGQPAGISGFVKGLWG   54 (60)
Q Consensus        39 ~~~~~g~~~~kkGwFG   54 (60)
                      .++-.+|...+|||||
T Consensus        54 ~e~k~kltdRvR~~fg   69 (73)
T PF11983_consen   54 SEPKEKLTDRVRGFFG   69 (73)
T ss_pred             cccCCcHHHHHHHHHh
Confidence            3445668888999998


No 8  
>PF15118 DUF4560:  Domain of unknown function (DUF4560)
Probab=36.46  E-value=5.5  Score=23.59  Aligned_cols=14  Identities=50%  Similarity=0.861  Sum_probs=9.8

Q ss_pred             eeeeecccc-ccCCC
Q psy15905          9 LFFDLAQNQ-LEFPS   22 (60)
Q Consensus         9 iffDlA~Ny-i~yP~   22 (60)
                      +|||+||-- ++||-
T Consensus        34 ~FFdLAWrLr~nFpy   48 (65)
T PF15118_consen   34 TFFDLAWRLRMNFPY   48 (65)
T ss_pred             HHHHHHHHHHcCCch
Confidence            589999963 46653


No 9  
>PF15302 P33MONOX:  P33 mono-oxygenase
Probab=27.96  E-value=55  Score=24.38  Aligned_cols=13  Identities=15%  Similarity=0.289  Sum_probs=9.4

Q ss_pred             CCceeeeeeecCC
Q psy15905         46 SGFVKGLWGWGGA   58 (60)
Q Consensus        46 ~~~kkGwFGfGr~   58 (60)
                      +...||||.=|.+
T Consensus       172 kq~~RgWF~~gss  184 (294)
T PF15302_consen  172 KQKRRGWFSSGSS  184 (294)
T ss_pred             ccccCcccccCCc
Confidence            4677999976653


No 10 
>PF13558 SbcCD_C:  Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A.
Probab=23.76  E-value=57  Score=19.05  Aligned_cols=19  Identities=26%  Similarity=0.267  Sum_probs=14.8

Q ss_pred             ccCCCceeeeeccccccCC
Q psy15905          3 PIPAKPLFFDLAQNQLEFP   21 (60)
Q Consensus         3 pvp~KPiffDlA~Nyi~yP   21 (60)
                      +..+..||||=||+.++=.
T Consensus        61 ~~~~~~l~lDEaF~~lD~~   79 (90)
T PF13558_consen   61 GDSPRLLFLDEAFSKLDEE   79 (90)
T ss_dssp             -TTBSEEEEESTTTTCGHH
T ss_pred             CCCcCEEEEeCCCCcCCHH
Confidence            4567899999999988743


No 11 
>PF13504 LRR_7:  Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D ....
Probab=23.59  E-value=48  Score=14.08  Aligned_cols=10  Identities=40%  Similarity=0.650  Sum_probs=6.4

Q ss_pred             eeeecccccc
Q psy15905         10 FFDLAQNQLE   19 (60)
Q Consensus        10 ffDlA~Nyi~   19 (60)
                      .+||..|.|.
T Consensus         5 ~L~l~~n~L~   14 (17)
T PF13504_consen    5 TLDLSNNRLT   14 (17)
T ss_dssp             EEEETSS--S
T ss_pred             EEECCCCCCC
Confidence            5899999874


No 12 
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones]
Probab=23.12  E-value=23  Score=24.13  Aligned_cols=14  Identities=50%  Similarity=0.489  Sum_probs=11.0

Q ss_pred             eccccccCCCCcch
Q psy15905         13 LAQNQLEFPSLEDK   26 (60)
Q Consensus        13 lA~Nyi~yP~~~~~   26 (60)
                      +|.||++||-|-+.
T Consensus       100 laaNYL~ikpLLd~  113 (158)
T COG5201         100 LAANYLEIKPLLDL  113 (158)
T ss_pred             HhhccccchHHHHH
Confidence            58999999987543


No 13 
>PF03190 Thioredox_DsbH:  Protein of unknown function, DUF255;  InterPro: IPR004879 This is a group of uncharacterised proteins.; PDB: 3IRA_A.
Probab=22.13  E-value=36  Score=22.93  Aligned_cols=14  Identities=21%  Similarity=0.513  Sum_probs=7.6

