Diaphorina citri psyllid: psy15974


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MSHCNVNCFDNGAPKYFLDRQIVSIFIFTRYANEVGEAFRAVVHRQVVNASYGIASLYVLADVTAKTIQAWHSTEHNAGRVAKIGIDALLWQSLASVAVPGLAINRICYLSRALFARWRQGQVATVVTGLVSIPCVIHPIDWAVTEAMDLTVRPYLLHVRVNKEE
ccccccccccccccccccccHHccHHHHHHHHHHHHHHccccccccEEEEcEEEEEEEEEHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHcccccccEEEEccEEcccccccccHHHHHHHHHHHHHHHHcccccccc
*****VNCFDNGAPKYFLDRQIVSIFIFTRYANEVGEAFRAVVHRQVVNASYGIASLYVLADVTAKTIQAWHSTEHNAGRVAKIGIDALLWQSLASVAVPGLAINRICYLSRALFARWRQGQVATVVTGLVSIPCVIHPIDWAVTEAMDLTVRPYLLHVRV****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHCNVNCFDNGAPKYFLDRQIVSIFIFTRYANEVGEAFRAVVHRQVVNASYGIASLYVLADVTAKTIQAWHSTEHNAGRVAKIGIDALLWQSLASVAVPGLAINRICYLSRALFARWRQGQVATVVTGLVSIPCVIHPIDWAVTEAMDLTVRPYLLHVRVNKEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial fission process protein 1 Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function leads to apoptosis.confidentQ6PCS6
Mitochondrial fission process protein 1 Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function leads to apoptosis.confidentQ8T3C8
Mitochondrial fission process protein 1 Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.confidentQ9UDX5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000266 [BP]mitochondrial fissionprobableGO:0006996, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0048285, GO:0008150, GO:0007005, GO:0044699
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted