Query         psy15933
Match_columns 59
No_of_seqs    33 out of 35
Neff          2.3 
Searched_HMMs 29240
Date          Fri Aug 16 16:49:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15933.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/15933hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3ivf_A Talin-1; FERM domain, c  95.9  0.0028 9.5E-08   43.8   1.8   34   18-51     41-74  (371)
  2 4b6w_A Tubulin-specific chaper  47.2     7.3 0.00025   22.3   1.1   18   34-51     56-73  (86)
  3 1wgh_A Ubiquitin-like 3, HCG-1  42.9     6.5 0.00022   24.2   0.5   16   35-50     70-85  (116)
  4 3tj5_B Metavinculin, SCA-famil  42.4     3.9 0.00013   21.0  -0.5   14   11-24     10-23  (27)
  5 1v6e_A Cytoskeleton-associated  40.8      15 0.00051   20.7   1.8   19   33-51     55-77  (95)
  6 1se9_A Ubiquitin family; ubiqu  40.1     6.2 0.00021   25.0   0.1   17   35-51     70-86  (126)
  7 1lpl_A Hypothetical 25.4 kDa p  38.7     6.7 0.00023   23.8   0.1   21   22-42     71-91  (95)
  8 2gow_A HCG-1 protein, ubiquiti  36.1     8.4 0.00029   23.9   0.2   17   35-51     71-87  (125)
  9 4fbj_B NEDD8; effector-HOST ta  31.2      21 0.00072   19.7   1.3   17   35-51     46-62  (88)
 10 2faz_A Ubiquitin-like containi  29.2      25 0.00084   18.4   1.3   17   35-51     50-66  (78)
 11 3phx_B Ubiquitin-like protein   29.1      18 0.00061   19.1   0.8   17   35-51     50-66  (79)
 12 2wyq_A HHR23A, UV excision rep  27.8      20 0.00067   19.0   0.8   17   35-51     54-70  (85)
 13 2kj6_A Tubulin folding cofacto  27.6      15 0.00051   21.6   0.3   19   33-51     63-85  (97)
 14 2kd0_A LRR repeats and ubiquit  27.1      27 0.00094   19.3   1.3   17   35-51     57-73  (85)
 15 2bps_A YUKD protein; ubiquitin  26.0      19 0.00064   21.3   0.5   42    9-53     28-75  (81)
 16 1ndd_A NEDD8, protein (ubiquit  26.0      22 0.00075   18.0   0.8   17   35-51     46-62  (76)
 17 3m62_B UV excision repair prot  25.9      29 0.00099   20.0   1.3   16   35-50     47-62  (106)
 18 2r2o_A Plexin-B1; effector dom  25.5      15 0.00051   24.2   0.0   11   37-47      8-18  (138)
 19 2bwf_A Ubiquitin-like protein   25.2      23 0.00078   18.2   0.7   17   35-51     49-65  (77)
 20 3dbh_I NEDD8; cell cycle, acti  24.8      24 0.00081   18.7   0.8   17   35-51     58-74  (88)
 21 3n3k_B Ubiquitin; hydrolase, p  24.5      32  0.0011   18.0   1.3   17   35-51     49-65  (85)
 22 2dzi_A Ubiquitin-like protein   23.8      25 0.00086   18.2   0.8   17   35-51     53-69  (81)
 23 1wia_A Hypothetical ubiquitin-  23.7      32  0.0011   19.0   1.2   16   35-50     50-66  (95)
 24 4dwf_A HLA-B-associated transc  23.4      18 0.00061   19.6   0.1   16   35-50     51-66  (90)
 25 4eew_A Large proline-rich prot  23.2      18 0.00062   19.5   0.1   17   35-51     63-79  (88)
 26 1we6_A Splicing factor, putati  22.8      47  0.0016   19.0   1.8   17   35-51     77-93  (111)
 27 3a9j_A Ubiquitin; protein comp  22.5      28 0.00096   17.6   0.7   16   36-51     47-62  (76)
 28 3m63_B Ubiquitin domain-contai  22.4      37  0.0013   19.5   1.3   17   35-51     73-89  (101)
 29 3v6c_B Ubiquitin; structural g  22.1      28 0.00096   19.0   0.7   17   35-51     63-79  (91)
 30 2dzj_A Synaptic glycoprotein S  22.0      40  0.0014   19.1   1.4   17   35-51     62-78  (88)
 31 1uel_A HHR23B, UV excision rep  21.9      29 0.00098   19.4   0.8   16   35-50     49-64  (95)

No 1  
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A
Probab=95.94  E-value=0.0028  Score=43.76  Aligned_cols=34  Identities=24%  Similarity=0.434  Sum_probs=31.5

Q ss_pred             ccccccceeecCCCCCCCCCccchhcccCCCCCC
Q psy15933         18 FKEGFNYGLFYPPANGKAGKFLDEERRLGDYPFN   51 (59)
Q Consensus        18 L~d~lNYGLf~Pp~~Gr~GKFLdEERlLreYP~~   51 (59)
                      ..|.-+||||.|..+++.|++|+..|.|..|+..
T Consensus        41 ~~~~~~y~l~~~~~~~~~~~Wl~~~~~l~~y~~~   74 (371)
T 3ivf_A           41 AGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLR   74 (371)
T ss_dssp             SSCGGGEEEEECCSSGGGCEECCTTSBGGGGTCC
T ss_pred             CCCHHHCeEeccCCCCCcCEeccCCCCHHHhCCC
Confidence            5678999999999999999999999999999973


No 2  
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927}
Probab=47.17  E-value=7.3  Score=22.33  Aligned_cols=18  Identities=22%  Similarity=0.442  Sum_probs=15.8

Q ss_pred             CCCCccchhcccCCCCCC
Q psy15933         34 KAGKFLDEERRLGDYPFN   51 (59)
Q Consensus        34 r~GKFLdEERlLreYP~~   51 (59)
                      .+||-|+.+|.|.+|...
T Consensus        56 ~~g~~l~d~~tL~~Y~i~   73 (86)
T 4b6w_A           56 TIEKNMANDKQLGYYQCR   73 (86)
T ss_dssp             EEESSCCTTSBGGGGTCC
T ss_pred             ceeeEcCCCCCHHHCCCC
Confidence            468999999999999974


No 3  
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1
Probab=42.90  E-value=6.5  Score=24.24  Aligned_cols=16  Identities=31%  Similarity=0.627  Sum_probs=14.8

Q ss_pred             CCCccchhcccCCCCC
Q psy15933         35 AGKFLDEERRLGDYPF   50 (59)
Q Consensus        35 ~GKFLdEERlLreYP~   50 (59)
                      +||.|+.++.|.+|-.
T Consensus        70 ~GK~LeD~~TL~~y~I   85 (116)
T 1wgh_A           70 QGRFLHGNVTLGALKL   85 (116)
T ss_dssp             TTEEECSSCBTTTTTC
T ss_pred             CCcCCCCCCcHHHcCC
Confidence            7999999999999975


No 4  
>3tj5_B Metavinculin, SCA-family protein; cytoskeleton, epidemic typhus, spotted fever, alpha-HE bundle domain, protein-protein interactions; 1.99A {Rickettsia rickettsii}
Probab=42.35  E-value=3.9  Score=21.03  Aligned_cols=14  Identities=21%  Similarity=0.124  Sum_probs=12.1

Q ss_pred             hhhhhhhccccccc
Q psy15933         11 KTYWFTEFKEGFNY   24 (59)
Q Consensus        11 ~~~~~~~L~d~lNY   24 (59)
                      .+-||+|.+|.+||
T Consensus        10 A~~LS~sMQdLLn~   23 (27)
T 3tj5_B           10 ATALSGSMQYLLNY   23 (27)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            36799999999997


No 5  
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1
Probab=40.83  E-value=15  Score=20.72  Aligned_cols=19  Identities=42%  Similarity=0.796  Sum_probs=14.6

Q ss_pred             CCCCCc----cchhcccCCCCCC
Q psy15933         33 GKAGKF----LDEERRLGDYPFN   51 (59)
Q Consensus        33 Gr~GKF----LdEERlLreYP~~   51 (59)
                      |+.||.    ++.++.|.+|...
T Consensus        55 ~~~g~~~~~l~~D~~tL~~y~i~   77 (95)
T 1v6e_A           55 GADDKFYSKLDQEDALLGSYPVD   77 (95)
T ss_dssp             CSSSCEEEECCCSSSBTTSSSCC
T ss_pred             CCCCccccccCCCcCCHhHCCCC
Confidence            445776    5889999999863


No 6  
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1
Probab=40.12  E-value=6.2  Score=25.00  Aligned_cols=17  Identities=35%  Similarity=0.612  Sum_probs=15.4

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      +||.|+.++.|.||-..
T Consensus        70 ~GK~LeD~~TLsdy~I~   86 (126)
T 1se9_A           70 AGKVLENSKTVKDYRSP   86 (126)
T ss_dssp             TTEECCTTSBGGGGSCC
T ss_pred             CCeECcCCCcHHHcCCC
Confidence            79999999999999864


No 7  
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A
Probab=38.75  E-value=6.7  Score=23.78  Aligned_cols=21  Identities=33%  Similarity=0.537  Sum_probs=17.5

Q ss_pred             ccceeecCCCCCCCCCccchh
Q psy15933         22 FNYGLFYPPANGKAGKFLDEE   42 (59)
Q Consensus        22 lNYGLf~Pp~~Gr~GKFLdEE   42 (59)
                      -|||+|.+|+.=+.|-|-+++
T Consensus        71 p~~G~Fvr~~~v~~gdfp~~d   91 (95)
T 1lpl_A           71 PKYGGFVRPVDVKVGDFPELS   91 (95)
T ss_dssp             TTSEEEECGGGEEESCCCCCC
T ss_pred             CCEEEEEcHHHceECCCCCCC
Confidence            589999999988888887766


No 8  
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens}
Probab=36.14  E-value=8.4  Score=23.94  Aligned_cols=17  Identities=29%  Similarity=0.573  Sum_probs=15.2

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      +||.|+.++.|.+|-..
T Consensus        71 ~GK~LeD~~TL~~y~I~   87 (125)
T 2gow_A           71 QGRFLHGNVTLGALKLP   87 (125)
T ss_dssp             SSSEEESSCBTGGGCCC
T ss_pred             CCcCCCCCCcHHHcCCC
Confidence            79999999999999753


No 9  
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B
Probab=31.21  E-value=21  Score=19.66  Aligned_cols=17  Identities=29%  Similarity=0.614  Sum_probs=14.8

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        46 ~Gk~L~D~~tL~~~~i~   62 (88)
T 4fbj_B           46 SGKQMNDEKTAADYKIL   62 (88)
T ss_dssp             TTEECCTTSBTTTTTCC
T ss_pred             CCeECCCCCcHHHcCCC
Confidence            57899999999999863


No 10 
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1
Probab=29.22  E-value=25  Score=18.37  Aligned_cols=17  Identities=29%  Similarity=0.503  Sum_probs=14.3

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        50 ~g~~L~d~~tL~~~~i~   66 (78)
T 2faz_A           50 RGKQMEDGHTLFDYEVR   66 (78)
T ss_dssp             TTEECCTTCBTTTTTCC
T ss_pred             CCEECCCCCCHHHcCCC
Confidence            46889999999999863


No 11 
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens}
Probab=29.10  E-value=18  Score=19.07  Aligned_cols=17  Identities=35%  Similarity=0.712  Sum_probs=14.7

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        50 ~G~~L~d~~tL~~~~i~   66 (79)
T 3phx_B           50 EGKPLEDQLPLGEYGLK   66 (79)
T ss_dssp             TTEECCTTSBGGGGTCC
T ss_pred             CCEECCCCCcHHHCCCC
Confidence            57899999999999863


No 12 
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A
Probab=27.82  E-value=20  Score=19.01  Aligned_cols=17  Identities=35%  Similarity=0.722  Sum_probs=14.3

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        54 ~Gk~L~D~~tL~~~~i~   70 (85)
T 2wyq_A           54 AGKILSDDVPIRDYRID   70 (85)
T ss_dssp             TTEECCTTSBGGGGCCC
T ss_pred             CCEECcCCCCHHHcCCC
Confidence            37889999999999863


No 13 
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana}
Probab=27.63  E-value=15  Score=21.59  Aligned_cols=19  Identities=26%  Similarity=0.337  Sum_probs=14.6

Q ss_pred             CCCCCc----cchhcccCCCCCC
Q psy15933         33 GKAGKF----LDEERRLGDYPFN   51 (59)
Q Consensus        33 Gr~GKF----LdEERlLreYP~~   51 (59)
                      |+.||.    ++++|.|.+|...
T Consensus        63 g~~g~~~~~L~~D~~tL~~Y~I~   85 (97)
T 2kj6_A           63 DDSGSKVAVLSDDSRPLGFFSPF   85 (97)
T ss_dssp             CSSSCBCCCSSGGGSCHHHHCCC
T ss_pred             cCCCcccceecCCcCCHHHCCCC
Confidence            445665    5999999999974


No 14 
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana}
Probab=27.07  E-value=27  Score=19.26  Aligned_cols=17  Identities=29%  Similarity=0.304  Sum_probs=14.5

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        57 ~Gk~L~D~~tL~~~gi~   73 (85)
T 2kd0_A           57 KGKVLVETSTLKQSDVG   73 (85)
T ss_dssp             TTEECCTTCBTTTTTCC
T ss_pred             CCeECCCcCCHHHCCCC
Confidence            37899999999999864


No 15 
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis}
Probab=26.02  E-value=19  Score=21.27  Aligned_cols=42  Identities=19%  Similarity=0.244  Sum_probs=27.8

Q ss_pred             hhhhhhhhhccccccceeecCCCCCC------CCCccchhcccCCCCCCCC
Q psy15933          9 TFKTYWFTEFKEGFNYGLFYPPANGK------AGKFLDEERRLGDYPFNGP   53 (59)
Q Consensus         9 ~~~~~~~~~L~d~lNYGLf~Pp~~Gr------~GKFLdEERlLreYP~~~~   53 (59)
                      |+|.++ +.++++++-.  .|+.+|.      .+.+|.+.+.|.|||...+
T Consensus        28 tvK~Li-~~l~ea~~l~--~~~~~~~~irv~NK~~~L~~~~~L~d~~ItnG   75 (81)
T 2bps_A           28 PVKKVI-DIAWQAQSVS--MPPREGHWIRVVNKDKVFSGECKLSDCGITNG   75 (81)
T ss_dssp             BTTHHH-HHHHHHSCCC--SCCCTTCEEEEGGGTEEEETTSBTGGGTCCTT
T ss_pred             hHHHHH-HHHHHHhCCC--cCCCCCCEEEEecCCEEEcCCCEEeeCCcCCC
Confidence            344433 3566665555  5555542      5789999999999998643


No 16 
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A
Probab=25.95  E-value=22  Score=18.02  Aligned_cols=17  Identities=29%  Similarity=0.614  Sum_probs=14.2

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        46 ~g~~L~d~~tL~~~~i~   62 (76)
T 1ndd_A           46 SGKQMNDEKTAADYKIL   62 (76)
T ss_dssp             TTEECCTTSBGGGGTCC
T ss_pred             CCEECCCCCcHHHcCCC
Confidence            37889999999999863


No 17 
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae}
Probab=25.86  E-value=29  Score=19.99  Aligned_cols=16  Identities=19%  Similarity=0.545  Sum_probs=14.3

Q ss_pred             CCCccchhcccCCCCC
Q psy15933         35 AGKFLDEERRLGDYPF   50 (59)
Q Consensus        35 ~GKFLdEERlLreYP~   50 (59)
                      .||-|+.++.|.+|..
T Consensus        47 ~Gk~L~D~~tL~~~~i   62 (106)
T 3m62_B           47 SGKVLQDSKTVSECGL   62 (106)
T ss_dssp             TTEECCTTSBTTTTTC
T ss_pred             CCEECCCcCCHHHcCC
Confidence            4789999999999985


No 18 
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A
Probab=25.46  E-value=15  Score=24.22  Aligned_cols=11  Identities=9%  Similarity=-0.173  Sum_probs=0.0

Q ss_pred             CccchhcccCC
Q psy15933         37 KFLDEERRLGD   47 (59)
Q Consensus        37 KFLdEERlLre   47 (59)
                      .-|.||+|||+
T Consensus         8 ~~lsEdkLLRq   18 (138)
T 2r2o_A            8 SSGRENLYFQG   18 (138)
T ss_dssp             -----------
T ss_pred             cccChhHhhcc
Confidence            34899999996


No 19 
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S
Probab=25.22  E-value=23  Score=18.23  Aligned_cols=17  Identities=24%  Similarity=0.647  Sum_probs=14.2

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        49 ~gk~L~d~~tL~~~~i~   65 (77)
T 2bwf_A           49 SGKILKDDQTVESYHIQ   65 (77)
T ss_dssp             TTEECCTTSBTGGGTCC
T ss_pred             CCeEcCCCCCHHHcCCC
Confidence            36889999999999864


No 20 
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I
Probab=24.79  E-value=24  Score=18.72  Aligned_cols=17  Identities=29%  Similarity=0.614  Sum_probs=14.6

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        58 ~G~~L~d~~tL~~~~i~   74 (88)
T 3dbh_I           58 SGKQMNDEKTAADYKIL   74 (88)
T ss_dssp             TTEECCTTSBGGGGTCC
T ss_pred             CCeECCCCCcHHHcCCC
Confidence            57889999999999863


No 21 
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1
Probab=24.53  E-value=32  Score=17.98  Aligned_cols=17  Identities=47%  Similarity=0.802  Sum_probs=14.4

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        49 ~g~~L~d~~tL~~~~i~   65 (85)
T 3n3k_B           49 AGKQLEDGRTLSDYNIH   65 (85)
T ss_dssp             TBEECCTTCBTTTTTCC
T ss_pred             CCeECCCCCCHHHCCCC
Confidence            46889999999999863


No 22 
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=23.84  E-value=25  Score=18.23  Aligned_cols=17  Identities=41%  Similarity=0.761  Sum_probs=14.3

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        53 ~gk~L~d~~tL~~~~i~   69 (81)
T 2dzi_A           53 KGKALADGKRLSDYSIG   69 (81)
T ss_dssp             TTEECCTTSBGGGGTCC
T ss_pred             CCeECCCCCcHHHcCCC
Confidence            37889999999999863


No 23 
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1
Probab=23.66  E-value=32  Score=18.95  Aligned_cols=16  Identities=25%  Similarity=0.578  Sum_probs=13.7

Q ss_pred             CCCccchh-cccCCCCC
Q psy15933         35 AGKFLDEE-RRLGDYPF   50 (59)
Q Consensus        35 ~GKFLdEE-RlLreYP~   50 (59)
                      .||-|+.+ +.|.||..
T Consensus        50 ~Gk~L~D~~~tL~~y~i   66 (95)
T 1wia_A           50 QGRLLQDPARTLSSLNI   66 (95)
T ss_dssp             TTEECCCSSCBTTTTTC
T ss_pred             CCEEccCCcCCHHHcCC
Confidence            47899888 99999976


No 24 
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A
Probab=23.43  E-value=18  Score=19.60  Aligned_cols=16  Identities=25%  Similarity=0.783  Sum_probs=14.3

Q ss_pred             CCCccchhcccCCCCC
Q psy15933         35 AGKFLDEERRLGDYPF   50 (59)
Q Consensus        35 ~GKFLdEERlLreYP~   50 (59)
                      .||-|+.++.|.+|..
T Consensus        51 ~Gk~L~d~~tL~~~~i   66 (90)
T 4dwf_A           51 QGRVLQDDKKLQEYNV   66 (90)
T ss_dssp             TTEECCTTSBGGGGTC
T ss_pred             CCeECCCCCCHHHcCC
Confidence            5789999999999986


No 25 
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens}
Probab=23.22  E-value=18  Score=19.49  Aligned_cols=17  Identities=24%  Similarity=0.745  Sum_probs=14.7

