Diaphorina citri psyllid: psy15907

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260

MPRLVRIKTLVVKTIGVITTVVGGLAGGKEGPMIHSGAIVAAGISQGKSTSFGTDFQIFKYFREDHEKRDFVSGGAAAGVAAAFGAPVGGVLFSLEEGASFWNQSLTWRIFFGTIVTTFTLNVVLSAYYGHPGELTNSGLLNFGKFYDLRYDLLEMFFYVGAGVFGGLTGALYNSLNHKLTVFRIRYMSARYVKVLEAVLVAMVSACVPIIMIYSIDDCRPLGEDPTEHAVQMYCGDGEYNTLAALWLQVPEKSVRTMLL

ccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccHHHHcccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHccccHHHHHHHcc

*PRLVRIKTLVVKTIGVITTVVGGLAGGKEGPMIHSGAIVAAGISQGKSTSFGTDFQIFKYFREDHEKRDFVSGGAAAGVAAAFGAPVGGVLFSLEEGASFWNQSLTWRIFFGTIVTTFTLNVVLSAYYGHPGELTNSGLLNFGKFYDLRYDLLEMFFYVGAGVFGGLTGALYNSLNHKLTVFRIRYMSARYVKVLEAVLVAMVSACVPIIMIYSIDDCRPLGEDPTEHAVQMYCGDGEYNTLAALWLQVPEKSVRTMLL

xxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
H(+)/Cl(-) exchange transporter 7	Mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to the acidification of the lysosome lumen.	confident	O70496
H(+)/Cl(-) exchange transporter 7	Mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to the acidification of the lysosome lumen.	confident	P51798
H(+)/Cl(-) exchange transporter 7	Mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to the acidification of the lysosome lumen.	confident	P51799

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005622 [CC]	intracellular	probable	GO:0005575, GO:0044464, GO:0005623
GO:0008150 [BP]	biological_process	probable

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OTS, chain A
Confidence level:very confident
Coverage over the Query: 4-47,59-229
View the alignment between query and template
View the model in PyMOL