Query         psy16017
Match_columns 85
No_of_seqs    76 out of 78
Neff          2.9 
Searched_HMMs 46136
Date          Fri Aug 16 18:48:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16017.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16017hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3938|consensus               99.9 6.3E-28 1.4E-32  191.5   7.6   83    1-84      1-93  (334)
  2 cd01807 GDX_N ubiquitin-like d  76.0     1.5 3.3E-05   26.6   1.1   26   59-84     16-41  (74)
  3 PF11543 UN_NPL4:  Nuclear pore  71.8     3.1 6.8E-05   26.8   1.9   24   60-83     20-43  (80)
  4 cd01791 Ubl5 UBL5 ubiquitin-li  70.8     2.2 4.8E-05   26.8   1.0   27   59-85     17-43  (73)
  5 PF00240 ubiquitin:  Ubiquitin   69.9     3.2 6.9E-05   24.3   1.5   26   59-84     11-36  (69)
  6 cd01803 Ubiquitin Ubiquitin. U  68.5       3 6.4E-05   24.6   1.1   26   59-84     16-41  (76)
  7 cd01804 midnolin_N Ubiquitin-l  67.6     3.3 7.1E-05   25.8   1.2   25   60-84     18-42  (78)
  8 cd01794 DC_UbP_C dendritic cel  67.4     2.8 6.1E-05   25.9   0.9   26   59-84     14-39  (70)
  9 cd01793 Fubi Fubi ubiquitin-li  67.0     3.2   7E-05   25.2   1.1   26   59-84     14-39  (74)
 10 cd01808 hPLIC_N Ubiquitin-like  66.3     3.3 7.3E-05   24.9   1.1   25   60-84     16-40  (71)
 11 cd01792 ISG15_repeat1 ISG15 ub  64.4     3.8 8.2E-05   25.4   1.1   25   60-84     19-43  (80)
 12 cd01796 DDI1_N DNA damage indu  64.2     3.9 8.4E-05   25.0   1.1   26   59-84     15-40  (71)
 13 cd01810 ISG15_repeat2 ISG15 ub  63.1     4.4 9.6E-05   24.6   1.2   26   59-84     14-39  (74)
 14 cd01806 Nedd8 Nebb8-like  ubiq  61.9     5.9 0.00013   23.3   1.6   25   60-84     17-41  (76)
 15 cd00196 UBQ Ubiquitin-like pro  60.4     6.5 0.00014   19.7   1.4   24   61-84     15-38  (69)
 16 PF02071 NSF:  Aromatic-di-Alan  59.4       5 0.00011   18.5   0.7   10   68-77      3-12  (12)
 17 cd01798 parkin_N amino-termina  59.0     5.2 0.00011   23.9   1.0   25   60-84     15-39  (70)
 18 cd01802 AN1_N ubiquitin-like d  58.4     5.9 0.00013   26.4   1.3   39   44-84     29-68  (103)
 19 cd01812 BAG1_N Ubiquitin-like   55.8     8.5 0.00018   22.5   1.5   25   60-84     16-40  (71)
 20 PF14552 Tautomerase_2:  Tautom  54.1       7 0.00015   25.4   1.0   19   66-84     45-67  (82)
 21 PF14645 Chibby:  Chibby family  53.2      34 0.00073   23.7   4.4   32   44-75     51-85  (116)
 22 smart00760 Bac_DnaA_C Bacteria  53.1     5.8 0.00013   23.6   0.5   20   65-84      1-20  (60)
 23 PF13647 Glyco_hydro_80:  Glyco  53.0     7.3 0.00016   31.3   1.2   24   44-68    201-224 (308)
 24 cd01805 RAD23_N Ubiquitin-like  52.7     9.5 0.00021   22.8   1.4   25   60-84     17-43  (77)
 25 PRK01964 4-oxalocrotonate taut  52.2     8.4 0.00018   22.7   1.1   18   67-84     22-39  (64)
 26 PRK10219 DNA-binding transcrip  51.5     6.9 0.00015   24.8   0.7   25   61-85     80-104 (107)
 27 smart00213 UBQ Ubiquitin homol  50.9      10 0.00022   21.1   1.3   26   59-84     15-40  (64)
 28 cd01797 NIRF_N amino-terminal   50.8     8.6 0.00019   24.2   1.0   25   60-84     19-43  (78)
 29 smart00342 HTH_ARAC helix_turn  50.8      14 0.00031   20.9   1.9   26   60-85     59-84  (84)
 30 PRK02220 4-oxalocrotonate taut  50.7     9.1  0.0002   22.1   1.1   17   68-84     23-39  (61)
 31 PF07027 DUF1318:  Protein of u  50.3     5.2 0.00011   27.1  -0.1   18   67-84     50-67  (95)
 32 PF01337 Barstar:  Barstar (bar  50.2      14  0.0003   23.2   1.9   22   60-81      5-26  (90)
 33 cd06398 PB1_Joka2 The PB1 doma  49.9      15 0.00032   24.4   2.1   17   65-81     26-42  (91)
 34 KOG3889|consensus               48.6      12 0.00026   31.3   1.8   37   42-79    202-241 (371)
 35 PTZ00044 ubiquitin; Provisiona  48.1      11 0.00024   22.5   1.2   26   59-84     16-41  (76)
 36 PF14338 Mrr_N:  Mrr N-terminal  47.9       9  0.0002   24.4   0.8   20   64-83     20-39  (92)
 37 cd01809 Scythe_N Ubiquitin-lik  47.9      12 0.00026   21.7   1.3   25   60-84     17-41  (72)
 38 PF12833 HTH_18:  Helix-turn-he  47.4     5.5 0.00012   23.8  -0.2   26   60-85     54-79  (81)
 39 PF14566 PTPlike_phytase:  Inos  46.9     8.1 0.00018   26.8   0.5   10   42-51    124-133 (149)
 40 TIGR00013 taut 4-oxalocrotonat  46.6      16 0.00035   21.1   1.7   19   66-84     21-39  (63)
 41 cd05875 Ig6_hNeurofascin_like   43.2      15 0.00032   22.2   1.2   20   45-65      1-20  (77)
 42 PF05099 TerB:  Tellurite resis  41.8      20 0.00043   23.4   1.7   21   65-85    116-136 (140)
 43 PF08281 Sigma70_r4_2:  Sigma-7  41.2     5.1 0.00011   22.6  -1.0   16   69-84     28-43  (54)
 44 cd05140 Barstar_AU1054-like Ba  41.1      24 0.00051   23.1   2.0   22   60-81      5-26  (86)
 45 COG2169 Ada Adenosine deaminas  40.5      13 0.00028   28.3   0.7   36   49-84    140-178 (187)
 46 PF12085 DUF3562:  Protein of u  40.4      10 0.00022   24.8   0.1   22   64-85      4-25  (66)
 47 cd05142 Barstar Barstar is an   40.4      25 0.00054   23.0   2.0   21   61-81      7-27  (87)
 48 cd05141 Barstar_evA4336-like B  38.7      28 0.00061   21.9   2.0   22   60-81      5-26  (81)
 49 cd05749 Ig2_Tyro3_like Second   38.0      21 0.00046   22.2   1.4   18   43-61     14-32  (81)
 50 cd06406 PB1_P67 A PB1 domain i  36.7      28 0.00061   23.2   1.9   21   64-84     21-41  (80)
 51 COG2411 Uncharacterized conser  36.4      20 0.00044   27.6   1.3   21   58-78     71-91  (188)
 52 cd00491 4Oxalocrotonate_Tautom  36.2      30 0.00065   19.4   1.7   18   67-84     21-38  (58)
 53 PF08769 Spo0A_C:  Sporulation   35.9     7.5 0.00016   26.4  -1.0   19   66-84     39-57  (106)
 54 PRK11511 DNA-binding transcrip  35.8      16 0.00034   24.4   0.5   25   61-85     84-108 (127)
 55 cd01799 Hoil1_N Ubiquitin-like  35.5      23 0.00051   22.2   1.3   26   59-84     18-43  (75)
 56 cd01769 UBL Ubiquitin-like dom  34.0      30 0.00065   19.4   1.5   23   62-84     16-38  (69)
 57 cd02984 TRX_PICOT TRX domain,   33.9      38 0.00082   20.2   2.0   30   41-74     68-97  (97)
 58 cd00489 Barstar_like Barstar i  33.9      37 0.00079   22.0   2.0   21   61-81      6-26  (85)
 59 PF11000 DUF2840:  Protein of u  33.8      27 0.00059   26.0   1.5   26   59-84     87-114 (149)
 60 PRK09685 DNA-binding transcrip  33.2      19 0.00041   26.2   0.6   25   61-85    274-298 (302)
 61 PF12872 OST-HTH:  OST-HTH/LOTU  32.9      24 0.00052   20.8   1.0   19   61-79     45-63  (74)
 62 PF11784 DUF3320:  Protein of u  32.8      34 0.00073   20.4   1.6   20   62-81     25-44  (52)
 63 cd01763 Sumo Small ubiquitin-r  32.7      29 0.00062   21.9   1.3   41   43-85     12-53  (87)
 64 PF05402 PqqD:  Coenzyme PQQ sy  32.4      13 0.00028   21.8  -0.3   25   60-84     26-50  (68)
 65 PF13443 HTH_26:  Cro/C1-type H  32.0      17 0.00036   20.9   0.2   17   68-84     41-57  (63)
 66 cd06409 PB1_MUG70 The MUG70 pr  32.0      32  0.0007   22.9   1.6   28   55-82      7-39  (86)
 67 PF13560 HTH_31:  Helix-turn-he  30.3      16 0.00035   21.4  -0.1   18   67-84     44-61  (64)
 68 smart00530 HTH_XRE Helix-turn-  29.0      48   0.001   16.3   1.6   17   67-83     39-55  (56)
 69 PF10668 Phage_terminase:  Phag  29.0      18 0.00039   22.9  -0.0   22   64-85     10-40  (60)
 70 PRK12534 RNA polymerase sigma   28.9      21 0.00045   24.2   0.2   20   60-84    151-170 (187)
 71 PF00432 Prenyltrans:  Prenyltr  28.8      25 0.00054   19.5   0.5   31   44-74      8-38  (44)
 72 smart00386 HAT HAT (Half-A-TPR  28.7      33 0.00072   16.1   0.9   18   62-79      2-19  (33)
 73 PF14109 GldH_lipo:  GldH lipop  26.3      17 0.00036   25.1  -0.6   23   44-68     67-91  (131)
 74 cd01800 SF3a120_C Ubiquitin-li  25.6      42 0.00091   20.5   1.2   24   60-83     14-37  (76)
 75 PF10542 Vitelline_membr:  Vite  25.3      51  0.0011   19.7   1.4   13   39-51      5-17  (38)
 76 PHA01976 helix-turn-helix prot  25.1      27 0.00058   20.2   0.2   17   68-84     45-61  (67)
 77 cd05895 Ig_Pro_neuregulin-1 Im  24.8      33 0.00072   19.9   0.6   24   45-68      1-24  (76)
 78 PF12844 HTH_19:  Helix-turn-he  24.7      22 0.00049   20.4  -0.2   17   68-84     42-58  (64)
 79 PF01381 HTH_3:  Helix-turn-hel  24.3      14 0.00031   20.5  -1.0   15   69-83     40-54  (55)
 80 PRK15435 bifunctional DNA-bind  24.1      48   0.001   26.4   1.5   25   61-85    157-181 (353)
 81 KOG4812|consensus               24.0      28 0.00062   28.0   0.2   65   10-74     20-84  (262)
 82 PF11976 Rad60-SLD:  Ubiquitin-  23.9      64  0.0014   18.9   1.7   26   59-84     16-42  (72)
 83 PRK02289 4-oxalocrotonate taut  23.8      54  0.0012   19.3   1.4   19   66-84     21-39  (60)
 84 cd01801 Tsc13_N Ubiquitin-like  23.8      60  0.0013   19.9   1.6   21   63-83     22-43  (77)
 85 TIGR02297 HpaA 4-hydroxyphenyl  23.7      39 0.00085   24.2   0.9   22   62-83    262-283 (287)
 86 cd05876 Ig3_L1-CAM Third immun  23.5      41 0.00088   19.6   0.8   16   45-61      1-16  (71)
 87 cd03409 Chelatase_Class_II Cla  23.1      76  0.0017   19.3   2.0   26   51-77      5-30  (101)
 88 PRK15121 right oriC-binding tr  23.1      37  0.0008   25.1   0.7   25   61-85     80-104 (289)
 89 PF03517 Voldacs:  Regulator of  23.0      50  0.0011   22.7   1.3   19   65-83     91-109 (135)
 90 COG4229 Predicted enolase-phos  22.8      46 0.00099   26.4   1.1   43   41-84    131-180 (229)
 91 PF14560 Ubiquitin_2:  Ubiquiti  22.7      70  0.0015   19.9   1.8   30   55-84     15-44  (87)
 92 PF10685 KGG:  Stress-induced b  22.5      66  0.0014   17.0   1.4   14   62-75      1-15  (23)
 93 PF06971 Put_DNA-bind_N:  Putat  22.4      17 0.00036   22.0  -1.1   17   69-85     30-46  (50)
 94 smart00482 POLAc DNA polymeras  21.9      14 0.00031   26.8  -1.7   33   52-84     30-64  (206)
 95 COG4031 Predicted metal-bindin  21.6      63  0.0014   25.5   1.7   21   47-76     48-68  (227)
 96 PRK13503 transcriptional activ  21.0      37  0.0008   24.2   0.3    6   75-80    260-265 (278)
 97 PF10545 MADF_DNA_bdg:  Alcohol  21.0      33 0.00071   20.1   0.0   19   65-83     24-44  (85)
 98 cd05874 Ig6_NrCAM Sixth immuno  20.9      65  0.0014   19.3   1.3   18   45-63      1-18  (77)
 99 COG2207 AraC AraC-type DNA-bin  20.8      46   0.001   20.1   0.7   24   61-84     95-118 (127)
100 TIGR02408 ectoine_ThpD ectoine  20.7      54  0.0012   24.6   1.1   17   44-60    220-236 (277)
101 smart00266 CAD Domains present  20.5      84  0.0018   20.7   1.9   21   64-84     19-39  (74)
102 PRK11509 hydrogenase-1 operon   20.5 1.3E+02  0.0028   21.3   3.0   37   42-81     92-128 (132)

