Query psy15905
Match_columns 60
No_of_seqs 100 out of 147
Neff 4.5
Searched_HMMs 46136
Date Sat Aug 17 00:36:46 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy15905.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15905hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG2460|consensus 99.6 4.7E-16 1E-20 119.9 0.9 54 1-57 539-593 (593)
2 PF14804 Jag_N: Jag N-terminus 80.5 0.46 1E-05 26.5 -0.2 12 48-59 33-44 (52)
3 cd06399 PB1_P40 The PB1 domain 63.2 3 6.5E-05 26.3 0.4 16 11-26 44-59 (92)
4 PF15246 NCKAP5: Nck-associate 61.5 4.3 9.3E-05 30.4 1.1 14 46-59 37-50 (318)
5 PF09469 Cobl: Cordon-bleu ubi 48.7 5.8 0.00013 24.4 0.0 15 46-60 61-76 (79)
6 PF10310 DUF2413: Protein of u 46.6 16 0.00036 28.1 2.2 11 47-57 123-133 (444)
7 PF11983 DUF3484: Domain of un 46.4 3.4 7.4E-05 24.5 -1.2 16 39-54 54-69 (73)
8 PF15118 DUF4560: Domain of un 36.5 5.5 0.00012 23.6 -1.4 14 9-22 34-48 (65)
9 PF15302 P33MONOX: P33 mono-ox 28.0 55 0.0012 24.4 2.3 13 46-58 172-184 (294)
10 PF13558 SbcCD_C: Putative exo 23.8 57 0.0012 19.0 1.5 19 3-21 61-79 (90)
11 PF13504 LRR_7: Leucine rich r 23.6 48 0.001 14.1 0.9 10 10-19 5-14 (17)
12 COG5201 SKP1 SCF ubiquitin lig 23.1 23 0.0005 24.1 -0.4 14 13-26 100-113 (158)
13 PF03190 Thioredox_DsbH: Prote 22.1 36 0.00079 22.9 0.4 14 6-19 37-50 (163)
14 PF00128 Alpha-amylase: Alpha 22.0 44 0.00096 21.8 0.8 16 9-24 68-83 (316)
15 PRK09505 malS alpha-amylase; R 21.7 56 0.0012 26.4 1.5 16 9-24 308-323 (683)
16 COG1993 PII-like signaling pro 21.3 49 0.0011 21.3 0.9 17 43-59 35-53 (109)
No 1
>KOG2460|consensus
Probab=99.57 E-value=4.7e-16 Score=119.91 Aligned_cols=54 Identities=46% Similarity=0.800 Sum_probs=41.0
Q ss_pred CCccCCCceeeeeccccccCCCCcchhhhccCCCCCCCCCCCCCCCCceeeeee-ecC
Q psy15905 1 MQPIPAKPLFFDLAQNQLEFPSLEDKLDVKIKPAAGGGSGQPAGISGFVKGLWG-WGG 57 (60)
Q Consensus 1 ~~pvp~KPiffDlA~Nyi~yP~~~~~~~~~~~~a~~~~~~~~~g~~~~kkGwFG-fGr 57 (60)
|+||||||||||||+|||.||.++++.++.++..... .+.|..+.++||+| ||+
T Consensus 539 ~~PIP~KPlFFDLA~~yl~~p~~edkleq~~k~~~~t---~~~G~~k~~~Gf~~sf~g 593 (593)
T KOG2460|consen 539 FLPIPCKPLFFDLAFNYLTYPKLEDKLEQVKKSGTET---TPTGEPKKKRGFLSSFGG 593 (593)
T ss_pred cccCCCcchHHHHHHHhhcCCcccchhhhcCCCcccc---CCccccccchhhhhccCC
Confidence 6899999999999999999999999988653322111 23566777888886 553
No 2
>PF14804 Jag_N: Jag N-terminus; PDB: 3GKU_B.
Probab=80.46 E-value=0.46 Score=26.52 Aligned_cols=12 Identities=33% Similarity=0.645 Sum_probs=1.4
Q ss_pred ceeeeeeecCCC
Q psy15905 48 FVKGLWGWGGAK 59 (60)
Q Consensus 48 ~kkGwFGfGr~~ 59 (60)
-++|+||||++.
T Consensus 33 g~kGf~G~g~k~ 44 (52)
T PF14804_consen 33 GKKGFFGFGKKP 44 (52)
T ss_dssp -B--------B-
T ss_pred CCCcEEeeccee
Confidence 378999999763
No 3
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=63.16 E-value=3 Score=26.30 Aligned_cols=16 Identities=19% Similarity=-0.066 Sum_probs=13.1
Q ss_pred eeeccccccCCCCcch
Q psy15905 11 FDLAQNQLEFPSLEDK 26 (60)
Q Consensus 11 fDlA~Nyi~yP~~~~~ 26 (60)
.|||+||.++-..=-|
T Consensus 44 ~dIaLNYrD~EGDLIR 59 (92)
T cd06399 44 EDIALNYRDAEGDLIR 59 (92)
T ss_pred hheeeeeecCCCCEEE
Confidence 5999999999876555
No 4
>PF15246 NCKAP5: Nck-associated protein 5, Peripheral clock protein
Probab=61.47 E-value=4.3 Score=30.40 Aligned_cols=14 Identities=14% Similarity=0.344 Sum_probs=11.1
Q ss_pred CCceeeeeeecCCC
Q psy15905 46 SGFVKGLWGWGGAK 59 (60)
Q Consensus 46 ~~~kkGwFGfGr~~ 59 (60)
....-.||||++||
T Consensus 37 gpsiAsWFG~rKSK 50 (318)
T PF15246_consen 37 GPSIASWFGFRKSK 50 (318)
T ss_pred Ccchhhhhcccccc
Confidence 35577899999986
No 5
>PF09469 Cobl: Cordon-bleu ubiquitin-like domain; InterPro: IPR019025 The Cordon-bleu protein domain is highly conserved among vertebrates. The sequence contains three repeated lysine, arginine, and proline-rich regions, the KKRAP motif. The exact function of the protein is unknown but it is thought to be involved in mid-brain neural tube closure. It is expressed specifically in the node []. ; PDB: 2DAJ_A.
Probab=48.67 E-value=5.8 Score=24.37 Aligned_cols=15 Identities=33% Similarity=0.441 Sum_probs=0.0
Q ss_pred CCceeeeee-ecCCCC
Q psy15905 46 SGFVKGLWG-WGGAKK 60 (60)
Q Consensus 46 ~~~kkGwFG-fGr~~~ 60 (60)
..-++|+|| |.++|+
T Consensus 61 ekE~Kgflg~F~~sKk 76 (79)
T PF09469_consen 61 EKENKGFLGFFRRSKK 76 (79)
T ss_dssp ----------------
T ss_pred chhhcchhhhhhcccc
Confidence 345789999 777764
No 6
>PF10310 DUF2413: Protein of unknown function (DUF2413); InterPro: IPR018814 This entry represents a family of proteins conserved in fungi. Their function is not known.
Probab=46.58 E-value=16 Score=28.13 Aligned_cols=11 Identities=36% Similarity=1.129 Sum_probs=8.4
Q ss_pred CceeeeeeecC
Q psy15905 47 GFVKGLWGWGG 57 (60)
Q Consensus 47 ~~kkGwFGfGr 57 (60)
+...||||||.
T Consensus 123 ~s~ggwWsWGs 133 (444)
T PF10310_consen 123 ASSGGWWSWGS 133 (444)
T ss_pred cccCCcccccc
Confidence 45789998884
No 7
>PF11983 DUF3484: Domain of unknown function (DUF3484); InterPro: IPR021873 FtsA is essential for bacterial cell division, and co-localizes to the septal ring with FtsZ. It has been suggested that the interaction of FtsA-FtsZ has arisen through coevolution in different bacterial strains []. This C-terminal domain is found in FtsA from Firmicutes (Gram-positive bacteria). It is typically between 65 to 81 amino acids in length.
Probab=46.37 E-value=3.4 Score=24.49 Aligned_cols=16 Identities=25% Similarity=0.534 Sum_probs=12.1
Q ss_pred CCCCCCCCCceeeeee
Q psy15905 39 SGQPAGISGFVKGLWG 54 (60)
Q Consensus 39 ~~~~~g~~~~kkGwFG 54 (60)
.++-.+|...+|||||
T Consensus 54 ~e~k~kltdRvR~~fg 69 (73)
T PF11983_consen 54 SEPKEKLTDRVRGFFG 69 (73)
T ss_pred cccCCcHHHHHHHHHh
Confidence 3445668888999998
No 8
>PF15118 DUF4560: Domain of unknown function (DUF4560)
Probab=36.46 E-value=5.5 Score=23.59 Aligned_cols=14 Identities=50% Similarity=0.861 Sum_probs=9.8
Q ss_pred eeeeecccc-ccCCC
Q psy15905 9 LFFDLAQNQ-LEFPS 22 (60)
Q Consensus 9 iffDlA~Ny-i~yP~ 22 (60)
+|||+||-- ++||-
T Consensus 34 ~FFdLAWrLr~nFpy 48 (65)
T PF15118_consen 34 TFFDLAWRLRMNFPY 48 (65)
T ss_pred HHHHHHHHHHcCCch
Confidence 589999963 46653
No 9
>PF15302 P33MONOX: P33 mono-oxygenase
Probab=27.96 E-value=55 Score=24.38 Aligned_cols=13 Identities=15% Similarity=0.289 Sum_probs=9.4
Q ss_pred CCceeeeeeecCC
Q psy15905 46 SGFVKGLWGWGGA 58 (60)
Q Consensus 46 ~~~kkGwFGfGr~ 58 (60)
+...||||.=|.+
T Consensus 172 kq~~RgWF~~gss 184 (294)
T PF15302_consen 172 KQKRRGWFSSGSS 184 (294)
T ss_pred ccccCcccccCCc
Confidence 4677999976653
No 10
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A.
Probab=23.76 E-value=57 Score=19.05 Aligned_cols=19 Identities=26% Similarity=0.267 Sum_probs=14.8
Q ss_pred ccCCCceeeeeccccccCC
Q psy15905 3 PIPAKPLFFDLAQNQLEFP 21 (60)
Q Consensus 3 pvp~KPiffDlA~Nyi~yP 21 (60)
+..+..||||=||+.++=.
T Consensus 61 ~~~~~~l~lDEaF~~lD~~ 79 (90)
T PF13558_consen 61 GDSPRLLFLDEAFSKLDEE 79 (90)
T ss_dssp -TTBSEEEEESTTTTCGHH
T ss_pred CCCcCEEEEeCCCCcCCHH
Confidence 4567899999999988743
No 11
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D ....
Probab=23.59 E-value=48 Score=14.08 Aligned_cols=10 Identities=40% Similarity=0.650 Sum_probs=6.4
Q ss_pred eeeecccccc
Q psy15905 10 FFDLAQNQLE 19 (60)
Q Consensus 10 ffDlA~Nyi~ 19 (60)
.+||..|.|.
T Consensus 5 ~L~l~~n~L~ 14 (17)
T PF13504_consen 5 TLDLSNNRLT 14 (17)
T ss_dssp EEEETSS--S
T ss_pred EEECCCCCCC
Confidence 5899999874
No 12
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones]
Probab=23.12 E-value=23 Score=24.13 Aligned_cols=14 Identities=50% Similarity=0.489 Sum_probs=11.0
Q ss_pred eccccccCCCCcch
Q psy15905 13 LAQNQLEFPSLEDK 26 (60)
Q Consensus 13 lA~Nyi~yP~~~~~ 26 (60)
+|.||++||-|-+.
T Consensus 100 laaNYL~ikpLLd~ 113 (158)
T COG5201 100 LAANYLEIKPLLDL 113 (158)
T ss_pred HhhccccchHHHHH
Confidence 58999999987543
No 13
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins.; PDB: 3IRA_A.
Probab=22.13 E-value=36 Score=22.93 Aligned_cols=14 Identities=21% Similarity=0.513 Sum_probs=7.6
Q ss_pred CCceeeeecccccc
Q psy15905 6 AKPLFFDLAQNQLE 19 (60)
Q Consensus 6 ~KPiffDlA~Nyi~ 19 (60)
-||||+||.++...
T Consensus 37 ~KpIfl~ig~~~C~ 50 (163)
T PF03190_consen 37 NKPIFLSIGYSWCH 50 (163)
T ss_dssp T--EEEEEE-TT-H
T ss_pred CCcEEEEEEecCCc
Confidence 38999999876554
No 14
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Enzymes containing this domain, such as alpha-amylase, belong to family 13 (GH13 from CAZY) of the glycosyl hydrolases. The maltogenic alpha-amylase is an enzyme which catalyses hydrolysis of (1-4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive alpha-maltose residues from the non-reducing ends of the chains in the conversion of starch to maltose. Other enzymes include neopullulanase, which hydrolyses pullulan to panose, and cyclomaltodextrinase, which hydrolyses cyclodextrins. This entry represents the catalytic domain found in several protein members of this family. It has a structure consisting of an 8 stranded alpha/beta barrel that contains the active site, interrupted by a ~70 amino acid calcium-binding domain protruding between beta strand 3 and alpha helix 3, and a carboxyl-terminal Greek key beta-barrel domain []. More information about this protein can be found at Protein of the Month: alpha-Amylase [].; GO: 0003824 catalytic activity, 0043169 cation binding, 0005975 carbohydrate metabolic process; PDB: 3FAX_A 3FAW_A 2DH3_B 2DH2_A 1CIU_A 1A47_A 3BMW_A 3BMV_A 2FH8_A 2FH6_A ....
Probab=21.96 E-value=44 Score=21.78 Aligned_cols=16 Identities=13% Similarity=0.067 Sum_probs=12.8
Q ss_pred eeeeeccccccCCCCc
Q psy15905 9 LFFDLAQNQLEFPSLE 24 (60)
Q Consensus 9 iffDlA~Nyi~yP~~~ 24 (60)
|++|+..||...-+.-
T Consensus 68 VilD~V~NH~~~~~~~ 83 (316)
T PF00128_consen 68 VILDVVPNHTSDDHPW 83 (316)
T ss_dssp EEEEEETSEEETTSHH
T ss_pred EEEeeecccccccccc
Confidence 6899999998776643
No 15
>PRK09505 malS alpha-amylase; Reviewed
Probab=21.74 E-value=56 Score=26.40 Aligned_cols=16 Identities=25% Similarity=0.650 Sum_probs=13.7
Q ss_pred eeeeeccccccCCCCc
Q psy15905 9 LFFDLAQNQLEFPSLE 24 (60)
Q Consensus 9 iffDlA~Nyi~yP~~~ 24 (60)
|++|+.+||..|..+.
T Consensus 308 VilD~V~NH~~~~~~~ 323 (683)
T PRK09505 308 ILFDVVMNHTGYATLA 323 (683)
T ss_pred EEEEECcCCCcccccc
Confidence 7899999999997653
No 16
>COG1993 PII-like signaling protein [Signal transduction mechanisms]
Probab=21.34 E-value=49 Score=21.34 Aligned_cols=17 Identities=35% Similarity=0.771 Sum_probs=12.2
Q ss_pred CCCCCc--eeeeeeecCCC
Q psy15905 43 AGISGF--VKGLWGWGGAK 59 (60)
Q Consensus 43 ~g~~~~--kkGwFGfGr~~ 59 (60)
.||.|. .+|..|||+++
T Consensus 35 ~Gi~GATVlRGI~GfG~~~ 53 (109)
T COG1993 35 EGIRGATVLRGIAGFGKDG 53 (109)
T ss_pred cCcCceeeeeeeeccCCCC
Confidence 344444 68999999876
Done!