Diaphorina citri psyllid: psy15911

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MEGKYLNHKGRNRRFTNPEELETARVREEKEKQWRAKAKGVEKLIDVENPNRVVKKNKKLSTLNEVVKGPTTAPELSRREREEIEAQKATAHYQKLHAEGKTEQARADLAQKDEAAQLKSAQTSKALGKKT
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
**********************************************VEN************************************************************A*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGKYLNHKGRNRRFTNPEELETARVREEKEKQWRAKAKGVEKLIDVENPNRVVKKNKKLSTLNEVVKGPTTAPELSRxxxxxxxxxxxxxxxxxxxxxGKTEQARADLAQKDEAAQLKSAQTSKALGKKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
28 kDa heat- and acid-stable phosphoprotein confidentQ3UHX2
28 kDa heat- and acid-stable phosphoprotein confidentQ62785
28 kDa heat- and acid-stable phosphoprotein Enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.confidentQ13442

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted