Query         psy15933
Match_columns 59
No_of_seqs    33 out of 35
Neff          2.3 
Searched_HMMs 46136
Date          Fri Aug 16 16:49:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15933.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15933hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07466 DUF1517:  Protein of u  57.7     4.8  0.0001   29.5   0.8   23   26-51    264-286 (289)
  2 cd01797 NIRF_N amino-terminal   42.6     5.9 0.00013   23.3  -0.6   16   35-50     48-63  (78)
  3 PF05182 Fip1:  Fip1 motif;  In  35.4      12 0.00027   21.4  -0.0   10   17-26     19-28  (45)
  4 PF00062 Lys:  C-type lysozyme/  32.8      11 0.00025   24.9  -0.5   13   19-31     48-60  (125)
  5 cd01798 parkin_N amino-termina  29.9      14 0.00031   20.4  -0.4   16   35-50     44-59  (70)
  6 PF10790 DUF2604:  Protein of U  25.7      56  0.0012   20.8   1.8   49    4-54     12-64  (76)
  7 cd01792 ISG15_repeat1 ISG15 ub  25.6      20 0.00044   20.6  -0.2   17   35-51     50-66  (80)
  8 cd01803 Ubiquitin Ubiquitin. U  24.2      28  0.0006   18.9   0.2   17   35-51     46-62  (76)
  9 cd01806 Nedd8 Nebb8-like  ubiq  23.3      29 0.00063   18.8   0.1   17   35-51     46-62  (76)
 10 cd01809 Scythe_N Ubiquitin-lik  22.6      30 0.00065   18.5   0.1   17   35-51     46-62  (72)
 11 PTZ00044 ubiquitin; Provisiona  20.5      39 0.00085   18.6   0.3   17   35-51     46-62  (76)
 12 cd01802 AN1_N ubiquitin-like d  20.4      36 0.00078   21.1   0.1   17   35-51     73-89  (103)

No 1  
>PF07466 DUF1517:  Protein of unknown function (DUF1517);  InterPro: IPR010903 This family consists of several hypothetical glycine rich plant and bacterial proteins of around 300 residues in length. The function of this family is unknown.
Probab=57.73  E-value=4.8  Score=29.53  Aligned_cols=23  Identities=43%  Similarity=0.687  Sum_probs=18.9

Q ss_pred             eecCCCCCCCCCccchhcccCCCCCC
Q psy15933         26 LFYPPANGKAGKFLDEERRLGDYPFN   51 (59)
Q Consensus        26 Lf~Pp~~Gr~GKFLdEERlLreYP~~   51 (59)
                      |+.|...   |-.|.||.+|.+||.=
T Consensus       264 lWtP~~~---gd~Ls~~ell~~yP~L  286 (289)
T PF07466_consen  264 LWTPQAE---GDTLSEDELLADYPDL  286 (289)
T ss_pred             EECCCCC---CCccCHHHHHHhCccc
Confidence            6777764   5699999999999963


No 2  
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of  Np95 and NIRF. NIRF_N    This CD represents the amino-terminal ubiquitin-like domain of a family of nuclear proteins that includes Np95 and NIRF (Np95/ICBP90-like RING finger) protein.  Both Np95 and NIRF have a domain architecture consisting of a ubiquitin-like domain, a PHD finger, a YDG/SRA domain, Rb-binding motifs and a RING finger domain. Both Np95 and NIRF are ubiquitin ligases that ubiquitinate PCNP (PEST-containing nuclear proteins). While Np95 is capable of binding histones, NIRF is involved in cell cycle regulation.
Probab=42.58  E-value=5.9  Score=23.27  Aligned_cols=16  Identities=31%  Similarity=0.520  Sum_probs=14.5

Q ss_pred             CCCccchhcccCCCCC
Q psy15933         35 AGKFLDEERRLGDYPF   50 (59)
Q Consensus        35 ~GKFLdEERlLreYP~   50 (59)
                      .||.|+++++|.+|-.
T Consensus        48 ~Gk~L~D~~tL~~y~i   63 (78)
T cd01797          48 RGKQMEDGHTLFDYNV   63 (78)
T ss_pred             CCEECCCCCCHHHcCC
Confidence            5899999999999975


No 3  
>PF05182 Fip1:  Fip1 motif;  InterPro: IPR007854 This short motif is about 40 amino acids in length and is found in the Fip1 protein that is a component of a Saccharomyces cerevisiae pre-mRNA polyadenylation factor that directly interacts with poly(A) polymerase []. This region of Fip1 is needed for the interaction with the Yth1 subunit of the complex and for specific polyadenylation of the cleaved mRNA precursor [].
Probab=35.39  E-value=12  Score=21.36  Aligned_cols=10  Identities=40%  Similarity=0.989  Sum_probs=8.2

Q ss_pred             hcccccccee
Q psy15933         17 EFKEGFNYGL   26 (59)
Q Consensus        17 ~L~d~lNYGL   26 (59)
                      .+.|.+|||+
T Consensus        19 DisDyFNYGf   28 (45)
T PF05182_consen   19 DISDYFNYGF   28 (45)
T ss_pred             ChhhhcCCCC
Confidence            4678999997


No 4  
>PF00062 Lys:  C-type lysozyme/alpha-lactalbumin family;  InterPro: IPR001916 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 22 GH22 from CAZY comprises enzymes with two known activities; lysozyme type C (3.2.1.17 from EC) and alpha-lactalbumins. Asp and/or the carbonyl oxygen of the C-2 acetamido group of the substrate acts as the catalytic nucleophile/base.   Alpha-lactalbumin [, ] is a milk protein that acts as the regulatory subunit of lactose synthetase, acting to promote the conversion of galactosyltransferase to lactose synthase, which is essential for milk production. In the mammary gland, alpha-lactalbumin changes the substrate specificity of galactosyltransferase from N-acetylglucosamine to glucose.  Lysozymes (3.2.1.17 from EC) act as bacteriolytic enzymes by hydrolyzing the beta(1->4) bonds between N-acetylglucosamine and N-acetylmuramic acid in the peptidoglycan of prokaryotic cell walls. It has also been recruited for a digestive role in certain ruminants and colobine monkeys []. There are at least five different classes of lysozymes []: C (chicken type), G (goose type), phage-type (T4), fungi (Chalaropsis), and bacterial (Bacillus subtilis). There are few similarities in the sequences of the different types of lysozymes. Lysozyme type C and alpha-lactalbumin are similar both in terms of primary sequence and structure, and probably evolved from a common ancestral protein []. Around 35 to 40% of the residues are conserved in both proteins as well as the positions of the four disulphide bonds. There is, however, no similarity in function. Another significant difference between the two enzymes is that all lactalbumins have the ability to bind calcium [], while this property is restricted to only a few lysozymes [].  The binding site was deduced using high resolution X-ray structure analysis and was shown to consist of three aspartic acid residues. It was first suggested that calcium bound to lactalbumin stabilised the structure, but recently it has been claimed that calcium controls the release of lactalbumin from the golgi membrane and that the pattern of ion binding may also affect the catalytic properties of the lactose synthetase complex.; PDB: 1HFX_A 1HMK_A 1HFY_B 1FKQ_A 1FKV_A 3B0K_B 1HML_A 1B9O_A 1A4V_A 3B0O_A ....
Probab=32.84  E-value=11  Score=24.86  Aligned_cols=13  Identities=23%  Similarity=0.519  Sum_probs=10.1

Q ss_pred             cccccceeecCCC
Q psy15933         19 KEGFNYGLFYPPA   31 (59)
Q Consensus        19 ~d~lNYGLf~Pp~   31 (59)
                      ..+-+|||||=.+
T Consensus        48 ~gS~dyGIFQIns   60 (125)
T PF00062_consen   48 DGSTDYGIFQINS   60 (125)
T ss_dssp             TSEEEETTTTEET
T ss_pred             CCccccceeecCc
Confidence            6688999999543


No 5  
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein. parkin_N  parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.  Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of  26S proteasomes through its Ubl domain.
Probab=29.87  E-value=14  Score=20.43  Aligned_cols=16  Identities=25%  Similarity=0.370  Sum_probs=14.1

Q ss_pred             CCCccchhcccCCCCC
Q psy15933         35 AGKFLDEERRLGDYPF   50 (59)
Q Consensus        35 ~GKFLdEERlLreYP~   50 (59)
                      +||.|+.++.|.+|-.
T Consensus        44 ~G~~L~d~~~l~~~~i   59 (70)
T cd01798          44 AGKELRNTTTIQECDL   59 (70)
T ss_pred             CCeECCCCCcHHHcCC
Confidence            5888999999999975


No 6  
>PF10790 DUF2604:  Protein of Unknown function (DUF2604);  InterPro: IPR019726  This entry represents bacterial proteins with undetermined function. 
Probab=25.74  E-value=56  Score=20.84  Aligned_cols=49  Identities=29%  Similarity=0.531  Sum_probs=40.3

Q ss_pred             ccccchhhhhhhhhccccccceeecCCCC----CCCCCccchhcccCCCCCCCCc
Q psy15933          4 TNFNATFKTYWFTEFKEGFNYGLFYPPAN----GKAGKFLDEERRLGDYPFNGPV   54 (59)
Q Consensus         4 ~~~~~~~~~~~~~~L~d~lNYGLf~Pp~~----Gr~GKFLdEERlLreYP~~~~v   54 (59)
                      .|-||...+.....|....|-|  ||+.|    -.+|.-||-.|-+.||-+..+|
T Consensus        12 ANvnaPLh~v~akALe~sgNvg--QP~ENWElkDe~G~vlD~~kKveD~Gftngv   64 (76)
T PF10790_consen   12 ANVNAPLHPVRAKALEQSGNVG--QPPENWELKDESGQVLDVNKKVEDFGFTNGV   64 (76)
T ss_pred             cCCCCcchHHHHHHHhhccccC--CCcccceeeccCCcEeeccchhhhccccccc
Confidence            4678888888889999999987  88876    3578899999999999886554


No 7  
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains that becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=25.61  E-value=20  Score=20.56  Aligned_cols=17  Identities=12%  Similarity=0.112  Sum_probs=14.5

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||.|+.++.|.||-..
T Consensus        50 ~G~~L~D~~tL~~~gi~   66 (80)
T cd01792          50 SREVLQDGVPLVSQGLG   66 (80)
T ss_pred             CCCCCCCCCCHHHcCCC
Confidence            57899999999999763


No 8  
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=24.15  E-value=28  Score=18.87  Aligned_cols=17  Identities=47%  Similarity=0.792  Sum_probs=14.3

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .|+-|++++.|.+|...
T Consensus        46 ~g~~L~d~~~L~~~~i~   62 (76)
T cd01803          46 AGKQLEDGRTLSDYNIQ   62 (76)
T ss_pred             CCEECCCCCcHHHcCCC
Confidence            37789999999999874


No 9  
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=23.34  E-value=29  Score=18.79  Aligned_cols=17  Identities=24%  Similarity=0.692  Sum_probs=14.4

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .|+.|++++.|.+|-..
T Consensus        46 ~g~~L~d~~tl~~~~i~   62 (76)
T cd01806          46 SGKQMNDDKTAADYKLE   62 (76)
T ss_pred             CCeEccCCCCHHHcCCC
Confidence            47899999999999863


No 10 
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein. Scythe protein (also known as Bat3) is an apoptotic regulator that is highly conserved in eukaryotes and contains a ubiquitin-like domain near its N-terminus.  Scythe binds reaper, a potent apoptotic inducer, and Scythe/Reaper are thought to signal apoptosis, in part through regulating the folding and activity of apoptotic signaling molecules.
Probab=22.55  E-value=30  Score=18.55  Aligned_cols=17  Identities=24%  Similarity=0.704  Sum_probs=14.3

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .|+-|++++.|.+|...
T Consensus        46 ~g~~L~d~~~L~~~~i~   62 (72)
T cd01809          46 SGRVLKDDETLSEYKVE   62 (72)
T ss_pred             CCEECCCcCcHHHCCCC
Confidence            37899999999999863


No 11 
>PTZ00044 ubiquitin; Provisional
Probab=20.46  E-value=39  Score=18.62  Aligned_cols=17  Identities=29%  Similarity=0.622  Sum_probs=14.2

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .|+-|+.+++|.+|...
T Consensus        46 ~g~~L~d~~~l~~~~i~   62 (76)
T PTZ00044         46 SGKQMSDDLKLSDYKVV   62 (76)
T ss_pred             CCEEccCCCcHHHcCCC
Confidence            57789999999999863


No 12 
>cd01802 AN1_N ubiquitin-like domain of AN1. AN1 (also known as ANUBL1 and RSD-7) is ubiquitin-like protein with a testis-specific expression in rats that has an N-terminal ubiquitin-like domain and a C-terminal zinc-binding domain. Unlike ubiquitin polyproteins and most ubiquitin fusion proteins, the N-terminal ubiquitin-like domain of An1 does not undergo proteolytic processing.  The function of AN1 is unknown.
Probab=20.35  E-value=36  Score=21.11  Aligned_cols=17  Identities=29%  Similarity=0.426  Sum_probs=14.9

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||.|+.+++|.+|...
T Consensus        73 ~Gk~L~D~~tL~dy~I~   89 (103)
T cd01802          73 NNMELEDEYCLNDYNIS   89 (103)
T ss_pred             CCEECCCCCcHHHcCCC
Confidence            58999999999999863


Done!