No 1  
>KOG3938|consensus
Probab=99.95  E-value=6.3e-28  Score=191.46  Aligned_cols=83  Identities=43%  Similarity=0.717  Sum_probs=63.0

Q ss_pred             CCCccCCCCCCCCCCCCCCcCCCCcc----------cccCCCCCCCCCCCCCCceeeeeecccCCCceeccCccchHHHH
Q psy16017          1 MPLFTRKPKKDDHLLDNNNVGEHKSK----------IYNGTKSPAPVTEDSKPKLIFHCQLAHGSPTGLISGFSNVRELY   70 (85)
Q Consensus         1 m~l~~~k~~k~~~~~~~~~~~~~~~~----------~~~g~~~~~p~~~~~~p~LvFh~QLAHGSptg~I~gFsnvkELY   70 (85)
                      |||+.++-+|.-.......--+-.|.          +.++.+ ..+.++..+|+||||||||||||||+|+||+||+|||
T Consensus         1 M~~~~~~~~k~~~~~~~~~a~~~rs~e~~p~~~~~~~s~~~~-s~s~~~~~~p~LvF~~QLAHGSptg~Ie~fsnv~ELY   79 (334)
T KOG3938|consen    1 MPLQGRPSPKSRPRSEGRGAFNARSGETSPLQPGVPISPNEG-SPSIPPAVRPRLVFHCQLAHGSPTGRIEGFSNVRELY   79 (334)
T ss_pred             CCCCCCCCCCCCCccccccccccCCCCCCCCCCCCCCCccCC-CCCCCccCCCceeEeeeeccCCccceecccccHHHHH
Confidence            89998888776665433222111111          112222 2456789999999999999999999999999999999


Q ss_pred             HhhhhhhcCCCCcC
Q psy16017         71 QKIAECYEFPAEEN   84 (85)
Q Consensus        71 ~kIae~f~i~p~e~   84 (85)
                      ++||+||+|+++|+
T Consensus        80 ~kIAe~F~Is~~dI   93 (334)
T KOG3938|consen   80 QKIAEAFDISPDDI   93 (334)
T ss_pred             HHHHHHhcCCccce
Confidence            99999999999986


No 2  
>cd01807 GDX_N ubiquitin-like domain of GDX. GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain.  The function of GDX is unknown.
Probab=75.99  E-value=1.5  Score=26.60  Aligned_cols=26  Identities=23%  Similarity=0.337  Sum_probs=23.0

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|+...+|.+|-+.|++.+++++++.
T Consensus        16 ~v~~~~tV~~lK~~i~~~~gi~~~~q   41 (74)
T cd01807          16 QVSEKESVSTLKKLVSEHLNVPEEQQ   41 (74)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHHe
Confidence            46788999999999999999998764


No 3  
>PF11543 UN_NPL4:  Nuclear pore localisation protein NPL4;  InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway.  Npl4 has a N-terminal ubiquitin-like domain which has within its structure a beta-grasp fold with a helical insert []. This entry represents the ubiquitin-like domain.; PDB: 2PJH_A 1WF9_A.
Probab=71.79  E-value=3.1  Score=26.77  Aligned_cols=24  Identities=29%  Similarity=0.416  Sum_probs=16.8

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCc
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEE   83 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e   83 (85)
                      |+.=+++.+||++|++.++++...
T Consensus        20 ~~~~~t~~~L~~kI~~~l~~~~~~   43 (80)
T PF11543_consen   20 VSPSSTLSDLKEKISEQLSIPDSS   43 (80)
T ss_dssp             E-TTSBHHHHHHHHHHHS---TTT
T ss_pred             cCCcccHHHHHHHHHHHcCCCCcc
Confidence            455678999999999999998764


No 4  
>cd01791 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also known as HUB1) is a ubiquitin-like modifier that is both widely expressed and highly phylogenetically conserved.  At the C-terminal end of the ubiquitin-like fold of UBL5 is a di-tyrosine motif followed by a single variable residue instead of the characteristic di-glycine found in all other ubiquitin-like modifiers.  ULB5 interacts with a cyclin-like kinase called CLK4 but not with other cyclin-like kinase family members.
Probab=70.84  E-value=2.2  Score=26.80  Aligned_cols=27  Identities=15%  Similarity=-0.032  Sum_probs=21.8

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      .|+.=.+|.+|.++|++.++++++..|
T Consensus        17 ~v~~~~TV~~LK~~I~~~~~~~~~~qr   43 (73)
T cd01791          17 KCNPDDTIGDLKKLIAAQTGTRPEKIV   43 (73)
T ss_pred             EeCCCCcHHHHHHHHHHHhCCChHHEE
Confidence            445557799999999999999988653


No 5  
>PF00240 ubiquitin:  Ubiquitin family;  InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade. There are many different E3 ligases, which are responsible for the type of ubiquitin chain formed, the specificity of the target protein, and the regulation of the ubiquitinylation process []. Ubiquitinylation is an important regulatory tool that controls the concentration of key signalling proteins, such as those involved in cell cycle control, as well as removing misfolded, damaged or mutant proteins that could be harmful to the cell. Several ubiquitin-like molecules have been discovered, such as Ufm1 (IPR005375 from INTERPRO), SUMO1 (IPR003653 from INTERPRO), NEDD8, Rad23 (IPR004806 from INTERPRO), Elongin B and Parkin (IPR003977 from INTERPRO), the latter being involved in Parkinson's disease []. Ubiquitin is a protein of 76 amino acid residues, found in all eukaryotic cells and whose sequence is extremely well conserved from protozoan to vertebrates. Ubiquitin acts through its post-translational attachment (ubiquitinylation) to other proteins, where these modifications alter the function, location or trafficking of the protein, or targets it for destruction by the 26S proteasome []. The terminal glycine in the C-terminal 4-residue tail of ubiquitin can form an isopeptide bond with a lysine residue in the target protein, or with a lysine in another ubiquitin molecule to form a ubiquitin chain that attaches itself to a target protein. Ubiquitin has seven lysine residues, any one of which can be used to link ubiquitin molecules together, resulting in different structures that alter the target protein in different ways. It appears that Lys(11)-, Lys(29) and Lys(48)-linked poly-ubiquitin chains target the protein to the proteasome for degradation, while mono-ubiquitinylated and Lys(6)- or Lys(63)-linked poly-ubiquitin chains signal reversible modifications in protein activity, location or trafficking []. For example, Lys(63)-linked poly-ubiquitinylation is known to be involved in DNA damage tolerance, inflammatory response, protein trafficking and signal transduction through kinase activation []. In addition, the length of the ubiquitin chain alters the fate of the target protein. Regulatory proteins such as transcription factors and histones are frequent targets of ubquitinylation [].; GO: 0005515 protein binding; PDB: 2DZI_A 2XEW_E 3NOB_E 2KWU_B 2Y5B_F 3PHD_G 2KWV_B 2KOX_A 2XK5_B 3NHE_B ....
Probab=69.86  E-value=3.2  Score=24.27  Aligned_cols=26  Identities=35%  Similarity=0.363  Sum_probs=22.8

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|....+|.+|-+.|++.+++|+++.
T Consensus        11 ~v~~~~tV~~lK~~i~~~~~~~~~~~   36 (69)
T PF00240_consen   11 EVDPDDTVADLKQKIAEETGIPPEQQ   36 (69)
T ss_dssp             EEETTSBHHHHHHHHHHHHTSTGGGE
T ss_pred             EECCCCCHHHhhhhcccccccccccc
Confidence            46678899999999999999998864


No 6  
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=68.46  E-value=3  Score=24.59  Aligned_cols=26  Identities=12%  Similarity=0.238  Sum_probs=21.5

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .++.-.+|.+|.++|++.+++|+++.
T Consensus        16 ~v~~~~tV~~lK~~i~~~~g~~~~~q   41 (76)
T cd01803          16 EVEPSDTIENVKAKIQDKEGIPPDQQ   41 (76)
T ss_pred             EECCcCcHHHHHHHHHHHhCCCHHHe
Confidence            35556789999999999999998754


No 7  
>cd01804 midnolin_N Ubiquitin-like domain of midnolin. midnolin_N   Midnolin (midbrain nucleolar protein) is expressed in the nucleolus and is thought to regulate genes involved in neurogenesis.  Midnolin contains an amino-terminal ubiquitin-like domain.
Probab=67.58  E-value=3.3  Score=25.81  Aligned_cols=25  Identities=20%  Similarity=0.286  Sum_probs=20.3

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      ++.=.+|.||.++|++.+++++++.
T Consensus        18 v~~~~TV~~LK~~I~~~~~~~~~~q   42 (78)
T cd01804          18 VPPDETVEGLKKRISQRLKVPKERL   42 (78)
T ss_pred             ECCcCHHHHHHHHHHHHhCCChHHE
Confidence            3444679999999999999998764


No 8  
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein. DC_UbP (dendritic cell derived ubiquitin-like protein) is a ubiquitin-like protein from human dendritic cells that is expressed in the mitochondrion. The ubiquitin-like domain of this protein is found at the C-terminus and lacks the canonical gly-gly motif of ubiquitin required for ubiquitinization.  DC_UbP is expressed in tumor cells but not in normal human adult tissue suggesting a role for DC_UbP in tumorogenesis.
Probab=67.35  E-value=2.8  Score=25.90  Aligned_cols=26  Identities=12%  Similarity=0.057  Sum_probs=22.7

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|+...+|.+|-++|++.+++++++.
T Consensus        14 ~v~~~~TV~~lK~~I~~~~gi~~~~q   39 (70)
T cd01794          14 SVSSKDTVGQLKKQLQAAEGVDPCCQ   39 (70)
T ss_pred             EECCcChHHHHHHHHHHHhCCCHHHe
Confidence            56778899999999999999998764


No 9  
>cd01793 Fubi Fubi ubiquitin-like protein. Fubi is a ubiquitin-like protein encoded by the fau gene which has an  N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30.  Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.
Probab=67.01  E-value=3.2  Score=25.21  Aligned_cols=26  Identities=15%  Similarity=0.266  Sum_probs=22.5

