BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy15933
MQGTNFNATFKTYWFTEFKEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVGYLEF

High Scoring Gene Products

Symbol, full name Information P value
Prosap protein from Drosophila melanogaster 5.8e-16
Shank3
SH3/ankyrin domain gene 3
protein from Mus musculus 1.1e-07
Shank3
SH3 and multiple ankyrin repeat domains 3
gene from Rattus norvegicus 1.1e-07
SHANK3
SH3 and multiple ankyrin repeat domains protein 3
protein from Homo sapiens 2.8e-07
SHANK3
SH3 and multiple ankyrin repeat domains protein 3
protein from Homo sapiens 2.8e-07
shn-1 gene from Caenorhabditis elegans 2.8e-07
shn-1
Protein SHN-1, isoform c
protein from Caenorhabditis elegans 2.8e-07
SHANK3
Uncharacterized protein
protein from Bos taurus 1.2e-06
SHANK2
SH3 and multiple ankyrin repeat domains protein 2
protein from Homo sapiens 3.5e-06
SHANK2
SH3 and multiple ankyrin repeat domains protein 2
protein from Homo sapiens 4.0e-05

The BLAST search returned 2 gene products which did not match your query constraints. Please see the full BLAST report below for the details.

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy15933
        (59 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

FB|FBgn0040752 - symbol:Prosap "Prosap" species:7227 "Dro...   215  5.8e-16   1
UNIPROTKB|F1NWF9 - symbol:F1NWF9 "Uncharacterized protein...   136  8.8e-09   1
MGI|MGI:1930016 - symbol:Shank3 "SH3/ankyrin domain gene ...   137  1.1e-07   1
RGD|69264 - symbol:Shank3 "SH3 and multiple ankyrin repea...   137  1.1e-07   1
UNIPROTKB|Q9BYB0 - symbol:SHANK3 "SH3 and multiple ankyri...   133  2.8e-07   1
UNIPROTKB|F2Z3L0 - symbol:SHANK3 "SH3 and multiple ankyri...   133  2.8e-07   1
WB|WBGene00006444 - symbol:shn-1 species:6239 "Caenorhabd...   131  2.8e-07   1
UNIPROTKB|B7WN72 - symbol:shn-1 "Protein SHN-1, isoform c...   131  2.8e-07   1
UNIPROTKB|G3X7P4 - symbol:SHANK3 "Uncharacterized protein...   127  1.2e-06   1
UNIPROTKB|C9JFP8 - symbol:SHANK2 "SH3 and multiple ankyri...   113  3.5e-06   1
UNIPROTKB|E1C3V2 - symbol:SHANK2 "Uncharacterized protein...   114  3.1e-05   1
UNIPROTKB|A6NHU9 - symbol:SHANK2 "SH3 and multiple ankyri...   113  4.0e-05   1


>FB|FBgn0040752 [details] [associations]
            symbol:Prosap "Prosap" species:7227 "Drosophila melanogaster"
            [GO:0005515 "protein binding" evidence=IPI] [GO:0030160 "GKAP/Homer
            scaffold activity" evidence=ISS] [GO:0097107 "postsynaptic density
            assembly" evidence=ISS] [GO:0014069 "postsynaptic density"
            evidence=ISS] Pfam:PF00595 InterPro:IPR002110 InterPro:IPR001452
            InterPro:IPR001478 PROSITE:PS50088 PROSITE:PS50106 SMART:SM00228
            SMART:SM00248 SMART:SM00326 EMBL:AE013599 eggNOG:COG0666
            Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796 SUPFAM:SSF48403
            PROSITE:PS50297 SUPFAM:SSF50044 SUPFAM:SSF50156 InterPro:IPR011511
            Pfam:PF07653 KO:K15009 GeneTree:ENSGT00510000046474 EMBL:BT044467
            RefSeq:NP_001246315.1 RefSeq:NP_610925.3 UniGene:Dm.19025
            SMR:A1Z9K8 STRING:A1Z9K8 EnsemblMetazoa:FBtr0087601
            EnsemblMetazoa:FBtr0304956 GeneID:50225 KEGG:dme:Dmel_CG30483
            UCSC:CG30483-RA CTD:50225 FlyBase:FBgn0040752 InParanoid:A1Z9K8
            OMA:PRYNPKR OrthoDB:EOG44QRFW ChiTaRS:Prosap GenomeRNAi:50225
            NextBio:840513 Uniprot:A1Z9K8
        Length = 1871

 Score = 215 (80.7 bits), Expect = 5.8e-16, P = 5.8e-16
 Identities = 39/42 (92%), Positives = 39/42 (92%)

Query:    17 EFKEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVGYLE 58
             E KE FNYGLF PPANGKAGKFLDEERRLGDYPFNGPVGYLE
Sbjct:    57 ELKESFNYGLFAPPANGKAGKFLDEERRLGDYPFNGPVGYLE 98


