Diaphorina citri psyllid: psy16008

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MIQIGVSATFIGLFTLHQPTKLYVLQHPGMFWIAFIAMFVTLICITCCESVRRSSPMNVIFLGIFTLAECTFCNTLACSGSRSSPCLSRSFVSRASVRRSSPMNVIFLGIFTLAESFLLGVISSRYNAEYVFYAAVITCVICLALTIFAFQTKIDFTMMGGILFVCVIVLMIFGIVMIFFHGKVMTLIYASLGAILFSVYLIYDTQLMIGASLNLYLDVINIFLSILQILGAANSD
ccHHHHHHHHHHHHEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MIQIGVSATFIGLFTLHQPTKLYVLQHPGMFWIAFIAMFVTLICITCCESVRRSSPMNVIFLGIFTLAECTFCNTLACSGSRSSPCLSRSFVSRASVRRSSPMNVIFLGIFTLAESFLLGVISSRYNAEYVFYAAVITCVICLALTIFAFQTKIDFTMMGGILFVCVIVLMIFGIVMIFFHGKVMTLIYASLGAILFSVYLIYDTQLMIGASLNLYLDVINIFLSILQILGA****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQIGVSATFIGLFTLHQPTKLYVLQHPGMFWIAFIAMFVTLICITCCESVRRSSPMNVIFLGIFTLAECTFCNTLACSGSRSSPCLSRSFVSRASVRRSSPMNVIFLGIFTLAESFLLGVISSRYNAEYVFYAAVITCVICLALTIFAFQTKIDFTMMGGILFVCVIVLMIFGIVMIFFHGKVMTLIYASLGAILFSVYLIYDTQLMIGASLNLYLDVINIFLSILQILGAANSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted