BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15915
         (99 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XI4|A Chain A, Clathrin D6 Coat
 pdb|1XI4|B Chain B, Clathrin D6 Coat
 pdb|1XI4|C Chain C, Clathrin D6 Coat
 pdb|1XI4|D Chain D, Clathrin D6 Coat
 pdb|1XI4|E Chain E, Clathrin D6 Coat
 pdb|1XI4|F Chain F, Clathrin D6 Coat
 pdb|1XI4|G Chain G, Clathrin D6 Coat
 pdb|1XI4|H Chain H, Clathrin D6 Coat
 pdb|1XI4|I Chain I, Clathrin D6 Coat
 pdb|1XI5|A Chain A, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|B Chain B, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|C Chain C, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|D Chain D, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|E Chain E, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|F Chain F, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|G Chain G, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|H Chain H, Clathrin D6 Coat With Auxilin J-Domain
 pdb|1XI5|I Chain I, Clathrin D6 Coat With Auxilin J-Domain
 pdb|3IYV|A Chain A, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|B Chain B, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|C Chain C, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|D Chain D, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|E Chain E, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|F Chain F, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|G Chain G, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|H Chain H, Clathrin D6 Coat As Full-Length Triskelions
 pdb|3IYV|I Chain I, Clathrin D6 Coat As Full-Length Triskelions
          Length = 1630

 Score = 92.4 bits (228), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/54 (75%), Positives = 50/54 (92%)

Query: 34  QIATKYHEQLTTKALIDLFESFKSYEGLFYFLGSIVNYSQDQEVHFKYIQVQGK 87
           Q+A+KYHEQL+T++LI+LFESFKS+EGLFYFLGSIVN+SQD +VHFKYIQ   K
Sbjct: 684 QVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACK 737


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.137    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,892,081
Number of Sequences: 62578
Number of extensions: 100569
Number of successful extensions: 226
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 221
Number of HSP's gapped (non-prelim): 5
length of query: 99
length of database: 14,973,337
effective HSP length: 65
effective length of query: 34
effective length of database: 10,905,767
effective search space: 370796078
effective search space used: 370796078
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)