>UNIPROTKB|F1NWF9 [details] [associations]
            symbol:F1NWF9 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0000165 "MAPK cascade" evidence=IEA]
            [GO:0001838 "embryonic epithelial tube formation" evidence=IEA]
            [GO:0005886 "plasma membrane" evidence=IEA] [GO:0007612 "learning"
            evidence=IEA] [GO:0007613 "memory" evidence=IEA] [GO:0008022
            "protein C-terminus binding" evidence=IEA] [GO:0021773 "striatal
            medium spiny neuron differentiation" evidence=IEA] [GO:0032232
            "negative regulation of actin filament bundle assembly"
            evidence=IEA] [GO:0035176 "social behavior" evidence=IEA]
            [GO:0035255 "ionotropic glutamate receptor binding" evidence=IEA]
            [GO:0035641 "locomotory exploration behavior" evidence=IEA]
            [GO:0044309 "neuron spine" evidence=IEA] [GO:0045794 "negative
            regulation of cell volume" evidence=IEA] [GO:0048170 "positive
            regulation of long-term neuronal synaptic plasticity" evidence=IEA]
            [GO:0048854 "brain morphogenesis" evidence=IEA] [GO:0050885
            "neuromuscular process controlling balance" evidence=IEA]
            [GO:0051835 "positive regulation of synapse structural plasticity"
            evidence=IEA] [GO:0051968 "positive regulation of synaptic
            transmission, glutamatergic" evidence=IEA] [GO:0060997 "dendritic
            spine morphogenesis" evidence=IEA] [GO:0060999 "positive regulation
            of dendritic spine development" evidence=IEA] [GO:0061001
            "regulation of dendritic spine morphogenesis" evidence=IEA]
            [GO:0071625 "vocalization behavior" evidence=IEA] [GO:0097107
            "postsynaptic density assembly" evidence=IEA] [GO:0097110 "scaffold
            protein binding" evidence=IEA] [GO:0097113
            "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptor
            clustering" evidence=IEA] [GO:0097114 "N-methyl-D-aspartate
            receptor clustering" evidence=IEA] [GO:0097117 "guanylate
            kinase-associated protein clustering" evidence=IEA] [GO:1900271
            "regulation of long-term synaptic potentiation" evidence=IEA]
            [GO:1900451 "positive regulation of glutamate receptor signaling
            pathway" evidence=IEA] [GO:1900452 "regulation of long term
            synaptic depression" evidence=IEA] [GO:2000463 "positive regulation
            of excitatory postsynaptic membrane potential" evidence=IEA]
            [GO:2000821 "regulation of grooming behavior" evidence=IEA]
            [GO:2000822 "regulation of behavioral fear response" evidence=IEA]
            [GO:2000969 "positive regulation of
            alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective
            glutamate receptor activity" evidence=IEA] InterPro:IPR002110
            PROSITE:PS50088 SMART:SM00248 Gene3D:1.25.40.20 InterPro:IPR020683
            Pfam:PF12796 SUPFAM:SSF48403 PROSITE:PS50297
            GeneTree:ENSGT00510000046474 EMBL:AADN02075694 EMBL:AADN02075695
            EMBL:AADN02075696 IPI:IPI00575132 Ensembl:ENSGALT00000015858
            OMA:MTAQNAS Uniprot:F1NWF9
        Length = 288

 Score = 136 (52.9 bits), Expect = 8.8e-09, P = 8.8e-09
 Identities = 28/43 (65%), Positives = 31/43 (72%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNG--PVGYLEF 59
             K+  NYGLF P  NG+AGKFLDEER L +YP N   PV YLEF
Sbjct:    37 KDVLNYGLFQPAFNGRAGKFLDEERLLREYPLNPDTPVPYLEF 79


>MGI|MGI:1930016 [details] [associations]
            symbol:Shank3 "SH3/ankyrin domain gene 3" species:10090 "Mus
            musculus" [GO:0000165 "MAPK cascade" evidence=IGI] [GO:0001838
            "embryonic epithelial tube formation" evidence=IGI] [GO:0005515
            "protein binding" evidence=IPI] [GO:0005737 "cytoplasm"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=IDA]
            [GO:0007416 "synapse assembly" evidence=IMP] [GO:0007612 "learning"
            evidence=IMP] [GO:0007613 "memory" evidence=IMP] [GO:0008022
            "protein C-terminus binding" evidence=ISO;IPI] [GO:0008270 "zinc
            ion binding" evidence=ISO] [GO:0014069 "postsynaptic density"
            evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0017124 "SH3
            domain binding" evidence=ISO] [GO:0021773 "striatal medium spiny
            neuron differentiation" evidence=IMP] [GO:0030054 "cell junction"
            evidence=IEA] [GO:0030160 "GKAP/Homer scaffold activity"
            evidence=ISO] [GO:0032232 "negative regulation of actin filament
            bundle assembly" evidence=IDA] [GO:0035176 "social behavior"
            evidence=IMP] [GO:0035255 "ionotropic glutamate receptor binding"
            evidence=IPI] [GO:0035641 "locomotory exploration behavior"
            evidence=IMP] [GO:0042802 "identical protein binding" evidence=ISO]
            [GO:0043005 "neuron projection" evidence=IDA] [GO:0043621 "protein
            self-association" evidence=ISO] [GO:0044309 "neuron spine"
            evidence=IDA] [GO:0045202 "synapse" evidence=ISO] [GO:0045211
            "postsynaptic membrane" evidence=IEA] [GO:0045794 "negative
            regulation of cell volume" evidence=IMP] [GO:0048170 "positive
            regulation of long-term neuronal synaptic plasticity" evidence=IMP]
            [GO:0048854 "brain morphogenesis" evidence=IMP] [GO:0050885
            "neuromuscular process controlling balance" evidence=IMP]
            [GO:0051259 "protein oligomerization" evidence=ISO] [GO:0051835
            "positive regulation of synapse structural plasticity"
            evidence=IMP] [GO:0051968 "positive regulation of synaptic
            transmission, glutamatergic" evidence=IMP] [GO:0060076 "excitatory
            synapse" evidence=IC] [GO:0060170 "cilium membrane" evidence=ISO]
            [GO:0060997 "dendritic spine morphogenesis" evidence=IMP]
            [GO:0060999 "positive regulation of dendritic spine development"
            evidence=IMP] [GO:0061001 "regulation of dendritic spine
            morphogenesis" evidence=IMP] [GO:0071625 "vocalization behavior"
            evidence=IMP] [GO:0097107 "postsynaptic density assembly"
            evidence=IMP] [GO:0097110 "scaffold protein binding"
            evidence=ISO;IPI] [GO:0097113
            "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptor
            clustering" evidence=IMP] [GO:0097114 "N-methyl-D-aspartate
            receptor clustering" evidence=IMP] [GO:0097117 "guanylate
            kinase-associated protein clustering" evidence=IMP] [GO:1900271
            "regulation of long-term synaptic potentiation" evidence=IMP]
            [GO:1900451 "positive regulation of glutamate receptor signaling
            pathway" evidence=IMP] [GO:1900452 "regulation of long term
            synaptic depression" evidence=IMP] [GO:2000463 "positive regulation
            of excitatory postsynaptic membrane potential" evidence=IMP]
            [GO:2000821 "regulation of grooming behavior" evidence=IMP]
            [GO:2000822 "regulation of behavioral fear response" evidence=IMP]
            [GO:2000969 "positive regulation of
            alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective
            glutamate receptor activity" evidence=IMP] Pfam:PF00595
            InterPro:IPR002110 InterPro:IPR001452 InterPro:IPR001478
            InterPro:IPR001660 PROSITE:PS50002 PROSITE:PS50088 PROSITE:PS50105
            PROSITE:PS50106 SMART:SM00228 SMART:SM00248 SMART:SM00326
            SMART:SM00454 MGI:MGI:1930016 GO:GO:0051259 GO:GO:0005886
            GO:GO:0005737 GO:GO:0000165 GO:GO:0014069 eggNOG:COG0666
            GO:GO:0007613 GO:GO:0030054 GO:GO:0045211 GO:GO:0007612
            GO:GO:0008270 Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796
            SUPFAM:SSF48403 PROSITE:PS50297 GO:GO:0050885 GO:GO:0051968
            SUPFAM:SSF50044 GO:GO:0035176 Gene3D:1.10.150.50 InterPro:IPR013761
            InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769 SUPFAM:SSF50156
            InterPro:IPR011511 Pfam:PF07653 GO:GO:0060076 GO:GO:0048854
            GO:GO:0021773 GO:GO:0048170 GO:GO:0061001 GO:GO:0051835
            GO:GO:0071625 GO:GO:0035641 GO:GO:0097113 GO:GO:0060997
            GO:GO:2000463 GO:GO:2000821 GO:GO:0060999 GO:GO:0030160
            GO:GO:0045794 GO:GO:0032232 GO:GO:0097114 GO:GO:2000969
            GO:GO:1900271 GO:GO:0097117 GO:GO:0097107 GO:GO:0001838
            HOGENOM:HOG000293276 KO:K15009 OrthoDB:EOG48PMJ9
            GeneTree:ENSGT00510000046474 HOVERGEN:HBG054027 CTD:85358
            ChiTaRS:SHANK3 GO:GO:1900451 GO:GO:2000822 GO:GO:1900452
            EMBL:AC122401 EMBL:AC137513 EMBL:AB231013 EMBL:AK173228
            IPI:IPI00351827 RefSeq:NP_067398.2 UniGene:Mm.146855 PDB:3O5N
            PDBsum:3O5N ProteinModelPortal:Q4ACU6 SMR:Q4ACU6 IntAct:Q4ACU6
            STRING:Q4ACU6 PhosphoSite:Q4ACU6 PaxDb:Q4ACU6 PRIDE:Q4ACU6
            Ensembl:ENSMUST00000039074 Ensembl:ENSMUST00000109309 GeneID:58234
            KEGG:mmu:58234 UCSC:uc007xha.2 InParanoid:Q4ACU6 OMA:KFIAVKA
            EvolutionaryTrace:Q4ACU6 NextBio:314265 Bgee:Q4ACU6
            CleanEx:MM_SHANK3 Genevestigator:Q4ACU6 Uniprot:Q4ACU6
        Length = 1805