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|+.-.+|.++-++|++.++||+++.
T Consensus        14 ~v~~~~tV~~lK~~i~~~~gip~~~q   39 (74)
T cd01793          14 EVTGQETVSDIKAHVAGLEGIDVEDQ   39 (74)
T ss_pred             EECCcCcHHHHHHHHHhhhCCCHHHE
Confidence            45677899999999999999998864


No 10 
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2. hPLIC-1 and hPLIC-2 (human homologs of the yeast ubiquitin-like Dsk2 protein)  are type2 UBL's (ubiquitin-like) proteins that are thought to serve as adaptors that link the ubiquitination machinery to the proteasome.  The hPLIC's have an N-terminal UBL domain that binds the S5a subunit of the proteasome and a C-terminal UBA (ubiquitin-associated) domain that binds a ubiquitylated protein.
Probab=66.34  E-value=3.3  Score=24.88  Aligned_cols=25  Identities=12%  Similarity=0.263  Sum_probs=20.4

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      |+.=.+|.+|.++|++.+++++++.
T Consensus        16 v~~~~TV~~lK~~I~~~~~i~~~~~   40 (71)
T cd01808          16 IAEDASVKDFKEAVSKKFKANQEQL   40 (71)
T ss_pred             ECCCChHHHHHHHHHHHhCCCHHHE
Confidence            4455689999999999999987654


No 11 
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains that becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=64.41  E-value=3.8  Score=25.40  Aligned_cols=25  Identities=32%  Similarity=0.325  Sum_probs=20.7

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      |+.-.+|.||.++|++.+++++++-
T Consensus        19 v~~~~TV~~lK~~I~~~~~i~~~~q   43 (80)
T cd01792          19 LRDSMTVSELKQQIAQKIGVPAFQQ   43 (80)
T ss_pred             cCCCCcHHHHHHHHHHHhCCCHHHE
Confidence            4556789999999999999987653


No 12 
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain. DDI1_N   DDI1 (DNA damage inducible protein 1) has an amino-terminal ubiquitin-like domain, an retroviral protease-like (RVP-like) domain, and a UBA (ubiquitin-associated) domain.  This CD represents the amino-terminal ubiquitin-like domain of DDI1.
Probab=64.16  E-value=3.9  Score=24.98  Aligned_cols=26  Identities=8%  Similarity=-0.000  Sum_probs=22.3

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|+.-.+|.+|-++|++.+++|+++.
T Consensus        15 ~v~~~~TV~~lK~~I~~~~gip~~~q   40 (71)
T cd01796          15 DVDPDLELENFKALCEAESGIPASQQ   40 (71)
T ss_pred             EECCcCCHHHHHHHHHHHhCCCHHHe
Confidence            45667899999999999999998764


No 13 
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains and becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=63.12  E-value=4.4  Score=24.60  Aligned_cols=26  Identities=15%  Similarity=0.110  Sum_probs=22.0

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|+.-.+|++|-++|++..+|++++.
T Consensus        14 ~v~~~~tV~~lK~~I~~~~gi~~~~q   39 (74)
T cd01810          14 EVQLTQTVATLKQQVSQRERVQADQF   39 (74)
T ss_pred             EECCcChHHHHHHHHHHHhCCCHHHe
Confidence            45667899999999999999988753


No 14 
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=61.92  E-value=5.9  Score=23.28  Aligned_cols=25  Identities=16%  Similarity=0.327  Sum_probs=21.6

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      |+.-.+|.+|-++|++.+++|+++.
T Consensus        17 v~~~~tv~~lK~~i~~~~g~~~~~q   41 (76)
T cd01806          17 IEPTDKVERIKERVEEKEGIPPQQQ   41 (76)
T ss_pred             ECCCCCHHHHHHHHhHhhCCChhhE
Confidence            5666789999999999999999864


No 15 
>cd00196 UBQ Ubiquitin-like proteins. Ubiquitin homologs; Includes ubiquitin and ubiquitin-like proteins. Ubiquitin-mediated proteolysis is part of the regulated turnover of proteins required for controlling cell cycle progression. Other family members are protein modifiers that perform a wide range of functions. Ubiquitination usually results in a covalent bond between the C-terminus of ubiquitin and the epsilon-amino group of a substrate lysine. The three-step mechanism requires an activating enzyme (E1) that forms a thiol ester with the C-terminal carboxy group, a conjugating enzyme (E2) that transiently carries the activated ubiquitin molecule as a thiol ester, and a ligase (E3) that transfers the activated ubiquitin from the E2 to the substrate lysine residue. In poly-ubiquitination, ubiquitin itself is the substrate.
Probab=60.43  E-value=6.5  Score=19.66  Aligned_cols=24  Identities=25%  Similarity=0.398  Sum_probs=19.2

Q ss_pred             cCccchHHHHHhhhhhhcCCCCcC
Q psy16017         61 SGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      ..-.+++++.++|.+.+++++++.
T Consensus        15 ~~~~tv~~l~~~i~~~~~~~~~~~   38 (69)
T cd00196          15 PSGTTVADLKEKLAKKLGLPPEQQ   38 (69)
T ss_pred             CCCCcHHHHHHHHHHHHCcChHHe
Confidence            346789999999999998776643


No 16 
>PF02071 NSF:  Aromatic-di-Alanine (AdAR) repeat ;  InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers. SNARE proteins are thought to form a protein bridge, the SNARE complex, between an incoming vesicle and the acceptor compartment. SNARE proteins contribute to the specificity of membrane fusion, implying that the mechanisms by which SNAREs are targeted to subcellular compartments are important for specific docking and fusion of vesicles. This mechanism involves a family of conserved proteins, members of which appear to function at all sites of constitutive and regulated secretion in eukaryotes []. Among them are 2 types of cytosolic protein, NSF (N-ethyl-maleimide-sensitive protein) and the SNAPs (alpha-, beta- and gamma-soluble NSF attachment proteins). The yeast vesicular fusion protein, sec17, a cytoplasmic peripheral membrane protein involved in vesicular transport between the endoplasmic reticulum and the golgi apparatus, shows a high degree of sequence similarity to the alpha-SNAP family.  SNAP-25 and its non-neuronal homologue Syndet/SNAP-23 are synthesized as soluble proteins in the cytosol. Both SNAP-25 and Syndet/SNAP-23 are palmitoylated at cysteine residues clustered in a loop between two N- and C-terminal coils and palmitoylation is essential for membrane binding and plasma membrane targeting. The C-terminal and the N-terminal helices of SNAP-25, are each targeted to the plasma membrane by two distinct cysteine-rich domains and appear to regulate the availability of SNAP to form complexes with SNARE [].; GO: 0006886 intracellular protein transport
Probab=59.41  E-value=5  Score=18.45  Aligned_cols=10  Identities=60%  Similarity=1.228  Sum_probs=8.1

Q ss_pred             HHHHhhhhhh
Q psy16017         68 ELYQKIAECY   77 (85)
Q Consensus        68 ELY~kIae~f   77 (85)
                      +-|+++|+||
T Consensus         3 ~~y~~Aa~~y   12 (12)
T PF02071_consen    3 KCYEKAAECY   12 (12)
T ss_pred             HHHHHHHhhC
Confidence            3589999987


No 17 
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein. parkin_N  parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.  Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of  26S proteasomes through its Ubl domain.
Probab=58.95  E-value=5.2  Score=23.89  Aligned_cols=25  Identities=12%  Similarity=0.295  Sum_probs=21.6

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      |+.-.+|+++-+.|++.+++++++.
T Consensus        15 v~~~~tV~~lK~~i~~~~gi~~~~q   39 (70)
T cd01798          15 VDPDTDIKQLKEVVAKRQGVPPDQL   39 (70)
T ss_pred             ECCCChHHHHHHHHHHHHCCCHHHe
Confidence            5567899999999999999998764


No 18 
>cd01802 AN1_N ubiquitin-like domain of AN1. AN1 (also known as ANUBL1 and RSD-7) is ubiquitin-like protein with a testis-specific expression in rats that has an N-terminal ubiquitin-like domain and a C-terminal zinc-binding domain. Unlike ubiquitin polyproteins and most ubiquitin fusion proteins, the N-terminal ubiquitin-like domain of An1 does not undergo proteolytic processing.  The function of AN1 is unknown.
Probab=58.44  E-value=5.9  Score=26.40  Aligned_cols=39  Identities=21%  Similarity=0.232  Sum_probs=29.0

Q ss_pred             ceeeeeecccCCCc-eeccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         44 KLIFHCQLAHGSPT-GLISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        44 ~LvFh~QLAHGSpt-g~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .+.+-+.  .|... =.|+...+|.+|-++|++.++|++++-
T Consensus        29 ~I~Vk~l--~G~~~~leV~~~~TV~~lK~kI~~~~gip~~~Q   68 (103)
T cd01802          29 ELFIETL--TGTCFELRVSPFETVISVKAKIQRLEGIPVAQQ   68 (103)
T ss_pred             EEEEEcC--CCCEEEEEeCCCCcHHHHHHHHHHHhCCChHHE
Confidence            4444444  35433 358899999999999999999998753


No 19 
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=55.75  E-value=8.5  Score=22.46  Aligned_cols=25  Identities=16%  Similarity=0.203  Sum_probs=20.8

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      ++.=.+|.+|-++|++.+++++++.
T Consensus        16 v~~~~tv~~lK~~i~~~~gi~~~~q   40 (71)
T cd01812          16 ISSQATFGDLKKMLAPVTGVEPRDQ   40 (71)
T ss_pred             ECCCCcHHHHHHHHHHhhCCChHHe
Confidence            4455789999999999999998754


No 20 
>PF14552 Tautomerase_2:  Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C.
Probab=54.07  E-value=7  Score=25.37  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=12.1

Q ss_pred             hHHHHHhhh----hhhcCCCCcC
Q psy16017         66 VRELYQKIA----ECYEFPAEEN   84 (85)
Q Consensus        66 vkELY~kIa----e~f~i~p~e~   84 (85)
                      -++||+.|+    +..+|+|+||
T Consensus        45 K~~ly~~l~~~L~~~~gi~p~Dv   67 (82)
T PF14552_consen   45 KKALYRALAERLAEKLGIRPEDV   67 (82)
T ss_dssp             HHHHHHHHHHHHHHHH---GGGE
T ss_pred             HHHHHHHHHHHHHHHcCCCHHHE
Confidence            467888887    5678999886


No 21 
>PF14645 Chibby:  Chibby family
Probab=53.17  E-value=34  Score=23.73  Aligned_cols=32  Identities=28%  Similarity=0.268  Sum_probs=20.7

Q ss_pred             ceeee-ee--cccCCCceeccCccchHHHHHhhhh
Q psy16017         44 KLIFH-CQ--LAHGSPTGLISGFSNVRELYQKIAE   75 (85)
Q Consensus        44 ~LvFh-~Q--LAHGSptg~I~gFsnvkELY~kIae   75 (85)
                      .|||. -|  ..+|+.++...+....++-.+.+-|
T Consensus        51 ~l~F~dG~W~~e~~~~~~~~~~~~~l~~~n~~L~E   85 (116)
T PF14645_consen   51 TLVFEDGQWTSESGSGTADGEENQRLRKENQQLEE   85 (116)
T ss_pred             EEEEECCEEeccCCCcccchhHHHHHHHHHHHHHH
Confidence            67882 01  3457777888888777776666553


No 22 
>smart00760 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain. Could be involved in DNA-binding.
Probab=53.09  E-value=5.8  Score=23.59  Aligned_cols=20  Identities=20%  Similarity=0.451  Sum_probs=17.0

Q ss_pred             chHHHHHhhhhhhcCCCCcC
Q psy16017         65 NVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        65 nvkELY~kIae~f~i~p~e~   84 (85)
                      ++.++-+.+|+.|+|+++|+
T Consensus         1 ~~~~I~~~Va~~~~i~~~~i   20 (60)
T smart00760        1 TIEEIIEAVAEYFGVKPEDL   20 (60)
T ss_pred             CHHHHHHHHHHHhCCCHHHH
Confidence            46788889999999998876


No 23 
>PF13647 Glyco_hydro_80:  Glycosyl hydrolase family 80 of chitosanase A
Probab=52.98  E-value=7.3  Score=31.32  Aligned_cols=24  Identities=46%  Similarity=0.695  Sum_probs=20.8

Q ss_pred             ceeeeeecccCCCceeccCccchHH
Q psy16017         44 KLIFHCQLAHGSPTGLISGFSNVRE   68 (85)
Q Consensus        44 ~LvFh~QLAHGSptg~I~gFsnvkE   68 (85)
                      -|-|+.|..-|| .|.|+.|++||.
T Consensus       201 glafqvqvntgs-igsisafssvks  224 (308)
T PF13647_consen  201 GLAFQVQVNTGS-IGSISAFSSVKS  224 (308)
T ss_pred             eEEEEEEecccc-ccceehhhhccc
Confidence            478999999887 689999999974


No 24 
>cd01805 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belongs to a family of adaptor molecules having affinity for both the proteasome and ubiquitinylated proteins and thought to shuttle these ubiquitinylated proteins to the proteasome for destruction. RAD23 interacts with ubiquitin through its C-terminal ubiquitin-associated domains (UBA) and with the proteasome through its N-terminal ubiquitin-like domain (UBL).
Probab=52.70  E-value=9.5  Score=22.75  Aligned_cols=25  Identities=32%  Similarity=0.355  Sum_probs=20.3

Q ss_pred             ccCccchHHHHHhhhhhhcC--CCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEF--PAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i--~p~e~   84 (85)
                      |+.-.+|.+|-+.|++.+++  ++++.
T Consensus        17 v~~~~TV~~lK~~i~~~~~i~~~~~~q   43 (77)
T cd01805          17 VDPDDTVAELKEKIEEEKGCDYPPEQQ   43 (77)
T ss_pred             ECCCCcHHHHHHHHHHhhCCCCChhHe
Confidence            45567899999999999998  77653


No 25 
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=52.23  E-value=8.4  Score=22.74  Aligned_cols=18  Identities=28%  Similarity=0.481  Sum_probs=12.4

Q ss_pred             HHHHHhhhhhhcCCCCcC
Q psy16017         67 RELYQKIAECYEFPAEEN   84 (85)
Q Consensus        67 kELY~kIae~f~i~p~e~   84 (85)
                      +++++.+++++++|++++
T Consensus        22 ~~it~~l~~~lg~p~~~v   39 (64)
T PRK01964         22 REVTEAISATLDVPKERV   39 (64)
T ss_pred             HHHHHHHHHHhCcChhhE
Confidence            344445558899999876


No 26 
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional
Probab=51.47  E-value=6.9  Score=24.78  Aligned_cols=25  Identities=8%  Similarity=0.254  Sum_probs=22.2

Q ss_pred             cCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         61 SGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      -||+|..-++...-+.||++|.|.|
T Consensus        80 ~Gf~~~s~f~~~Fk~~~G~tP~~~r  104 (107)
T PRK10219         80 LGYVSQQTFSRVFRRQFDRTPSDYR  104 (107)
T ss_pred             HCCCCHHHHHHHHHHHHCcCHHHHH
Confidence            4899999999999999999998764


No 27 
>smart00213 UBQ Ubiquitin homologues. Ubiquitin-mediated proteolysis is involved in the regulated turnover of  proteins required for controlling cell cycle progression
Probab=50.90  E-value=10  Score=21.11  Aligned_cols=26  Identities=35%  Similarity=0.400  Sum_probs=21.1

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|+.=.+|.+|-+.|++.+++++++.
T Consensus        15 ~v~~~~tv~~lk~~i~~~~~~~~~~~   40 (64)
T smart00213       15 EVKPSDTVSELKEKIAELTGIPVEQQ   40 (64)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHHE
Confidence            45555789999999999999988653


No 28 
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of  Np95 and NIRF. NIRF_N    This CD represents the amino-terminal ubiquitin-like domain of a family of nuclear proteins that includes Np95 and NIRF (Np95/ICBP90-like RING finger) protein.  Both Np95 and NIRF have a domain architecture consisting of a ubiquitin-like domain, a PHD finger, a YDG/SRA domain, Rb-binding motifs and a RING finger domain. Both Np95 and NIRF are ubiquitin ligases that ubiquitinate PCNP (PEST-containing nuclear proteins). While Np95 is capable of binding histones, NIRF is involved in cell cycle regulation.
Probab=50.83  E-value=8.6  Score=24.17  Aligned_cols=25  Identities=32%  Similarity=0.480  Sum_probs=20.9

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      ++.-.+|.++-++|++.++|++++-
T Consensus        19 v~~~~TV~~lK~~i~~~~gi~~~~Q   43 (78)
T cd01797          19 LSRLTKVEELREKIQELFNVEPECQ   43 (78)
T ss_pred             cCCcCcHHHHHHHHHHHhCCCHHHe
Confidence            3455789999999999999998764


No 29 
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein.
Probab=50.75  E-value=14  Score=20.85  Aligned_cols=26  Identities=19%  Similarity=0.287  Sum_probs=22.2

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      .-||.|...++...-+.+|++|.+.|
T Consensus        59 ~~g~~s~~~f~r~Fk~~~g~sp~~~r   84 (84)
T smart00342       59 RVGFSSQSYFSRAFKKLFGVTPSEYR   84 (84)
T ss_pred             HhCCCChHHHHHHHHHHHCcChhhcC
Confidence            45888999999999999999998865


No 30 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=50.69  E-value=9.1  Score=22.08  Aligned_cols=17  Identities=18%  Similarity=0.233  Sum_probs=11.7

Q ss_pred             HHHHhhhhhhcCCCCcC
Q psy16017         68 ELYQKIAECYEFPAEEN   84 (85)
Q Consensus        68 ELY~kIae~f~i~p~e~   84 (85)
                      ++++.++++|++|++++
T Consensus        23 ~it~~l~~~~~~p~~~v   39 (61)
T PRK02220         23 DVTAAVSKNTGAPAEHI   39 (61)
T ss_pred             HHHHHHHHHhCcChhhE
Confidence            34444558899998875


No 31 
>PF07027 DUF1318:  Protein of unknown function (DUF1318);  InterPro: IPR008309 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=50.28  E-value=5.2  Score=27.05  Aligned_cols=18  Identities=39%  Similarity=0.506  Sum_probs=16.0

Q ss_pred             HHHHHhhhhhhcCCCCcC
Q psy16017         67 RELYQKIAECYEFPAEEN   84 (85)
Q Consensus        67 kELY~kIae~f~i~p~e~   84 (85)
                      +.+|+.||+.-++++++|
T Consensus        50 ~~~Y~~iA~~ng~t~~~V   67 (95)
T PF07027_consen   50 RALYQEIAKKNGITVEQV   67 (95)
T ss_pred             HHHHHHHHHHcCCCHHHH
Confidence            579999999999998876


No 32 
>PF01337 Barstar:  Barstar (barnase inhibitor);  InterPro: IPR000468 Barstar is a small single chain protein. Barnase is the extracellular ribonuclease IPR001887 from INTERPRO of Bacillus amyloliquefaciens, and barstar its specific intracellular inhibitor [, ]. Expression of barstar is necessary to counter the lethal effect of expressed active barnase. The structure of the barnase-barstar complex is known [].; PDB: 2CX6_A 1B2U_F 1A19_A 1X1U_F 1B27_E 1X1W_F 1BGS_E 1X1Y_D 1B3S_D 1B2S_D ....
Probab=50.24  E-value=14  Score=23.15  Aligned_cols=22  Identities=23%  Similarity=0.534  Sum_probs=16.5

Q ss_pred             ccCccchHHHHHhhhhhhcCCC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPA   81 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p   81 (85)
                      ..++++..++|+.|++++++|.
T Consensus         5 g~~i~~~~~~~~~l~~~l~fP~   26 (90)
T PF01337_consen    5 GRKIRDKEDFYDALAEALDFPD   26 (90)
T ss_dssp             CCC-SSHHHHHHHHHHHTT--T
T ss_pred             CCCCCCHHHHHHHHHHHcCCCc
Confidence            3578899999999999999884


No 33 
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=49.94  E-value=15  Score=24.40  Aligned_cols=17  Identities=24%  Similarity=0.483  Sum_probs=15.6

Q ss_pred             chHHHHHhhhhhhcCCC
Q psy16017         65 NVRELYQKIAECYEFPA   81 (85)
Q Consensus        65 nvkELY~kIae~f~i~p   81 (85)
                      +..+|+++|+++|.|++
T Consensus        26 ~~~~L~~kI~~~f~l~~   42 (91)
T cd06398          26 NMDGLREKVEELFSLSP   42 (91)
T ss_pred             CHHHHHHHHHHHhCCCC
Confidence            67899999999999987


No 34 
>KOG3889|consensus
Probab=48.58  E-value=12  Score=31.26  Aligned_cols=37  Identities=35%  Similarity=0.628  Sum_probs=28.9

Q ss_pred             CCceeeeeeccc---CCCceeccCccchHHHHHhhhhhhcC
Q psy16017         42 KPKLIFHCQLAH---GSPTGLISGFSNVRELYQKIAECYEF   79 (85)
Q Consensus        42 ~p~LvFh~QLAH---GSptg~I~gFsnvkELY~kIae~f~i   79 (85)
                      ..--|||| |.|   |+-|=.|.||.-+.+|-++--|.|+|
T Consensus       202 ~GiQvfHC-l~h~gtGG~t~lVDgfy~ae~l~~~~Pe~fei  241 (371)
T KOG3889|consen  202 PGIQVFHC-LTHAGTGGDTVLVDGFYCAEKLRNESPEDFEI  241 (371)
T ss_pred             CCceEEEe-ecccCCCCceEEEehHHHHHHHHhhChHhhhH
Confidence            34569999 456   44455799999999999998888875


No 35 
>PTZ00044 ubiquitin; Provisional
Probab=48.07  E-value=11  Score=22.50  Aligned_cols=26  Identities=8%  Similarity=-0.013  Sum_probs=21.9

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .++.-.+|.+|=++|++..++|+++.
T Consensus        16 ~v~~~~tv~~lK~~i~~~~gi~~~~q   41 (76)
T PTZ00044         16 NFEPDNTVQQVKMALQEKEGIDVKQI   41 (76)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHHe
Confidence            45567789999999999999998764


No 36 
>PF14338 Mrr_N:  Mrr N-terminal domain
Probab=47.94  E-value=9  Score=24.36  Aligned_cols=20  Identities=30%  Similarity=0.697  Sum_probs=17.5

Q ss_pred             cchHHHHHhhhhhhcCCCCc
Q psy16017         64 SNVRELYQKIAECYEFPAEE   83 (85)
Q Consensus        64 snvkELY~kIae~f~i~p~e   83 (85)
                      .+.+|+|+.|++.|+++.+|
T Consensus        20 ~~~~ei~~~v~~~~~ls~e~   39 (92)
T PF14338_consen   20 ASRKEIYERVAERFGLSDEE   39 (92)
T ss_pred             cCHHHHHHHHHHHhCCCHHH
Confidence            57899999999999998765


No 37 
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein. Scythe protein (also known as Bat3) is an apoptotic regulator that is highly conserved in eukaryotes and contains a ubiquitin-like domain near its N-terminus.  Scythe binds reaper, a potent apoptotic inducer, and Scythe/Reaper are thought to signal apoptosis, in part through regulating the folding and activity of apoptotic signaling molecules.
Probab=47.88  E-value=12  Score=21.71  Aligned_cols=25  Identities=32%  Similarity=0.372  Sum_probs=20.2

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      ++.-.+|.+|-++|++..++++++.
T Consensus        17 v~~~~tv~~lK~~i~~~~gi~~~~q   41 (72)
T cd01809          17 VEEEITVLDLKEKIAEEVGIPVEQQ   41 (72)
T ss_pred             ECCCCcHHHHHHHHHHHHCcCHHHe
Confidence            3344789999999999999988754


No 38 
>PF12833 HTH_18:  Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B ....
Probab=47.45  E-value=5.5  Score=23.77  Aligned_cols=26  Identities=19%  Similarity=0.359  Sum_probs=20.4

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      .-||+|...++...-+.||++|.|.|
T Consensus        54 ~~Gf~~~~~f~~~fk~~~g~tP~~~r   79 (81)
T PF12833_consen   54 ECGFSSQSHFSRAFKRYFGMTPSEYR   79 (81)
T ss_dssp             HTT-SSHHHHHHHHHHHHSS-HHHHH
T ss_pred             HcCCCCHHHHHHHHHHHHCcCHHHHH
Confidence            45899999999999999999998753


No 39 
>PF14566 PTPlike_phytase:  Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B ....
Probab=46.87  E-value=8.1  Score=26.78  Aligned_cols=10  Identities=50%  Similarity=0.830  Sum_probs=7.1

Q ss_pred             CCceeeeeec
Q psy16017         42 KPKLIFHCQL   51 (85)
Q Consensus        42 ~p~LvFh~QL   51 (85)
                      ..-|+||||.
T Consensus       124 ~~~l~fhC~~  133 (149)
T PF14566_consen  124 DTWLHFHCQA  133 (149)
T ss_dssp             T-EEEEE-SS
T ss_pred             CCeEEEECCC
Confidence            5689999997


No 40 
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=46.58  E-value=16  Score=21.05  Aligned_cols=19  Identities=16%  Similarity=0.137  Sum_probs=15.2

Q ss_pred             hHHHHHhhhhhhcCCCCcC
Q psy16017         66 VRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        66 vkELY~kIae~f~i~p~e~   84 (85)
                      ++++++.++++++++++++
T Consensus        21 ~~~it~~l~~~lg~~~~~v   39 (63)
T TIGR00013        21 IEGVTEAMAETLGANLESI   39 (63)
T ss_pred             HHHHHHHHHHHhCCCcccE
Confidence            4667777889999998875


No 41 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=43.20  E-value=15  Score=22.21  Aligned_cols=20  Identities=30%  Similarity=0.587  Sum_probs=13.4

Q ss_pred             eeeeeecccCCCceeccCccc
Q psy16017         45 LIFHCQLAHGSPTGLISGFSN   65 (85)
Q Consensus        45 LvFh~QLAHGSptg~I~gFsn   65 (85)
                      ++|+|+ |.|+|+-.|.=+.|
T Consensus         1 ~~l~C~-~~G~P~P~v~W~k~   20 (77)
T cd05875           1 IIIECE-AKGNPVPTFQWTRN   20 (77)
T ss_pred             CEEEEe-ccccCCCEEEEEEC
Confidence            467887 56888777765443


No 42 
>PF05099 TerB:  Tellurite resistance protein TerB;  InterPro: IPR007791 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []. Structurally, the DnaJ protein consists of an N-terminal conserved domain (called 'J' domain) of about 70 amino acids, a glycine-rich region ('G' domain') of about 30 residues, a central domain containing four repeats of a CXXCXGXG motif ('CRR' domain) and a C-terminal region of 120 to 170 residues. Direct interaction between DnaK and djlA is needed for the induction of the wcaABCDE operon which is involved in the synthesis of a colanic acid polysaccharide capsule. The colanic acid capsule may help the bacterium survive conditions outside the host [, ]; PDB: 2H5N_D 2JXU_A.
Probab=41.82  E-value=20  Score=23.35  Aligned_cols=21  Identities=24%  Similarity=0.415  Sum_probs=14.8

Q ss_pred             chHHHHHhhhhhhcCCCCcCC
Q psy16017         65 NVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        65 nvkELY~kIae~f~i~p~e~~   85 (85)
                      .-+++..+||+.++|+.++++
T Consensus       116 ~E~~~l~~ia~~L~i~~~~~~  136 (140)
T PF05099_consen  116 EEQEFLRRIAEALGISEEDFQ  136 (140)
T ss_dssp             CHHHHHHHHHHHCTS-SS---
T ss_pred             HHHHHHHHHHHHcCCCHHHHh
Confidence            346789999999999999864


No 43 
>PF08281 Sigma70_r4_2:  Sigma-70, region 4;  InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2LFW_A 1OR7_B 2H27_D 2O8X_B.
Probab=41.20  E-value=5.1  Score=22.60  Aligned_cols=16  Identities=25%  Similarity=0.295  Sum_probs=11.8

Q ss_pred             HHHhhhhhhcCCCCcC
Q psy16017         69 LYQKIAECYEFPAEEN   84 (85)
Q Consensus        69 LY~kIae~f~i~p~e~   84 (85)
                      -|+.||+.++++++-|
T Consensus        28 s~~eIa~~l~~s~~~v   43 (54)
T PF08281_consen   28 SYAEIAEILGISESTV   43 (54)
T ss_dssp             -HHHHHHHCTS-HHHH
T ss_pred             CHHHHHHHHCcCHHHH
Confidence            6899999999987654


No 44 
>cd05140 Barstar_AU1054-like Barstar_AU1054-like contains uncharacterized sequences similar to the uncharacterized, predicted RNAase inhibitor AU1054 found in Burkholderia cenocepacia. This is a subfamily of the Barstar family of RNAase inhibitors. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=41.15  E-value=24  Score=23.08  Aligned_cols=22  Identities=36%  Similarity=0.729  Sum_probs=18.7

Q ss_pred             ccCccchHHHHHhhhhhhcCCC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPA   81 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p   81 (85)
                      .++.++-.++|+.+|++|++|.
T Consensus         5 ~~~i~~~~~l~~~l~~~l~fP~   26 (86)
T cd05140           5 LSDITSERELHELLKECLGFPG   26 (86)
T ss_pred             cccCCCHHHHHHHHHHHcCCch
Confidence            4567888999999999999874


No 45 
>COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism]
Probab=40.52  E-value=13  Score=28.28  Aligned_cols=36  Identities=17%  Similarity=0.288  Sum_probs=30.2

Q ss_pred             eecccCCCceec---cCccchHHHHHhhhhhhcCCCCcC
Q psy16017         49 CQLAHGSPTGLI---SGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        49 ~QLAHGSptg~I---~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .||.||.+...+   .||.|.+-.|....+.++++|.+.
T Consensus       140 ~~L~~g~sv~~a~~daGf~s~s~F~~af~~~~G~~P~~~  178 (187)
T COG2169         140 KQLRMGASVTDAQIDAGFESSSRFYDAFSKILGMTPTKF  178 (187)
T ss_pred             HHHhCCCchhHHHHHhCCCChHHHHHHHHHHcCCChHHH
Confidence            478888865544   699999999999999999998764


No 46 
>PF12085 DUF3562:  Protein of unknown function (DUF3562);  InterPro: IPR021945  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 62 to 84 amino acids in length. This protein has two completely conserved residues (A and Y) that may be functionally important. 
Probab=40.39  E-value=10  Score=24.76  Aligned_cols=22  Identities=45%  Similarity=0.483  Sum_probs=19.4

Q ss_pred             cchHHHHHhhhhhhcCCCCcCC
Q psy16017         64 SNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        64 snvkELY~kIae~f~i~p~e~~   85 (85)
                      .|+.|+-++||+.-++|.++|+
T Consensus         4 ~~~~e~i~~iA~~t~~P~e~V~   25 (66)
T PF12085_consen    4 DNVDEVIRSIAEETGTPAETVR   25 (66)
T ss_pred             ccHHHHHHHHHHHHCCCHHHHH
Confidence            5889999999999999988764


No 47 
>cd05142 Barstar Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=40.36  E-value=25  Score=22.96  Aligned_cols=21  Identities=14%  Similarity=0.317  Sum_probs=18.2

Q ss_pred             cCccchHHHHHhhhhhhcCCC
Q psy16017         61 SGFSNVRELYQKIAECYEFPA   81 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p   81 (85)
                      ..+++..++|+.++++|++|.
T Consensus         7 ~~i~~~~~f~~~l~~~~~~p~   27 (87)
T cd05142           7 EEIRSIEDLHQILKKELALPE   27 (87)
T ss_pred             ccCCCHHHHHHHHHHHhCCch
Confidence            467889999999999999874


No 48 
>cd05141 Barstar_evA4336-like Barstar_evA4336-like contains uncharacterized sequences similar to the uncharacterized, predicted RNAase inhibitor evA4336 found in Azoarcus sp. EvN1. This is a subfamily of the Barstar family of RNAase inhibitors. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=38.71  E-value=28  Score=21.94  Aligned_cols=22  Identities=27%  Similarity=0.640  Sum_probs=18.4

Q ss_pred             ccCccchHHHHHhhhhhhcCCC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPA   81 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p   81 (85)
                      .++.++..++|+.+|++|++|.
T Consensus         5 g~~i~~~~~~~~~l~~~l~fP~   26 (81)
T cd05141           5 LSGIADKAALLDALAAALDFPS   26 (81)
T ss_pred             cccCCCHHHHHHHHHHHcCCCc
Confidence            3567888999999999999873


No 49 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=37.99  E-value=21  Score=22.18  Aligned_cols=18  Identities=33%  Similarity=0.501  Sum_probs=14.3

Q ss_pred             CceeeeeecccCCCce-ecc
Q psy16017         43 PKLIFHCQLAHGSPTG-LIS   61 (85)
Q Consensus        43 p~LvFh~QLAHGSptg-~I~   61 (85)
                      -...|+|+ |+|.|.- .|.
T Consensus        14 ~~v~l~C~-a~G~P~P~~I~   32 (81)
T cd05749          14 TPFNLTCQ-AVGPPEPVEIL   32 (81)
T ss_pred             CCEEEEEE-eeeecCCeEEE
Confidence            36899999 9999976 454


No 50 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=36.72  E-value=28  Score=23.21  Aligned_cols=21  Identities=38%  Similarity=0.417  Sum_probs=17.9

Q ss_pred             cchHHHHHhhhhhhcCCCCcC
Q psy16017         64 SNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        64 snvkELY~kIae~f~i~p~e~   84 (85)
                      -+..+|+++|++-+.++++++
T Consensus        21 ~~y~~L~~ki~~kLkl~~e~i   41 (80)
T cd06406          21 LSYATLLQKISSKLELPAEHI   41 (80)
T ss_pred             CCHHHHHHHHHHHhCCCchhc
Confidence            367899999999999987764


No 51 
>COG2411 Uncharacterized conserved protein [Function unknown]
Probab=36.40  E-value=20  Score=27.58  Aligned_cols=21  Identities=24%  Similarity=0.521  Sum_probs=18.7

Q ss_pred             eeccCccchHHHHHhhhhhhc
Q psy16017         58 GLISGFSNVRELYQKIAECYE   78 (85)
Q Consensus        58 g~I~gFsnvkELY~kIae~f~   78 (85)
                      .+.+||.|++||-..+.+.|+
T Consensus        71 Ar~DGF~sreELi~~LkriYg   91 (188)
T COG2411          71 ARLDGFRSREELIEELKRIYG   91 (188)
T ss_pred             HHhcccccHHHHHHHHHHHcC
Confidence            467899999999999999886


No 52 
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=36.16  E-value=30  Score=19.43  Aligned_cols=18  Identities=11%  Similarity=0.193  Sum_probs=12.2

Q ss_pred             HHHHHhhhhhhcCCCCcC
Q psy16017         67 RELYQKIAECYEFPAEEN   84 (85)
Q Consensus        67 kELY~kIae~f~i~p~e~   84 (85)
                      +++++.+++.+++++.++
T Consensus        21 ~~i~~~l~~~~g~~~~~v   38 (58)
T cd00491          21 ERVTEAVSEILGAPEATI   38 (58)
T ss_pred             HHHHHHHHHHhCcCcccE
Confidence            445555558888988765


No 53 
>PF08769 Spo0A_C:  Sporulation initiation factor Spo0A C terminal;  InterPro: IPR014879 The response regulator Spo0A is comprised of a phophoacceptor domain and a transcription activation domain. This domain corresponds to the transcription activation domain and forms an alpha helical structure comprising of 6 alpha helices. The structure contains a helix-turn-helix and binds DNA [, ]. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0005509 calcium ion binding, 0006355 regulation of transcription, DNA-dependent, 0042173 regulation of sporulation resulting in formation of a cellular spore, 0005737 cytoplasm; PDB: 1FC3_C 1LQ1_D.
Probab=35.94  E-value=7.5  Score=26.35  Aligned_cols=19  Identities=32%  Similarity=0.471  Sum_probs=14.8

Q ss_pred             hHHHHHhhhhhhcCCCCcC
Q psy16017         66 VRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        66 vkELY~kIae~f~i~p~e~   84 (85)
                      .|+||-.||+.|+.+++-|
T Consensus        39 tK~LYp~IA~k~~TT~s~V   57 (106)
T PF08769_consen   39 TKELYPDIAKKYGTTPSRV   57 (106)
T ss_dssp             TTTHHHHHHHHTTS-HHHH
T ss_pred             hhhHHHHHHHHHCCCHHHH
Confidence            3679999999999887654


No 54 
>PRK11511 DNA-binding transcriptional activator MarA; Provisional
Probab=35.78  E-value=16  Score=24.41  Aligned_cols=25  Identities=20%  Similarity=0.509  Sum_probs=22.1

Q ss_pred             cCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         61 SGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      -||++..-++...-+.|+++|.+.|
T Consensus        84 ~Gf~s~s~F~r~Fkk~~G~tP~~yR  108 (127)
T PRK11511         84 YGFESQQTLTRTFKNYFDVPPHKYR  108 (127)
T ss_pred             hCCCCHHHHHHHHHHHHCcCHHHHH
Confidence            5899999999999999999998753


No 55 
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N   HOIL-1 (heme-oxidized IRP2 ubiquitin ligase-1) is an E3 ubiquitin-protein ligase that recognizes heme-oxidized IRP2 (iron regulatory protein2) and is thought to affect the turnover of oxidatively damaged proteins.  Hoil-1 has an amino-terminal ubiquitin-like domain as well as an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.
Probab=35.47  E-value=23  Score=22.19  Aligned_cols=26  Identities=23%  Similarity=0.266  Sum_probs=21.5

Q ss_pred             eccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .|+.-.+|.+|-++|.+.++||+++-
T Consensus        18 ~v~~~~TV~~lK~kI~~~~gip~~~Q   43 (75)
T cd01799          18 TVRPDMTVAQLKDKVFLDYGFPPAVQ   43 (75)
T ss_pred             EECCCCcHHHHHHHHHHHHCcCHHHE
Confidence            34556789999999999999999754


No 56 
>cd01769 UBL Ubiquitin-like domain of UBL. UBLs function by remodeling the surface of their target proteins, changing their target's half-life, enzymatic activity, protein-protein interactions, subcellular localization or other properties. At least 10 different ubiquitin-like modifications exist in mammals, and attachment of different ubls to a target leads to different biological consequences. Ubl-conjugation cascades are initiated by activating enzymes, which also coordinate the ubls with their downstream pathways.
Probab=33.97  E-value=30  Score=19.36  Aligned_cols=23  Identities=35%  Similarity=0.296  Sum_probs=18.5

Q ss_pred             CccchHHHHHhhhhhhcCCCCcC
Q psy16017         62 GFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        62 gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      .-.++.+|-+.|++.+++++++.
T Consensus        16 ~~~ti~~lK~~i~~~~~~~~~~~   38 (69)
T cd01769          16 PDDTVAELKAKIAAKEGVPPEQQ   38 (69)
T ss_pred             CCChHHHHHHHHHHHHCcChHHE
Confidence            34579999999999999988653


No 57 
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT contains an N-terminal TRX-like domain, which does not contain the catalytic CXXC motif, followed by one to three glutaredoxin domains. The TRX-like domain is required for interaction with PKC theta. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli.
Probab=33.94  E-value=38  Score=20.16  Aligned_cols=30  Identities=27%  Similarity=0.522  Sum_probs=22.8

Q ss_pred             CCCceeeeeecccCCCceeccCccchHHHHHhhh
Q psy16017         41 SKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIA   74 (85)
Q Consensus        41 ~~p~LvFh~QLAHGSptg~I~gFsnvkELY~kIa   74 (85)
                      .-|.++|--+   |...+++.|+ +.++|.++|+
T Consensus        68 ~~Pt~~~~~~---g~~~~~~~g~-~~~~l~~~~~   97 (97)
T cd02984          68 AVPTFVFFRN---GTIVDRVSGA-DPKELAKKVE   97 (97)
T ss_pred             cccEEEEEEC---CEEEEEEeCC-CHHHHHHhhC
Confidence            3556777754   9999999997 6788888774


No 58 
>cd00489 Barstar_like Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it, thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs  to the same enzyme family as does barnase.
Probab=33.93  E-value=37  Score=21.97  Aligned_cols=21  Identities=10%  Similarity=0.346  Sum_probs=17.8

Q ss_pred             cCccchHHHHHhhhhhhcCCC
Q psy16017         61 SGFSNVRELYQKIAECYEFPA   81 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p   81 (85)
                      +..++..++|+.+|++|++|.
T Consensus         6 ~~i~~~~~f~~~~~~~l~fp~   26 (85)
T cd00489           6 EDIADWEDFHARLKKKLGFPD   26 (85)
T ss_pred             ccCCCHHHHHHHHHHHhCCcc
Confidence            456788999999999999874


No 59 
>PF11000 DUF2840:  Protein of unknown function (DUF2840);  InterPro: IPR021263  This bacterial family of proteins have no known function. 
Probab=33.77  E-value=27  Score=26.01  Aligned_cols=26  Identities=23%  Similarity=0.383  Sum_probs=23.6

Q ss_pred             eccCccchHHHHHhhh--hhhcCCCCcC
Q psy16017         59 LISGFSNVRELYQKIA--ECYEFPAEEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIa--e~f~i~p~e~   84 (85)
                      +++|+.+|+...+.|-  |+.||+|.||
T Consensus        87 r~~Gw~kV~~VL~~IDaiEalGidp~dv  114 (149)
T PF11000_consen   87 RIEGWPKVERVLQAIDAIEALGIDPADV  114 (149)
T ss_pred             cccCcHHHHHHHHHHhHHHHcCCChhhc
Confidence            5799999999999997  9999999886


No 60 
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional
Probab=33.22  E-value=19  Score=26.16  Aligned_cols=25  Identities=20%  Similarity=0.333  Sum_probs=19.0

Q ss_pred             cCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         61 SGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      -||+|..-.+...-+.||++|+|.|
T Consensus       274 ~GF~d~s~Fsr~Fkk~~G~sP~~yR  298 (302)
T PRK09685        274 WGFSDSSHFSTAFKQRFGVSPGEYR  298 (302)
T ss_pred             hCCCCHHHHHHHHHHHHCcCHHHHH
Confidence            5788887777777788888887654


No 61 
>PF12872 OST-HTH:  OST-HTH/LOTUS domain; PDB: 2KPM_A 3S93_B 3RCO_A 2KZV_A.
Probab=32.94  E-value=24  Score=20.81  Aligned_cols=19  Identities=32%  Similarity=0.616  Sum_probs=15.3

Q ss_pred             cCccchHHHHHhhhhhhcC
Q psy16017         61 SGFSNVRELYQKIAECYEF   79 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i   79 (85)
                      =||++.++|-+++.+.|.|
T Consensus        45 yG~~~l~~ll~~~~~~~~i   63 (74)
T PF12872_consen   45 YGFSSLSELLESLPDVVEI   63 (74)
T ss_dssp             TTSSSHHHHHHT-TTTEEE
T ss_pred             cCCCcHHHHHHhCCCeEEE
Confidence            3899999999988888776


No 62 
>PF11784 DUF3320:  Protein of unknown function (DUF3320);  InterPro: IPR021754  This family is conserved in Proteobacteria and Chlorobi families. Many members are annotated as being putative DNA helicase-related proteins. 
Probab=32.82  E-value=34  Score=20.38  Aligned_cols=20  Identities=25%  Similarity=0.368  Sum_probs=15.8

Q ss_pred             CccchHHHHHhhhhhhcCCC
Q psy16017         62 GFSNVRELYQKIAECYEFPA   81 (85)
Q Consensus        62 gFsnvkELY~kIae~f~i~p   81 (85)
                      |==...+|.++|++++|++-
T Consensus        25 gPI~~~~L~~Ri~~a~G~~R   44 (52)
T PF11784_consen   25 GPIHEDELARRIARAWGLSR   44 (52)
T ss_pred             CCccHHHHHHHHHHHcCccc
Confidence            33356789999999999874


No 63 
>cd01763 Sumo Small ubiquitin-related modifier (SUMO). Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability.  SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases.
Probab=32.70  E-value=29  Score=21.95  Aligned_cols=41  Identities=15%  Similarity=0.109  Sum_probs=28.6

Q ss_pred             CceeeeeecccCCC-ceeccCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         43 PKLIFHCQLAHGSP-TGLISGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        43 p~LvFh~QLAHGSp-tg~I~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      -.+..++|  .|.. +=.|+-=+.++.|.+++++..+|+++++|
T Consensus        12 i~I~v~~~--~g~~~~~~v~~~~~l~~l~~~y~~~~gi~~~~~r   53 (87)
T cd01763          12 INLKVKGQ--DGNEVFFKIKRSTPLKKLMEAYCQRQGLSMNSVR   53 (87)
T ss_pred             EEEEEECC--CCCEEEEEEcCCCHHHHHHHHHHHHhCCCccceE
Confidence            34555555  3544 33456667788999999999999998764


No 64 
>PF05402 PqqD:  Coenzyme PQQ synthesis protein D (PqqD);  InterPro: IPR008792 This family contains several bacterial coenzyme PQQ synthesis protein D (PqqD) sequences. This protein is required for coenzyme pyrrolo-quinoline-quinone (PQQ) biosynthesis.; PDB: 3G2B_A.
Probab=32.38  E-value=13  Score=21.82  Aligned_cols=25  Identities=32%  Similarity=0.519  Sum_probs=17.0

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      ++|=.++.|+-+.+++.|+++++++
T Consensus        26 ~~g~~t~~ei~~~l~~~y~~~~~~~   50 (68)
T PF05402_consen   26 LDGPRTVEEIVDALAEEYDVDPEEA   50 (68)
T ss_dssp             --SSS-HHHHHHHHHHHTT--HHHH
T ss_pred             ccCCCCHHHHHHHHHHHcCCCHHHH
Confidence            4555789999999999999988754


No 65 
>PF13443 HTH_26:  Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A.
Probab=32.04  E-value=17  Score=20.85  Aligned_cols=17  Identities=29%  Similarity=0.382  Sum_probs=11.5

Q ss_pred             HHHHhhhhhhcCCCCcC
Q psy16017         68 ELYQKIAECYEFPAEEN   84 (85)
Q Consensus        68 ELY~kIae~f~i~p~e~   84 (85)
                      +.-.+||++|+++++|+
T Consensus        41 ~~l~~ia~~l~~~~~el   57 (63)
T PF13443_consen   41 DTLEKIAKALNCSPEEL   57 (63)
T ss_dssp             HHHHHHHHHHT--HHHC
T ss_pred             HHHHHHHHHcCCCHHHH
Confidence            34568999999998875


No 66 
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=32.02  E-value=32  Score=22.93  Aligned_cols=28  Identities=21%  Similarity=0.269  Sum_probs=20.6

Q ss_pred             CCceeccCcc-----chHHHHHhhhhhhcCCCC
Q psy16017         55 SPTGLISGFS-----NVRELYQKIAECYEFPAE   82 (85)
Q Consensus        55 Sptg~I~gFs-----nvkELY~kIae~f~i~p~   82 (85)
                      +|-|++.-|+     ++.||.+.||.-|+++..
T Consensus         7 ~~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~~   39 (86)
T cd06409           7 DPKGRVHRFRLRPSESLEELRTLISQRLGDDDF   39 (86)
T ss_pred             CCCCCEEEEEecCCCCHHHHHHHHHHHhCCccc
Confidence            4455555544     679999999999998753


No 67 
>PF13560 HTH_31:  Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A.
Probab=30.35  E-value=16  Score=21.36  Aligned_cols=18  Identities=22%  Similarity=0.479  Sum_probs=13.0

Q ss_pred             HHHHHhhhhhhcCCCCcC
Q psy16017         67 RELYQKIAECYEFPAEEN   84 (85)
Q Consensus        67 kELY~kIae~f~i~p~e~   84 (85)
                      .+.+.+|+++|+++++++
T Consensus        44 ~~~l~~l~~~l~~~~~~~   61 (64)
T PF13560_consen   44 PDTLQRLARALGVPPDER   61 (64)
T ss_dssp             HHHHHHHHHHTT--HHHH
T ss_pred             HHHHHHHHHHHCcCHHHH
Confidence            457899999999988764