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|..+
T Consensus        63 ~Gk~L~D~~tL~~~~i~   79 (88)
T 4eew_A           63 QGRVLQDDKKLQEYNVG   79 (88)
T ss_dssp             TTEECCTTSBGGGGTCT
T ss_pred             CCEECCCCCcHHHcCCC
Confidence            57899999999999763


No 26 
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1
Probab=22.78  E-value=47  Score=19.02  Aligned_cols=17  Identities=24%  Similarity=0.481  Sum_probs=14.6

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||.|+.++.|.+|...
T Consensus        77 ~Gk~L~D~~tL~~y~I~   93 (111)
T 1we6_A           77 KAGFLKDNMSLAHYNVG   93 (111)
T ss_dssp             SSSBCCTTSBTTTTTCS
T ss_pred             CCEECCCCCcHHHCCCC
Confidence            47899999999999863


No 27 
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ...
Probab=22.45  E-value=28  Score=17.60  Aligned_cols=16  Identities=44%  Similarity=0.792  Sum_probs=13.7

Q ss_pred             CCccchhcccCCCCCC
Q psy15933         36 GKFLDEERRLGDYPFN   51 (59)
Q Consensus        36 GKFLdEERlLreYP~~   51 (59)
                      ||-|+.++.|.+|...
T Consensus        47 g~~L~d~~tL~~~~i~   62 (76)
T 3a9j_A           47 GKQLEDGRTLSDYNIQ   62 (76)
T ss_dssp             TEECCTTCBTGGGTCC
T ss_pred             CeECCCCCcHHHcCCC
Confidence            6789999999999863


No 28 
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae}
Probab=22.43  E-value=37  Score=19.49  Aligned_cols=17  Identities=24%  Similarity=0.647  Sum_probs=14.8

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        73 ~Gk~L~D~~tL~~~gI~   89 (101)
T 3m63_B           73 SGKILKDDQTVESYHIQ   89 (101)
T ss_dssp             TTEECCTTSBTTTTTCC
T ss_pred             CCEECCCcCcHHHCCCC
Confidence            57999999999999864


No 29 
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B
Probab=22.12  E-value=28  Score=19.03  Aligned_cols=17  Identities=47%  Similarity=0.792  Sum_probs=14.6

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        63 ~Gk~L~D~~tL~~~gi~   79 (91)
T 3v6c_B           63 AGKQLEDGRTLSDYNIQ   79 (91)
T ss_dssp             TTEECCTTCBTGGGTCC
T ss_pred             CCeECCCcCcHHHCCCC
Confidence            47889999999999864


No 30 
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=22.02  E-value=40  Score=19.05  Aligned_cols=17  Identities=35%  Similarity=0.524  Sum_probs=14.7

Q ss_pred             CCCccchhcccCCCCCC
Q psy15933         35 AGKFLDEERRLGDYPFN   51 (59)
Q Consensus        35 ~GKFLdEERlLreYP~~   51 (59)
                      .||-|+.++.|.+|...
T Consensus        62 ~Gk~L~D~~tL~~y~i~   78 (88)
T 2dzj_A           62 KGKSLKDEDVLQKLPVG   78 (88)
T ss_dssp             TSCCCCTTCBTTTSSCC
T ss_pred             CCcCcCCCCCHHHcCCC
Confidence            48999999999999863


No 31 
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1
Probab=21.89  E-value=29  Score=19.36  Aligned_cols=16  Identities=38%  Similarity=0.787  Sum_probs=13.9

Q ss_pred             CCCccchhcccCCCCC
Q psy15933         35 AGKFLDEERRLGDYPF   50 (59)
Q Consensus        35 ~GKFLdEERlLreYP~   50 (59)
                      .||-|+.++.|.+|..
T Consensus        49 ~Gk~L~D~~tL~~ygI   64 (95)
T 1uel_A           49 AGKILNDDTALKEYKI   64 (95)
T ss_dssp             TTEECCTTSBGGGGTC
T ss_pred             CCEECCCcCcHHHCCC
Confidence            4788999999999986


Done!