 Score = 137 (53.3 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 27/43 (62%), Positives = 32/43 (74%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFN--GPVGYLEF 59
             ++  NYGLF PP+ G+AGKFLDEER L DYP N   P+ YLEF
Sbjct:   123 QDALNYGLFQPPSRGRAGKFLDEERLLQDYPPNLDTPLPYLEF 165


>RGD|69264 [details] [associations]
            symbol:Shank3 "SH3 and multiple ankyrin repeat domains 3"
           species:10116 "Rattus norvegicus" [GO:0000165 "MAPK cascade"
           evidence=IEA;ISO] [GO:0001838 "embryonic epithelial tube formation"
           evidence=IEA;ISO] [GO:0005515 "protein binding" evidence=IPI]
           [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005886 "plasma membrane"
           evidence=ISO;ISS] [GO:0007416 "synapse assembly" evidence=ISO]
           [GO:0007612 "learning" evidence=IEA;ISO] [GO:0007613 "memory"
           evidence=IEA;ISO] [GO:0008022 "protein C-terminus binding"
           evidence=ISO;IPI] [GO:0008270 "zinc ion binding" evidence=IDA]
           [GO:0014069 "postsynaptic density" evidence=IDA] [GO:0017124 "SH3
           domain binding" evidence=IPI] [GO:0021773 "striatal medium spiny
           neuron differentiation" evidence=ISO;ISS] [GO:0030054 "cell
           junction" evidence=IEA] [GO:0030160 "GKAP/Homer scaffold activity"
           evidence=IDA] [GO:0032232 "negative regulation of actin filament
           bundle assembly" evidence=IEA;ISO] [GO:0035176 "social behavior"
           evidence=ISO;ISS] [GO:0035255 "ionotropic glutamate receptor
           binding" evidence=ISO;ISS] [GO:0035641 "locomotory exploration
           behavior" evidence=ISO;ISS] [GO:0042802 "identical protein binding"
           evidence=IPI] [GO:0043005 "neuron projection" evidence=ISO;ISS]
           [GO:0043621 "protein self-association" evidence=IDA] [GO:0044309
           "neuron spine" evidence=ISO;ISS] [GO:0045202 "synapse" evidence=IDA]
           [GO:0045211 "postsynaptic membrane" evidence=IEA] [GO:0045794
           "negative regulation of cell volume" evidence=ISO;ISS] [GO:0048170
           "positive regulation of long-term neuronal synaptic plasticity"
           evidence=ISO;ISS] [GO:0048854 "brain morphogenesis"
           evidence=ISO;ISS] [GO:0050885 "neuromuscular process controlling
           balance" evidence=IEA;ISO] [GO:0051259 "protein oligomerization"
           evidence=IDA] [GO:0051835 "positive regulation of synapse structural
           plasticity" evidence=ISO;ISS] [GO:0051968 "positive regulation of
           synaptic transmission, glutamatergic" evidence=ISO;ISS] [GO:0060170
           "cilium membrane" evidence=IDA] [GO:0060997 "dendritic spine
           morphogenesis" evidence=ISO;ISS] [GO:0060999 "positive regulation of
           dendritic spine development" evidence=ISO;ISS] [GO:0061001
           "regulation of dendritic spine morphogenesis" evidence=ISO;ISS]
           [GO:0071625 "vocalization behavior" evidence=ISO;ISS] [GO:0097107
           "postsynaptic density assembly" evidence=ISO;ISS] [GO:0097110
           "scaffold protein binding" evidence=ISO;IPI] [GO:0097113
           "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptor
           clustering" evidence=ISO;ISS] [GO:0097114 "N-methyl-D-aspartate
           receptor clustering" evidence=IEA;ISO] [GO:0097117 "guanylate
           kinase-associated protein clustering" evidence=IEA;ISO] [GO:1900271
           "regulation of long-term synaptic potentiation" evidence=IEA;ISO]
           [GO:1900451 "positive regulation of glutamate receptor signaling
           pathway" evidence=ISO;ISS] [GO:1900452 "regulation of long term
           synaptic depression" evidence=ISO;ISS] [GO:2000463 "positive
           regulation of excitatory postsynaptic membrane potential"
           evidence=ISO;ISS] [GO:2000821 "regulation of grooming behavior"
           evidence=IEA;ISO] [GO:2000822 "regulation of behavioral fear
           response" evidence=ISO;ISS] [GO:2000969 "positive regulation of
           alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective
           glutamate receptor activity" evidence=ISO;ISS] Pfam:PF00595
           InterPro:IPR002110 InterPro:IPR001452 InterPro:IPR001478
           InterPro:IPR001660 PROSITE:PS50002 PROSITE:PS50088 PROSITE:PS50105
           PROSITE:PS50106 SMART:SM00228 SMART:SM00248 SMART:SM00326
           SMART:SM00454 RGD:69264 GO:GO:0051259 GO:GO:0005737 GO:GO:0000165
           GO:GO:0014069 eggNOG:COG0666 GO:GO:0007613 GO:GO:0030054
           GO:GO:0045211 GO:GO:0007612 GO:GO:0008270 Gene3D:1.25.40.20
           InterPro:IPR020683 Pfam:PF12796 SUPFAM:SSF48403 PROSITE:PS50297
           GO:GO:0050885 GO:GO:0051968 GO:GO:0043621 SUPFAM:SSF50044
           GO:GO:0035176 Gene3D:1.10.150.50 InterPro:IPR013761
           InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769 SUPFAM:SSF50156
           InterPro:IPR011511 Pfam:PF07653 GO:GO:0060170 GO:GO:0048854
           GO:GO:0021773 GO:GO:0048170 GO:GO:0035255 GO:GO:0061001
           GO:GO:0051835 GO:GO:0071625 GO:GO:0035641 GO:GO:0097113
           GO:GO:0060997 GO:GO:2000463 GO:GO:2000821 GO:GO:0060999
           GO:GO:0030160 GO:GO:0045794 GO:GO:0032232 GO:GO:0097114
           GO:GO:2000969 GO:GO:1900271 GO:GO:0097117 GO:GO:0097107
           GO:GO:0001838 HOGENOM:HOG000293276 KO:K15009 OrthoDB:EOG48PMJ9
           HOVERGEN:HBG054027 CTD:85358 GO:GO:1900451 GO:GO:2000822
           GO:GO:1900452 EMBL:AJ133120 EMBL:AF133301 EMBL:AF159047
           IPI:IPI00204088 IPI:IPI00231141 IPI:IPI00231142 RefSeq:NP_067708.1
           UniGene:Rn.42876 PDB:2F3N PDB:2F44 PDBsum:2F3N PDBsum:2F44
           ProteinModelPortal:Q9JLU4 SMR:Q9JLU4 MINT:MINT-1486849 STRING:Q9JLU4
           PhosphoSite:Q9JLU4 PRIDE:Q9JLU4 GeneID:59312 KEGG:rno:59312
           InParanoid:Q9JLU4 EvolutionaryTrace:Q9JLU4 NextBio:611861
           ArrayExpress:Q9JLU4 Genevestigator:Q9JLU4 Uniprot:Q9JLU4
        Length = 1815

 Score = 137 (53.3 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 27/43 (62%), Positives = 32/43 (74%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFN--GPVGYLEF 59
             ++  NYGLF PP+ G+AGKFLDEER L DYP N   P+ YLEF
Sbjct:   123 QDALNYGLFQPPSRGRAGKFLDEERLLQDYPPNLDTPLPYLEF 165


>UNIPROTKB|Q9BYB0 [details] [associations]
            symbol:SHANK3 "SH3 and multiple ankyrin repeat domains
            protein 3" species:9606 "Homo sapiens" [GO:0017124 "SH3 domain
            binding" evidence=IEA] [GO:0030054 "cell junction" evidence=IEA]
            [GO:0045211 "postsynaptic membrane" evidence=IEA] [GO:0005737
            "cytoplasm" evidence=IEA] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0060170 "cilium membrane" evidence=ISS]
            [GO:1900271 "regulation of long-term synaptic potentiation"
            evidence=ISS] [GO:0007613 "memory" evidence=ISS] [GO:0097114
            "N-methyl-D-aspartate receptor clustering" evidence=ISS]
            [GO:1900451 "positive regulation of glutamate receptor signaling
            pathway" evidence=ISS] [GO:0051968 "positive regulation of synaptic
            transmission, glutamatergic" evidence=ISS] [GO:0060999 "positive
            regulation of dendritic spine development" evidence=ISS]
            [GO:0061001 "regulation of dendritic spine morphogenesis"
            evidence=ISS] [GO:0097113
            "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptor
            clustering" evidence=ISS] [GO:2000463 "positive regulation of
            excitatory postsynaptic membrane potential" evidence=ISS]
            [GO:1900452 "regulation of long term synaptic depression"
            evidence=ISS] [GO:0008022 "protein C-terminus binding"
            evidence=ISS] [GO:0035255 "ionotropic glutamate receptor binding"
            evidence=ISS] [GO:0005886 "plasma membrane" evidence=ISS]
            [GO:0044309 "neuron spine" evidence=ISS] [GO:0007612 "learning"
            evidence=ISS] [GO:0050885 "neuromuscular process controlling
            balance" evidence=ISS] [GO:0097117 "guanylate kinase-associated
            protein clustering" evidence=ISS] [GO:0051835 "positive regulation
            of synapse structural plasticity" evidence=ISS] [GO:0048854 "brain
            morphogenesis" evidence=ISS] [GO:0021773 "striatal medium spiny
            neuron differentiation" evidence=ISS] [GO:2000822 "regulation of
            behavioral fear response" evidence=ISS] [GO:0035641 "locomotory
            exploration behavior" evidence=ISS] [GO:0048170 "positive
            regulation of long-term neuronal synaptic plasticity" evidence=ISS]
            [GO:0045794 "negative regulation of cell volume" evidence=ISS]
            [GO:0060997 "dendritic spine morphogenesis" evidence=ISS]
            [GO:2000969 "positive regulation of
            alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective
            glutamate receptor activity" evidence=ISS] [GO:0071625
            "vocalization behavior" evidence=ISS] [GO:0097110 "scaffold protein
            binding" evidence=ISS] [GO:0014069 "postsynaptic density"
            evidence=ISS] [GO:0030160 "GKAP/Homer scaffold activity"
            evidence=ISS] [GO:0043005 "neuron projection" evidence=ISS]
            [GO:0097107 "postsynaptic density assembly" evidence=ISS]
            [GO:0035176 "social behavior" evidence=ISS] Pfam:PF00595
            InterPro:IPR002110 InterPro:IPR001452 InterPro:IPR001478
            InterPro:IPR001660 PROSITE:PS50002 PROSITE:PS50088 PROSITE:PS50105
            PROSITE:PS50106 SMART:SM00228 SMART:SM00248 SMART:SM00326
            SMART:SM00454 GO:GO:0005737 GO:GO:0014069 eggNOG:COG0666
            GO:GO:0007613 GO:GO:0030054 GO:GO:0045211 GO:GO:0007612
            Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796 SUPFAM:SSF48403
            PROSITE:PS50297 GO:GO:0050885 GO:GO:0051968 SUPFAM:SSF50044
            GO:GO:0035176 Gene3D:1.10.150.50 InterPro:IPR013761
            InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769 GO:GO:0008022
            SUPFAM:SSF50156 InterPro:IPR011511 Pfam:PF07653 GO:GO:0060170
            Orphanet:106 GO:GO:0048854 GO:GO:0021773
            Pathway_Interaction_DB:ret_pathway GO:GO:0048170 GO:GO:0035255
            GO:GO:0061001 GO:GO:0051835 GO:GO:0071625 GO:GO:0035641
            Orphanet:3140 GO:GO:0097110 GO:GO:0097113 GO:GO:0060997
            GO:GO:2000463 GO:GO:0060999 GO:GO:0030160 GO:GO:0045794
            GO:GO:0097114 GO:GO:2000969 GO:GO:1900271 GO:GO:0097117
            GO:GO:0097107 KO:K15009 HOVERGEN:HBG054027 EMBL:AC000050
            EMBL:AC000036 EMBL:AB051437 EMBL:AK074038 IPI:IPI00019794
            IPI:IPI00847618 RefSeq:NP_277052.1 UniGene:Hs.149035
            ProteinModelPortal:Q9BYB0 SMR:Q9BYB0 DIP:DIP-52267N IntAct:Q9BYB0
            MINT:MINT-4134553 STRING:Q9BYB0 PhosphoSite:Q9BYB0 DMDM:148887434
            PaxDb:Q9BYB0 PRIDE:Q9BYB0 GeneID:85358 KEGG:hsa:85358
            UCSC:uc003bnf.1 CTD:85358 GeneCards:GC22P051112 HGNC:HGNC:14294
            HPA:HPA003446 MIM:606230 MIM:613950 neXtProt:NX_Q9BYB0
            Orphanet:48652 InParanoid:Q9BYB0 ChiTaRS:SHANK3 CleanEx:HS_SHANK3
            Genevestigator:Q9BYB0 GermOnline:ENSG00000099882 GO:GO:1900451
            GO:GO:2000822 GO:GO:1900452 Uniprot:Q9BYB0
        Length = 1741

 Score = 133 (51.9 bits), Expect = 2.8e-07, P = 2.8e-07
 Identities = 26/43 (60%), Positives = 32/43 (74%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFN--GPVGYLEF 59
             ++  NYGLF PP+ G+AGKFLDEER L +YP N   P+ YLEF
Sbjct:    48 QDALNYGLFQPPSRGRAGKFLDEERLLQEYPPNLDTPLPYLEF 90


>UNIPROTKB|F2Z3L0 [details] [associations]
            symbol:SHANK3 "SH3 and multiple ankyrin repeat domains
            protein 3" species:9606 "Homo sapiens" [GO:0000165 "MAPK cascade"
            evidence=IEA] [GO:0001838 "embryonic epithelial tube formation"
            evidence=IEA] [GO:0007612 "learning" evidence=IEA] [GO:0007613
            "memory" evidence=IEA] [GO:0008022 "protein C-terminus binding"
            evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0014069 "postsynaptic density" evidence=IEA] [GO:0017124 "SH3
            domain binding" evidence=IEA] [GO:0021773 "striatal medium spiny
            neuron differentiation" evidence=IEA] [GO:0030160 "GKAP/Homer
            scaffold activity" evidence=IEA] [GO:0032232 "negative regulation
            of actin filament bundle assembly" evidence=IEA] [GO:0035176
            "social behavior" evidence=IEA] [GO:0035255 "ionotropic glutamate
            receptor binding" evidence=IEA] [GO:0035641 "locomotory exploration
            behavior" evidence=IEA] [GO:0042802 "identical protein binding"
            evidence=IEA] [GO:0043621 "protein self-association" evidence=IEA]
            [GO:0045794 "negative regulation of cell volume" evidence=IEA]
            [GO:0048170 "positive regulation of long-term neuronal synaptic
            plasticity" evidence=IEA] [GO:0048854 "brain morphogenesis"
            evidence=IEA] [GO:0050885 "neuromuscular process controlling
            balance" evidence=IEA] [GO:0051259 "protein oligomerization"
            evidence=IEA] [GO:0051835 "positive regulation of synapse
            structural plasticity" evidence=IEA] [GO:0051968 "positive
            regulation of synaptic transmission, glutamatergic" evidence=IEA]
            [GO:0060170 "cilium membrane" evidence=IEA] [GO:0060997 "dendritic
            spine morphogenesis" evidence=IEA] [GO:0060999 "positive regulation
            of dendritic spine development" evidence=IEA] [GO:0061001
            "regulation of dendritic spine morphogenesis" evidence=IEA]
            [GO:0071625 "vocalization behavior" evidence=IEA] [GO:0097107
            "postsynaptic density assembly" evidence=IEA] [GO:0097110 "scaffold
            protein binding" evidence=IEA] [GO:0097113
            "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptor
            clustering" evidence=IEA] [GO:0097114 "N-methyl-D-aspartate
            receptor clustering" evidence=IEA] [GO:0097117 "guanylate
            kinase-associated protein clustering" evidence=IEA] [GO:1900271
            "regulation of long-term synaptic potentiation" evidence=IEA]
            [GO:1900451 "positive regulation of glutamate receptor signaling
            pathway" evidence=IEA] [GO:1900452 "regulation of long term
            synaptic depression" evidence=IEA] [GO:2000463 "positive regulation
            of excitatory postsynaptic membrane potential" evidence=IEA]
            [GO:2000821 "regulation of grooming behavior" evidence=IEA]
            [GO:2000822 "regulation of behavioral fear response" evidence=IEA]
            [GO:2000969 "positive regulation of
            alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective
            glutamate receptor activity" evidence=IEA] Pfam:PF00595
            InterPro:IPR002110 InterPro:IPR001452 InterPro:IPR001478
            InterPro:IPR001660 PROSITE:PS50002 PROSITE:PS50088 PROSITE:PS50105
            PROSITE:PS50106 SMART:SM00228 SMART:SM00248 SMART:SM00326
            SMART:SM00454 Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796
            SUPFAM:SSF48403 PROSITE:PS50297 SUPFAM:SSF50044 Gene3D:1.10.150.50
            InterPro:IPR013761 InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769
            SUPFAM:SSF50156 InterPro:IPR011511 Pfam:PF07653 EMBL:AC000050
            EMBL:AC000036 IPI:IPI00019794 HGNC:HGNC:14294 ChiTaRS:SHANK3
            OMA:KFIAVKA ProteinModelPortal:F2Z3L0 SMR:F2Z3L0 PRIDE:F2Z3L0
            Ensembl:ENST00000262795 UCSC:uc003bne.1 NextBio:75867
            ArrayExpress:F2Z3L0 Bgee:F2Z3L0 Uniprot:F2Z3L0
        Length = 1747

 Score = 133 (51.9 bits), Expect = 2.8e-07, P = 2.8e-07
 Identities = 26/43 (60%), Positives = 32/43 (74%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFN--GPVGYLEF 59
             ++  NYGLF PP+ G+AGKFLDEER L +YP N   P+ YLEF
Sbjct:    48 QDALNYGLFQPPSRGRAGKFLDEERLLQEYPPNLDTPLPYLEF 90


>WB|WBGene00006444 [details] [associations]
            symbol:shn-1 species:6239 "Caenorhabditis elegans"
            [GO:0040010 "positive regulation of growth rate" evidence=IMP]
            [GO:0007622 "rhythmic behavior" evidence=IGI] [GO:0030421
            "defecation" evidence=IGI] Pfam:PF00595 InterPro:IPR002110
            InterPro:IPR001478 InterPro:IPR001660 PROSITE:PS50088
            PROSITE:PS50105 PROSITE:PS50106 SMART:SM00228 SMART:SM00248
            SMART:SM00454 GO:GO:0040010 eggNOG:COG0666 Gene3D:1.25.40.20
            InterPro:IPR020683 Pfam:PF12796 SUPFAM:SSF48403 PROSITE:PS50297
            Gene3D:1.10.150.50 InterPro:IPR013761 InterPro:IPR021129
            Pfam:PF00536 SUPFAM:SSF47769 SUPFAM:SSF50156 GO:GO:0030421
            GO:GO:0007622 GeneTree:ENSGT00510000046474 EMBL:Z48367
            RefSeq:NP_001254297.1 ProteinModelPortal:B7WN72 SMR:B7WN72
            IntAct:B7WN72 PaxDb:B7WN72 EnsemblMetazoa:C33B4.3c GeneID:174739
            KEGG:cel:CELE_C33B4.3 CTD:174739 WormBase:C33B4.3c
            HOGENOM:HOG000016844 OMA:HETNIAR ArrayExpress:B7WN72 Uniprot:B7WN72
        Length = 1140

 Score = 131 (51.2 bits), Expect = 2.8e-07, P = 2.8e-07
 Identities = 24/39 (61%), Positives = 29/39 (74%)

Query:    20 EGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVGYLE 58
             + FNYGLF PP +G+AGKFL E+R + DYPF   V YLE
Sbjct:    48 QAFNYGLFLPPCDGRAGKFLLEDRTIRDYPFTDCVPYLE 86


>UNIPROTKB|B7WN72 [details] [associations]
            symbol:shn-1 "Protein SHN-1, isoform c" species:6239
            "Caenorhabditis elegans" [GO:0005515 "protein binding"
            evidence=IPI] Pfam:PF00595 InterPro:IPR002110 InterPro:IPR001478
            InterPro:IPR001660 PROSITE:PS50088 PROSITE:PS50105 PROSITE:PS50106
            SMART:SM00228 SMART:SM00248 SMART:SM00454 GO:GO:0040010
            eggNOG:COG0666 Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796
            SUPFAM:SSF48403 PROSITE:PS50297 Gene3D:1.10.150.50
            InterPro:IPR013761 InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769
            SUPFAM:SSF50156 GO:GO:0030421 GO:GO:0007622
            GeneTree:ENSGT00510000046474 EMBL:Z48367 RefSeq:NP_001254297.1
            ProteinModelPortal:B7WN72 SMR:B7WN72 IntAct:B7WN72 PaxDb:B7WN72
            EnsemblMetazoa:C33B4.3c GeneID:174739 KEGG:cel:CELE_C33B4.3
            CTD:174739 WormBase:C33B4.3c HOGENOM:HOG000016844 OMA:HETNIAR
            ArrayExpress:B7WN72 Uniprot:B7WN72
        Length = 1140

 Score = 131 (51.2 bits), Expect = 2.8e-07, P = 2.8e-07
 Identities = 24/39 (61%), Positives = 29/39 (74%)

Query:    20 EGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVGYLE 58
             + FNYGLF PP +G+AGKFL E+R + DYPF   V YLE
Sbjct:    48 QAFNYGLFLPPCDGRAGKFLLEDRTIRDYPFTDCVPYLE 86


>UNIPROTKB|G3X7P4 [details] [associations]
            symbol:SHANK3 "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:2000969 "positive regulation of
            alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective
            glutamate receptor activity" evidence=IEA] [GO:2000822 "regulation
            of behavioral fear response" evidence=IEA] [GO:2000821 "regulation
            of grooming behavior" evidence=IEA] [GO:2000463 "positive
            regulation of excitatory postsynaptic membrane potential"
            evidence=IEA] [GO:1900452 "regulation of long term synaptic
            depression" evidence=IEA] [GO:1900451 "positive regulation of
            glutamate receptor signaling pathway" evidence=IEA] [GO:1900271
            "regulation of long-term synaptic potentiation" evidence=IEA]
            [GO:0097117 "guanylate kinase-associated protein clustering"
            evidence=IEA] [GO:0097114 "N-methyl-D-aspartate receptor
            clustering" evidence=IEA] [GO:0097113
            "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptor
            clustering" evidence=IEA] [GO:0097110 "scaffold protein binding"
            evidence=IEA] [GO:0097107 "postsynaptic density assembly"
            evidence=IEA] [GO:0071625 "vocalization behavior" evidence=IEA]
            [GO:0061001 "regulation of dendritic spine morphogenesis"
            evidence=IEA] [GO:0060999 "positive regulation of dendritic spine
            development" evidence=IEA] [GO:0060997 "dendritic spine
            morphogenesis" evidence=IEA] [GO:0051968 "positive regulation of
            synaptic transmission, glutamatergic" evidence=IEA] [GO:0051835
            "positive regulation of synapse structural plasticity"
            evidence=IEA] [GO:0050885 "neuromuscular process controlling
            balance" evidence=IEA] [GO:0048854 "brain morphogenesis"
            evidence=IEA] [GO:0048170 "positive regulation of long-term
            neuronal synaptic plasticity" evidence=IEA] [GO:0045794 "negative
            regulation of cell volume" evidence=IEA] [GO:0044309 "neuron spine"
            evidence=IEA] [GO:0035641 "locomotory exploration behavior"
            evidence=IEA] [GO:0035255 "ionotropic glutamate receptor binding"
            evidence=IEA] [GO:0035176 "social behavior" evidence=IEA]
            [GO:0032232 "negative regulation of actin filament bundle assembly"
            evidence=IEA] [GO:0021773 "striatal medium spiny neuron
            differentiation" evidence=IEA] [GO:0008022 "protein C-terminus
            binding" evidence=IEA] [GO:0007613 "memory" evidence=IEA]
            [GO:0007612 "learning" evidence=IEA] [GO:0005886 "plasma membrane"
            evidence=IEA] [GO:0001838 "embryonic epithelial tube formation"
            evidence=IEA] [GO:0000165 "MAPK cascade" evidence=IEA] Pfam:PF00595
            InterPro:IPR002110 InterPro:IPR001452 InterPro:IPR001478
            InterPro:IPR001660 PROSITE:PS50002 PROSITE:PS50088 PROSITE:PS50105
            PROSITE:PS50106 SMART:SM00228 SMART:SM00248 SMART:SM00326
            SMART:SM00454 GO:GO:0005886 GO:GO:0000165 GO:GO:0007613
            GO:GO:0007612 Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796
            SUPFAM:SSF48403 PROSITE:PS50297 GO:GO:0050885 GO:GO:0051968
            SUPFAM:SSF50044 GO:GO:0035176 Gene3D:1.10.150.50 InterPro:IPR013761
            InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769 SUPFAM:SSF50156
            InterPro:IPR011511 Pfam:PF07653 GO:GO:0048854 GO:GO:0021773
            GO:GO:0048170 GO:GO:0061001 GO:GO:0051835 GO:GO:0071625
            GO:GO:0035641 GO:GO:0097113 GO:GO:0060997 GO:GO:2000463
            GO:GO:2000821 GO:GO:0060999 GO:GO:0045794 GO:GO:0032232
            GO:GO:0097114 GO:GO:2000969 GO:GO:1900271 GO:GO:0097117
            GO:GO:0044309 GO:GO:0097107 GO:GO:0001838
            GeneTree:ENSGT00510000046474 GO:GO:1900451 GO:GO:2000822
            GO:GO:1900452 OMA:KFIAVKA EMBL:DAAA02015062 EMBL:DAAA02015063
            EMBL:DAAA02015064 EMBL:DAAA02015065 EMBL:DAAA02015066
            Ensembl:ENSBTAT00000042578 Uniprot:G3X7P4
        Length = 1697

 Score = 127 (49.8 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 25/42 (59%), Positives = 31/42 (73%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFN--GPVGYLE 58
             ++  NYGLF PP+ G+AGKFLDEER L +YP N   P+ YLE
Sbjct:    27 QDALNYGLFQPPSRGRAGKFLDEERLLQEYPPNLDTPLPYLE 68


>UNIPROTKB|C9JFP8 [details] [associations]
            symbol:SHANK2 "SH3 and multiple ankyrin repeat domains
            protein 2" species:9606 "Homo sapiens" [GO:0001750 "photoreceptor
            outer segment" evidence=IEA] [GO:0001917 "photoreceptor inner
            segment" evidence=IEA] [GO:0005883 "neurofilament" evidence=IEA]
            [GO:0008328 "ionotropic glutamate receptor complex" evidence=IEA]
            [GO:0035255 "ionotropic glutamate receptor binding" evidence=IEA]
            [GO:0043197 "dendritic spine" evidence=IEA] [GO:0045211
            "postsynaptic membrane" evidence=IEA] InterPro:IPR002110
            PROSITE:PS50088 SMART:SM00248 GO:GO:0014069 GO:GO:0007420
            GO:GO:0043025 Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796
            SUPFAM:SSF48403 PROSITE:PS50297 GO:GO:0030426 HOGENOM:HOG000293276
            EMBL:AP000590 EMBL:AP001271 EMBL:AP003783 EMBL:AP005401
            HGNC:HGNC:14295 EMBL:AP001648 EMBL:AP003967 EMBL:AP004370
            IPI:IPI00854885 SMR:C9JFP8 STRING:C9JFP8 Ensembl:ENST00000413503
            Ensembl:ENST00000457074 Uniprot:C9JFP8
        Length = 304

