Diaphorina citri psyllid: psy15933


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------6
MQGTNFNATFKTYWFTEFKEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVGYLEF
cccccccCEEEEEEEcccccccccCCccccccccccccccHHccccccccccccccccc
*****FNATFKTYWFTEFKEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVGYLEF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGTNFNATFKTYWFTEFKEGFNYGLFYPPANGKAGKFLDEERRLGDYPFNGPVGYLEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SH3 and multiple ankyrin repeat domains protein 3 Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors via complexes with GKAP/PSD-95 and Homer, respectively, and the actin-based cytoskeleton. May play a role in the structural and functional organization of the dendritic spine and synaptic junction.confidentQ4ACU6
SH3 and multiple ankyrin repeat domains protein 3 Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors via complexes with GKAP/PSD-95 and Homer, respectively, and the actin-based cytoskeleton. May play a role in the structural and functional organization of the dendritic spine and synaptic junction.confidentQ9BYB0
SH3 and multiple ankyrin repeat domains protein 3 Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors via complexes with GKAP/PSD-95 and Homer, respectively, and the actin-based cytoskeleton. May play a role in the structural and functional organization of the dendritic spine and synaptic junction.confidentQ9JLU4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030160 [MF]GKAP/Homer scaffold activityprobableGO:0030159, GO:0005198, GO:0003674, GO:0005488, GO:0005515, GO:0032947
GO:0032232 [BP]negative regulation of actin filament bundle assemblyprobableGO:0032231, GO:0032970, GO:0033043, GO:0051494, GO:0051493, GO:0010639, GO:0051129, GO:0050794, GO:0008150, GO:0044087, GO:0065007, GO:0044763, GO:0044699, GO:0032956, GO:0048519, GO:0009987, GO:0051128, GO:0050789, GO:0048523
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0060170 [CC]cilium membraneprobableGO:0043229, GO:0071944, GO:0005929, GO:0043227, GO:0043226, GO:0044446, GO:0031090, GO:0031514, GO:0016020, GO:0044459, GO:0031253, GO:0005886, GO:0042995, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044425, GO:0044422
GO:0097107 [BP]postsynaptic density assemblyprobableGO:0006996, GO:0032502, GO:0050808, GO:0007010, GO:0044707, GO:0007399, GO:0032501, GO:0071840, GO:0009987, GO:0048856, GO:0097106, GO:0016043, GO:0008150, GO:0022607, GO:0044763, GO:0044699, GO:0048731, GO:0007275, GO:0007416, GO:0044085
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IVF, chain A
Confidence level:confident
Coverage over the Query: 18-51
View the alignment between query and template
View the model in PyMOL