Q ss_pred             CCceeeeecccccc
Q psy15905          6 AKPLFFDLAQNQLE   19 (60)
Q Consensus         6 ~KPiffDlA~Nyi~   19 (60)
                      -||||+||.++...
T Consensus        37 ~KpIfl~ig~~~C~   50 (163)
T PF03190_consen   37 NKPIFLSIGYSWCH   50 (163)
T ss_dssp             T--EEEEEE-TT-H
T ss_pred             CCcEEEEEEecCCc
Confidence            38999999876554


No 14 
>PF00128 Alpha-amylase:  Alpha amylase, catalytic domain;  InterPro: IPR006047 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  Enzymes containing this domain, such as alpha-amylase, belong to family 13 (GH13 from CAZY) of the glycosyl hydrolases. The maltogenic alpha-amylase is an enzyme which catalyses hydrolysis of (1-4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive alpha-maltose residues from the non-reducing ends of the chains in the conversion of starch to maltose. Other enzymes include neopullulanase, which hydrolyses pullulan to panose, and cyclomaltodextrinase, which hydrolyses cyclodextrins. This entry represents the catalytic domain found in several protein members of this family. It has a structure consisting of an 8 stranded alpha/beta barrel that contains the active site, interrupted by a ~70 amino acid calcium-binding domain protruding between beta strand 3 and alpha helix 3, and a carboxyl-terminal Greek key beta-barrel domain []. More information about this protein can be found at Protein of the Month: alpha-Amylase [].; GO: 0003824 catalytic activity, 0043169 cation binding, 0005975 carbohydrate metabolic process; PDB: 3FAX_A 3FAW_A 2DH3_B 2DH2_A 1CIU_A 1A47_A 3BMW_A 3BMV_A 2FH8_A 2FH6_A ....
Probab=21.96  E-value=44  Score=21.78  Aligned_cols=16  Identities=13%  Similarity=0.067  Sum_probs=12.8

Q ss_pred             eeeeeccccccCCCCc
Q psy15905          9 LFFDLAQNQLEFPSLE   24 (60)
Q Consensus         9 iffDlA~Nyi~yP~~~   24 (60)
                      |++|+..||...-+.-
T Consensus        68 VilD~V~NH~~~~~~~   83 (316)
T PF00128_consen   68 VILDVVPNHTSDDHPW   83 (316)
T ss_dssp             EEEEEETSEEETTSHH
T ss_pred             EEEeeecccccccccc
Confidence            6899999998776643


No 15 
>PRK09505 malS alpha-amylase; Reviewed
Probab=21.74  E-value=56  Score=26.40  Aligned_cols=16  Identities=25%  Similarity=0.650  Sum_probs=13.7

Q ss_pred             eeeeeccccccCCCCc
Q psy15905          9 LFFDLAQNQLEFPSLE   24 (60)
Q Consensus         9 iffDlA~Nyi~yP~~~   24 (60)
                      |++|+.+||..|..+.
T Consensus       308 VilD~V~NH~~~~~~~  323 (683)
T PRK09505        308 ILFDVVMNHTGYATLA  323 (683)
T ss_pred             EEEEECcCCCcccccc
Confidence            7899999999997653


No 16 
>COG1993 PII-like signaling protein [Signal transduction mechanisms]
Probab=21.34  E-value=49  Score=21.34  Aligned_cols=17  Identities=35%  Similarity=0.771  Sum_probs=12.2

Q ss_pred             CCCCCc--eeeeeeecCCC
Q psy15905         43 AGISGF--VKGLWGWGGAK   59 (60)
Q Consensus        43 ~g~~~~--kkGwFGfGr~~   59 (60)
                      .||.|.  .+|..|||+++
T Consensus        35 ~Gi~GATVlRGI~GfG~~~   53 (109)
T COG1993          35 EGIRGATVLRGIAGFGKDG   53 (109)
T ss_pred             cCcCceeeeeeeeccCCCC
Confidence            344444  68999999876


Done!