 Score = 113 (44.8 bits), Expect = 3.5e-06, P = 3.5e-06
 Identities = 23/37 (62%), Positives = 27/37 (72%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVG 55
             K+  NYGLF P +NG+ GKFLDEER L +YP   PVG
Sbjct:    96 KDVLNYGLFQPASNGRDGKFLDEERLLREYP--QPVG 130


>UNIPROTKB|E1C3V2 [details] [associations]
            symbol:SHANK2 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0001750 "photoreceptor outer segment"
            evidence=IEA] [GO:0001917 "photoreceptor inner segment"
            evidence=IEA] [GO:0005883 "neurofilament" evidence=IEA] [GO:0008328
            "ionotropic glutamate receptor complex" evidence=IEA] [GO:0035255
            "ionotropic glutamate receptor binding" evidence=IEA] [GO:0043197
            "dendritic spine" evidence=IEA] [GO:0045211 "postsynaptic membrane"
            evidence=IEA] Pfam:PF00595 InterPro:IPR002110 InterPro:IPR001452
            InterPro:IPR001478 InterPro:IPR001660 PROSITE:PS50002
            PROSITE:PS50088 PROSITE:PS50105 PROSITE:PS50106 SMART:SM00228
            SMART:SM00248 SMART:SM00326 SMART:SM00454 Gene3D:1.25.40.20
            InterPro:IPR020683 Pfam:PF12796 SUPFAM:SSF48403 PROSITE:PS50297
            SUPFAM:SSF50044 Gene3D:1.10.150.50 InterPro:IPR013761
            InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769 SUPFAM:SSF50156
            InterPro:IPR011511 Pfam:PF07653 GeneTree:ENSGT00510000046474
            OMA:KMRPSVE EMBL:AADN02050814 EMBL:AADN02050815 EMBL:AADN02050816
            EMBL:AADN02050817 EMBL:AADN02050818 EMBL:AADN02050819
            EMBL:AADN02050820 EMBL:AADN02050821 EMBL:AADN02050822
            EMBL:AADN02050823 EMBL:AADN02050824 EMBL:AADN02050825
            EMBL:AADN02050826 EMBL:AADN02050827 EMBL:AADN02050828
            EMBL:AADN02050829 EMBL:AADN02050830 EMBL:AADN02050831
            EMBL:AADN02050832 EMBL:AADN02050833 EMBL:AADN02050834
            EMBL:AADN02050835 EMBL:AADN02050836 EMBL:AADN02050837
            EMBL:AADN02050838 EMBL:AADN02050839 EMBL:AADN02050840
            EMBL:AADN02050841 EMBL:AADN02073626 EMBL:AADN02073627
            IPI:IPI00572569 ProteinModelPortal:E1C3V2
            Ensembl:ENSGALT00000012514 Uniprot:E1C3V2
        Length = 1841

 Score = 114 (45.2 bits), Expect = 3.1e-05, P = 3.1e-05
 Identities = 25/43 (58%), Positives = 29/43 (67%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYP--FNGPVGYLEF 59
             K+  NYGLF P +NG+ GKFLDEER L +YP   N  V  LEF
Sbjct:    95 KDVLNYGLFQPASNGRDGKFLDEERLLREYPQPVNKGVPSLEF 137


>UNIPROTKB|A6NHU9 [details] [associations]
            symbol:SHANK2 "SH3 and multiple ankyrin repeat domains
            protein 2" species:9606 "Homo sapiens" [GO:0001750 "photoreceptor
            outer segment" evidence=IEA] [GO:0001917 "photoreceptor inner
            segment" evidence=IEA] [GO:0005883 "neurofilament" evidence=IEA]
            [GO:0008328 "ionotropic glutamate receptor complex" evidence=IEA]
            [GO:0035255 "ionotropic glutamate receptor binding" evidence=IEA]
            [GO:0043197 "dendritic spine" evidence=IEA] [GO:0045211
            "postsynaptic membrane" evidence=IEA] Pfam:PF00595
            InterPro:IPR002110 InterPro:IPR001452 InterPro:IPR001478
            InterPro:IPR001660 PROSITE:PS50002 PROSITE:PS50088 PROSITE:PS50105
            PROSITE:PS50106 SMART:SM00228 SMART:SM00248 SMART:SM00326
            SMART:SM00454 GO:GO:0014069 GO:GO:0007420 GO:GO:0043025
            Gene3D:1.25.40.20 InterPro:IPR020683 Pfam:PF12796 SUPFAM:SSF48403
            PROSITE:PS50297 GO:GO:0030426 SUPFAM:SSF50044 Gene3D:1.10.150.50
            InterPro:IPR013761 InterPro:IPR021129 Pfam:PF00536 SUPFAM:SSF47769
            SUPFAM:SSF50156 InterPro:IPR011511 Pfam:PF07653
            HOGENOM:HOG000293276 EMBL:AP000590 EMBL:AP001271 EMBL:AP003783
            EMBL:AP005401 IPI:IPI00952742 HGNC:HGNC:14295 HOVERGEN:HBG054027
            EMBL:AP001648 EMBL:AP003967 EMBL:AP004370 ProteinModelPortal:A6NHU9
            SMR:A6NHU9 STRING:A6NHU9 PRIDE:A6NHU9 Ensembl:ENST00000338508
            OMA:KMRPSVE ArrayExpress:A6NHU9 Bgee:A6NHU9 Uniprot:A6NHU9
        Length = 1850

 Score = 113 (44.8 bits), Expect = 4.0e-05, P = 4.0e-05
 Identities = 23/37 (62%), Positives = 27/37 (72%)

Query:    19 KEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVG 55
             K+  NYGLF P +NG+ GKFLDEER L +YP   PVG
Sbjct:    96 KDVLNYGLFQPASNGRDGKFLDEERLLREYP--QPVG 130


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.322   0.146   0.482    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       59        59   0.00091  102 3  12 22  0.40    28
                                                     29  0.49    27


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  12
  No. of states in DFA:  374 (40 KB)
  Total size of DFA:  65 KB (2061 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  5.02u 0.15s 5.17t   Elapsed:  00:00:00
  Total cpu time:  5.02u 0.15s 5.17t   Elapsed:  00:00:00
  Start:  Thu Aug 15 11:28:40 2013   End:  Thu Aug 15 11:28:40 2013

Back to top