No 68 
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins.
Probab=29.03  E-value=48  Score=16.34  Aligned_cols=17  Identities=24%  Similarity=0.325  Sum_probs=12.8

Q ss_pred             HHHHHhhhhhhcCCCCc
Q psy16017         67 RELYQKIAECYEFPAEE   83 (85)
Q Consensus        67 kELY~kIae~f~i~p~e   83 (85)
                      .+...+|++.|++++.+
T Consensus        39 ~~~~~~i~~~~~~~~~~   55 (56)
T smart00530       39 LETLKKLAKALGVSLDE   55 (56)
T ss_pred             HHHHHHHHHHhCCChhh
Confidence            34457889999998865


No 69 
>PF10668 Phage_terminase:  Phage terminase small subunit;  InterPro: IPR018925  This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].
Probab=29.02  E-value=18  Score=22.85  Aligned_cols=22  Identities=27%  Similarity=0.354  Sum_probs=16.1

Q ss_pred             cchHHHHH---------hhhhhhcCCCCcCC
Q psy16017         64 SNVRELYQ---------KIAECYEFPAEENR   85 (85)
Q Consensus        64 snvkELY~---------kIae~f~i~p~e~~   85 (85)
                      ...+|||.         .||+.++++++.||
T Consensus        10 dkA~e~y~~~~g~i~lkdIA~~Lgvs~~tIr   40 (60)
T PF10668_consen   10 DKAFEIYKESNGKIKLKDIAEKLGVSESTIR   40 (60)
T ss_pred             HHHHHHHHHhCCCccHHHHHHHHCCCHHHHH
Confidence            34456665         59999999988764


No 70 
>PRK12534 RNA polymerase sigma factor; Provisional
Probab=28.91  E-value=21  Score=24.22  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=16.6

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      ++||     -|+.||+.+|++++-|
T Consensus       151 ~~g~-----s~~eIA~~lgis~~~v  170 (187)
T PRK12534        151 FEGI-----TYEELAARTDTPIGTV  170 (187)
T ss_pred             HcCC-----CHHHHHHHhCCChhHH
Confidence            5777     7899999999998755


No 71 
>PF00432 Prenyltrans:  Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family.;  InterPro: IPR001330 The beta subunit of the farnesyltransferases is responsible for peptide binding. Squalene-hopene cyclase is a bacterial enzyme that catalyzes the cyclization of squalene into hopene, a key step in hopanoid (triterpenoid) metabolism []. Lanosterol synthase (5.4.99.7 from EC) (oxidosqualene-lanosterol cyclase) catalyzes the cyclization of (S)-2,3-epoxysqualene to lanosterol, the initial precursor of cholesterol, steroid hormones and vitamin D in vertebrates and of ergosterol in fungi []. Cycloartenol synthase () (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ....
Probab=28.81  E-value=25  Score=19.54  Aligned_cols=31  Identities=26%  Similarity=0.395  Sum_probs=24.5

Q ss_pred             ceeeeeecccCCCceeccCccchHHHHHhhh
Q psy16017         44 KLIFHCQLAHGSPTGLISGFSNVRELYQKIA   74 (85)
Q Consensus        44 ~LvFh~QLAHGSptg~I~gFsnvkELY~kIa   74 (85)
                      +.+..||..-|+.-++.++...+.--|-.++
T Consensus         8 ~~l~~~Q~~dGGf~~~~~~~~d~~~t~~~~~   38 (44)
T PF00432_consen    8 RFLLSCQNPDGGFGGRPGGESDTCYTYCALA   38 (44)
T ss_dssp             HHHHHTBBTTSSBBSSTTSSBBHHHHHHHHH
T ss_pred             HHHHHHCCCCCCCCCCCCCCCChHHHHHHHH
Confidence            4567899999999999999887776665554


No 72 
>smart00386 HAT HAT (Half-A-TPR) repeats. Present in several RNA-binding proteins. Structurally and sequentially thought to be similar to TPRs.
Probab=28.74  E-value=33  Score=16.14  Aligned_cols=18  Identities=17%  Similarity=0.421  Sum_probs=13.5

Q ss_pred             CccchHHHHHhhhhhhcC
Q psy16017         62 GFSNVRELYQKIAECYEF   79 (85)
Q Consensus        62 gFsnvkELY~kIae~f~i   79 (85)
                      .+..++++|++.-+.+..
T Consensus         2 ~~~~~r~i~e~~l~~~~~   19 (33)
T smart00386        2 DIERARKIYERALEKFPK   19 (33)
T ss_pred             cHHHHHHHHHHHHHHCCC
Confidence            466789999998776653


No 73 
>PF14109 GldH_lipo:  GldH lipoprotein
Probab=26.32  E-value=17  Score=25.13  Aligned_cols=23  Identities=30%  Similarity=0.563  Sum_probs=17.0

Q ss_pred             ceeeeeeccc--CCCceeccCccchHH
Q psy16017         44 KLIFHCQLAH--GSPTGLISGFSNVRE   68 (85)
Q Consensus        44 ~LvFh~QLAH--GSptg~I~gFsnvkE   68 (85)
                      +=...|+||.  |.+.|  +||++++|
T Consensus        67 ~dtl~~~Lad~~G~w~G--~G~~~~~e   91 (131)
T PF14109_consen   67 TDTLECELADPDGKWLG--KGIGDLYE   91 (131)
T ss_pred             eeeEEEEEECCCCcEee--eeEeEeEE
Confidence            4568999998  66666  78887654


No 74 
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120. SF3a120_C  Mammalian splicing factor SF3a consists of three subunits of 60, 66, and 120 kDa and functions early during pre-mRNA splicing by converting the U2 snRNP to its active form.  The 120kDa subunit (SF3a120) has a carboxy-terminal ubiquitin-like domain and two SWAP (suppressor-of-white-apricot) domains, referred to collectively as the SURP module, at its amino-terminus.
Probab=25.56  E-value=42  Score=20.47  Aligned_cols=24  Identities=29%  Similarity=0.188  Sum_probs=20.3

Q ss_pred             ccCccchHHHHHhhhhhhcCCCCc
Q psy16017         60 ISGFSNVRELYQKIAECYEFPAEE   83 (85)
Q Consensus        60 I~gFsnvkELY~kIae~f~i~p~e   83 (85)
                      |+...+|.+|-++|.+..+||+++
T Consensus        14 v~~~~TV~~lK~~i~~~~gip~~~   37 (76)
T cd01800          14 LQLSDPVSVLKVKIHEETGMPAGK   37 (76)
T ss_pred             ECCCCcHHHHHHHHHHHHCCCHHH
Confidence            456678999999999999998864


No 75 
>PF10542 Vitelline_membr:  Vitelline membrane cysteine-rich region;  InterPro: IPR013135 In Drosophila melanogaster (Fruit fly) the vitelline membrane (VM) is the first layer of the eggshell produced by the follicular epithelium. It is composed of at least four different proteins. VM proteins are similarly organised with a central highly conserved 38-amino acid domain which is flanked by unrelated regions. Since the surrounding regions have diverged significantly, it is possible that the VM domain is of key importance in VM protein structure [, ]. The VM domain contains three highly conserved cysteines.
Probab=25.26  E-value=51  Score=19.68  Aligned_cols=13  Identities=23%  Similarity=0.521  Sum_probs=10.0

Q ss_pred             CCCCCceeeeeec
Q psy16017         39 EDSKPKLIFHCQL   51 (85)
Q Consensus        39 ~~~~p~LvFh~QL   51 (85)
                      +.+.-..||.||-
T Consensus         5 PpCpknY~FSCqp   17 (38)
T PF10542_consen    5 PPCPKNYVFSCQP   17 (38)
T ss_pred             CCCCcceeEeccc
Confidence            4566689999993


No 76 
>PHA01976 helix-turn-helix protein
Probab=25.12  E-value=27  Score=20.22  Aligned_cols=17  Identities=6%  Similarity=0.061  Sum_probs=13.2

Q ss_pred             HHHHhhhhhhcCCCCcC
Q psy16017         68 ELYQKIAECYEFPAEEN   84 (85)
Q Consensus        68 ELY~kIae~f~i~p~e~   84 (85)
                      +...+||++|+++++++
T Consensus        45 ~~l~~ia~~l~v~~~~l   61 (67)
T PHA01976         45 KTLLRLADALGVTLDWL   61 (67)
T ss_pred             HHHHHHHHHHCcCHHHH
Confidence            34579999999998754


No 77 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=24.83  E-value=33  Score=19.93  Aligned_cols=24  Identities=25%  Similarity=0.450  Sum_probs=12.9

Q ss_pred             eeeeeecccCCCceeccCccchHH
Q psy16017         45 LIFHCQLAHGSPTGLISGFSNVRE   68 (85)
Q Consensus        45 LvFh~QLAHGSptg~I~gFsnvkE   68 (85)
                      |+|.|+...+.|.-.|.=|-|-++
T Consensus         1 ~~L~C~a~~~~p~~~~~W~~~g~~   24 (76)
T cd05895           1 LVLRCETVSEYPSLRFKWFKNGKE   24 (76)
T ss_pred             CEEEEecccCCCCCceEEEECCcc
Confidence            567777555556555544444333


No 78 
>PF12844 HTH_19:  Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B.
Probab=24.72  E-value=22  Score=20.35  Aligned_cols=17  Identities=29%  Similarity=0.313  Sum_probs=12.4

Q ss_pred             HHHHhhhhhhcCCCCcC
Q psy16017         68 ELYQKIAECYEFPAEEN   84 (85)
Q Consensus        68 ELY~kIae~f~i~p~e~   84 (85)
                      +.-.+||++|+++++++
T Consensus        42 ~~l~~i~~~~~v~~~~l   58 (64)
T PF12844_consen   42 STLKKIAEALGVSLDEL   58 (64)
T ss_dssp             HHHHHHHHHHTS-HHHH
T ss_pred             HHHHHHHHHhCCCHHHH
Confidence            45588999999998753


No 79 
>PF01381 HTH_3:  Helix-turn-helix;  InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould).; GO: 0043565 sequence-specific DNA binding; PDB: 2AXU_A 2AWI_D 2AXV_D 2AXZ_C 2AW6_A 3KXA_C 3BS3_A 2CRO_A 1ZUG_A 3CRO_R ....
Probab=24.31  E-value=14  Score=20.49  Aligned_cols=15  Identities=27%  Similarity=0.277  Sum_probs=10.8

Q ss_pred             HHHhhhhhhcCCCCc
Q psy16017         69 LYQKIAECYEFPAEE   83 (85)
Q Consensus        69 LY~kIae~f~i~p~e   83 (85)
                      .-.+||++|++++++
T Consensus        40 ~~~~ia~~l~~~~~~   54 (55)
T PF01381_consen   40 TLKKIAKALGVSPEY   54 (55)
T ss_dssp             HHHHHHHHHTSEHHH
T ss_pred             HHHHHHHHHCCCHHH
Confidence            345788888887754


No 80 
>PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional
Probab=24.14  E-value=48  Score=26.37  Aligned_cols=25  Identities=28%  Similarity=0.516  Sum_probs=22.8

Q ss_pred             cCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         61 SGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      -||+|..-+|....+.|+++|++.|
T Consensus       157 ~Gf~s~s~F~~~Fkk~~G~TPs~yR  181 (353)
T PRK15435        157 AGFPDSSSYYRKADETLGMTAKQFR  181 (353)
T ss_pred             hCCCChHHHHHHHHHHHCcCchhHH
Confidence            5999999999999999999999864


No 81 
>KOG4812|consensus
Probab=23.99  E-value=28  Score=28.01  Aligned_cols=65  Identities=9%  Similarity=0.046  Sum_probs=41.3

Q ss_pred             CCCCCCCCCCcCCCCcccccCCCCCCCCCCCCCCceeeeeecccCCCceeccCccchHHHHHhhh
Q psy16017         10 KDDHLLDNNNVGEHKSKIYNGTKSPAPVTEDSKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIA   74 (85)
Q Consensus        10 k~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~p~LvFh~QLAHGSptg~I~gFsnvkELY~kIa   74 (85)
                      ..++.+..+--.+|++-+++-...++.....+.|+.+.|.+.-|-+-...-..+..++++|.||-
T Consensus        20 r~t~~~e~ea~~g~~q~d~~~~e~s~l~~~~~~~~~~p~q~~~q~as~~p~~~a~~~p~~~~ki~   84 (262)
T KOG4812|consen   20 RDTQTVEGEAEIGSDQEDSIEDEGSPLAANEPAPRSVPHQLQVQLASGAPGRHAGILPPPYSKIP   84 (262)
T ss_pred             cccCCCccccccCCchhhhhhhccCcccccCCCCccchHHHHHhhccCCchhhcCCCCCcccccc
Confidence            34555555555677776666666655445556667776655555554444567888889998885


No 82 
>PF11976 Rad60-SLD:  Ubiquitin-2 like Rad60 SUMO-like;  InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair []. Unlike ubiquitin, they are not involved in protein degradation.  This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.; PDB: 3RD2_A 2JXX_A 3RCZ_A 3GOE_A 3A4S_D 3A4R_B 2IO1_D 1U4A_A 2K1F_A 1WZ0_A ....
Probab=23.93  E-value=64  Score=18.90  Aligned_cols=26  Identities=23%  Similarity=0.252  Sum_probs=21.4

Q ss_pred             eccCccchHHHHHhhhhhhcCCC-CcC
Q psy16017         59 LISGFSNVRELYQKIAECYEFPA-EEN   84 (85)
Q Consensus        59 ~I~gFsnvkELY~kIae~f~i~p-~e~   84 (85)
                      .|.--+.++.|.+++++..++++ .++
T Consensus        16 ~v~~~~~~~~l~~~~~~~~~i~~~~~~   42 (72)
T PF11976_consen   16 KVKPTTTVSKLIEKYCEKKGIPPEESI   42 (72)
T ss_dssp             EEETTSCCHHHHHHHHHHHTTTT-TTE
T ss_pred             EECCCCcHHHHHHHHHHhhCCCccceE
Confidence            35667889999999999999998 554


No 83 
>PRK02289 4-oxalocrotonate tautomerase; Provisional
Probab=23.80  E-value=54  Score=19.28  Aligned_cols=19  Identities=21%  Similarity=0.291  Sum_probs=14.4

Q ss_pred             hHHHHHhhhhhhcCCCCcC
Q psy16017         66 VRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        66 vkELY~kIae~f~i~p~e~   84 (85)
                      ++++++.++++|++|++.|
T Consensus        21 ~~~it~a~~~~~~~p~~~v   39 (60)
T PRK02289         21 AREVTEVVSRIAKAPKEAI   39 (60)
T ss_pred             HHHHHHHHHHHhCcCcceE
Confidence            3567777889999987754


No 84 
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N   N-terminal domain of Tsc13.  Tsc13 is an enoyl reductase involved in  elongation of long chain fatty acids that localizes to the endoplasmic reticulum and is highly enriched in a novel structure marking nuclear-vacuolar junctions.
Probab=23.79  E-value=60  Score=19.88  Aligned_cols=21  Identities=14%  Similarity=0.126  Sum_probs=15.9

Q ss_pred             ccchHHHHHhhhhhhcC-CCCc
Q psy16017         63 FSNVRELYQKIAECYEF-PAEE   83 (85)
Q Consensus        63 FsnvkELY~kIae~f~i-~p~e   83 (85)
                      -..|.||++.|++.++. ++..
T Consensus        22 ~aTV~dlk~~i~~~~~~~~~~R   43 (77)
T cd01801          22 DATIADLKKLIAKSSPQLTVNR   43 (77)
T ss_pred             CccHHHHHHHHHHHcCCCCcce
Confidence            35799999999988764 4544


No 85 
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA. This putative transcriptional regulator, which contains both the substrate-binding, dimerization domain (pfam02311) and the helix-turn-helix DNA-binding domain (pfam00165) of the AraC famil, is located proximal to genes of the 4-hydroxyphenylacetate catabolism pathway.
Probab=23.74  E-value=39  Score=24.23  Aligned_cols=22  Identities=5%  Similarity=0.095  Sum_probs=11.2

Q ss_pred             CccchHHHHHhhhhhhcCCCCc
Q psy16017         62 GFSNVRELYQKIAECYEFPAEE   83 (85)
Q Consensus        62 gFsnvkELY~kIae~f~i~p~e   83 (85)
                      ||+|..-.+.---+.+|++|.+
T Consensus       262 GF~s~s~Fsr~FKk~~G~tP~~  283 (287)
T TIGR02297       262 GYKDPAYFARFFQKETGLSPSA  283 (287)
T ss_pred             CCCCHHHHHHHHHHHHCcCHHH
Confidence            4555555555555555555544


No 86 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=23.47  E-value=41  Score=19.58  Aligned_cols=16  Identities=38%  Similarity=0.729  Sum_probs=9.3

Q ss_pred             eeeeeecccCCCceecc
Q psy16017         45 LIFHCQLAHGSPTGLIS   61 (85)
Q Consensus        45 LvFh~QLAHGSptg~I~   61 (85)
                      |++.|+ |+|.|.-.|.
T Consensus         1 ~~L~C~-~~G~P~P~v~   16 (71)
T cd05876           1 LVLECI-AEGLPTPEVH   16 (71)
T ss_pred             CEEEEE-eeEecCCeEE
Confidence            456665 5666665554


No 87 
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings. This family includes protoporphyrin IX ferrochelatase (HemH), sirohydrochlorin ferrochelatase (SirB) and the cobaltochelatases, CbiK and CbiX. HemH and SirB are involved in heme and siroheme biosynthesis, respectively, while the cobaltochelatases are associated with cobalamin biosynthesis. Excluded from this family are the ATP-dependent heterotrimeric chelatases (class I) and the multifunctional homodimeric enzymes with dehydrogenase and chelatase activities (class III).
Probab=23.14  E-value=76  Score=19.30  Aligned_cols=26  Identities=23%  Similarity=0.305  Sum_probs=13.2

Q ss_pred             cccCCCceeccCccchHHHHHhhhhhh
Q psy16017         51 LAHGSPTGLISGFSNVRELYQKIAECY   77 (85)
Q Consensus        51 LAHGSptg~I~gFsnvkELY~kIae~f   77 (85)
                      ++|||+... ..-.-+.++.+.+++.+
T Consensus         5 v~HGs~~~s-~~~~~~~~~~~~l~~~~   30 (101)
T cd03409           5 VGHGSPYKD-PYKKDIEAQAHNLAESL   30 (101)
T ss_pred             EECCCCCCc-cHHHHHHHHHHHHHHHC
Confidence            589998651 11123444455555443


No 88 
>PRK15121 right oriC-binding transcriptional activator; Provisional
Probab=23.08  E-value=37  Score=25.14  Aligned_cols=25  Identities=8%  Similarity=0.127  Sum_probs=22.2

Q ss_pred             cCccchHHHHHhhhhhhcCCCCcCC
Q psy16017         61 SGFSNVRELYQKIAECYEFPAEENR   85 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p~e~~   85 (85)
                      -||++..-++..--+.|+++|++.|
T Consensus        80 ~Gf~s~~~f~r~Fk~~~g~sP~~~r  104 (289)
T PRK15121         80 YRFDSQQTFTRAFKKQFAQTPALYR  104 (289)
T ss_pred             HCCCCHHHHHHHHHHHHCcCHHHHH
Confidence            4899999999999999999998764


No 89 
>PF03517 Voldacs:  Regulator of volume decrease after cellular swelling;  InterPro: IPR003521 The nucleotide-sensitive chloride conductance regulatory protein (ICln) is found ubiquitously in mammalian (and other) cell types and is postulated to play a critical role in cell volume regulation. Initial studies proposed that ICln was itself a swelling-activated anion channel; however, further studies demonstrated that it is localised primarily to the cell cytoplasm. It has therefore been postulated that activation of cell volume regulation may involve reversible translocation of ICln from the cytoplasm, and its insertion into the plasma membrane. It is not resolved whether the anionic channel involved in cell volume regulation after cell-swelling comprises one or more subunits, and if it does, whether ICln is in fact one of them [].; GO: 0006821 chloride transport, 0006884 cell volume homeostasis; PDB: 1ZYI_A.
Probab=22.97  E-value=50  Score=22.69  Aligned_cols=19  Identities=21%  Similarity=0.639  Sum_probs=12.7

Q ss_pred             chHHHHHhhhhhhcCCCCc
Q psy16017         65 NVRELYQKIAECYEFPAEE   83 (85)
Q Consensus        65 nvkELY~kIae~f~i~p~e   83 (85)
                      .+.++|+.|++|..+.|+.
T Consensus        91 ~l~~if~Als~C~~LhPD~  109 (135)
T PF03517_consen   91 MLDEIFEALSECQELHPDP  109 (135)
T ss_dssp             -HHHHHHHHHHHHH-----
T ss_pred             HHHHHHHHHHHHHHhCCCC
Confidence            3999999999999988865


No 90 
>COG4229 Predicted enolase-phosphatase [Energy production and conversion]
Probab=22.77  E-value=46  Score=26.37  Aligned_cols=43  Identities=33%  Similarity=0.438  Sum_probs=30.9

Q ss_pred             CCCceeeeeecccCCCceeccCccch-------HHHHHhhhhhhcCCCCcC
Q psy16017         41 SKPKLIFHCQLAHGSPTGLISGFSNV-------RELYQKIAECYEFPAEEN   84 (85)
Q Consensus        41 ~~p~LvFh~QLAHGSptg~I~gFsnv-------kELY~kIae~f~i~p~e~   84 (85)
                      +..+|.|-|--| |-=.+.++||-+.       ...|++||+..+++|.|+
T Consensus       131 ~AQkL~Fghs~a-gdL~~lfsGyfDttiG~KrE~~SY~kIa~~iGl~p~ei  180 (229)
T COG4229         131 KAQKLFFGHSDA-GDLNSLFSGYFDTTIGKKRESQSYAKIAGDIGLPPAEI  180 (229)
T ss_pred             hhHHHhhccccc-ccHHhhhcceeeccccccccchhHHHHHHhcCCCchhe
Confidence            445788877532 4445566776543       568999999999999885


No 91 
>PF14560 Ubiquitin_2:  Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A.
Probab=22.72  E-value=70  Score=19.88  Aligned_cols=30  Identities=23%  Similarity=0.193  Sum_probs=24.2

Q ss_pred             CCceeccCccchHHHHHhhhhhhcCCCCcC
Q psy16017         55 SPTGLISGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        55 Sptg~I~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      +..-++.--.+|.||=++|...+|++++..
T Consensus        15 ~~ekr~~~~~Tv~eLK~kl~~~~Gi~~~~m   44 (87)
T PF14560_consen   15 SVEKRFPKSITVSELKQKLEKLTGIPPSDM   44 (87)
T ss_dssp             EEEEEEETTSBHHHHHHHHHHHHTS-TTTE
T ss_pred             eEEEEcCCCCCHHHHHHHHHHHhCCCcccE
Confidence            344677777899999999999999999864


No 92 
>PF10685 KGG:  Stress-induced bacterial acidophilic repeat motif;  InterPro: IPR019626  This repeat contains a highly conserved, characteristic sequence motif, KGG, that is recognised by plants and lower eukaryotes. Further downstream from this motif is a Walker A, nucleotide binding motif. YciG is expressed as part of a three-gene operon, yciGFE and this operon is induced by stress and is regulated by RpoS, which controls the general stress-response in E coli. YciG was shown to be important for stationary-phase resistance to thermal stress and in particular to acid stress []. 
Probab=22.53  E-value=66  Score=16.99  Aligned_cols=14  Identities=21%  Similarity=0.299  Sum_probs=11.9

Q ss_pred             Cccc-hHHHHHhhhh
Q psy16017         62 GFSN-VRELYQKIAE   75 (85)
Q Consensus        62 gFsn-vkELY~kIae   75 (85)
                      ||.| .+|.+..||+
T Consensus         1 ~Fa~~d~e~~~eig~   15 (23)
T PF10685_consen    1 NFASMDPEKAREIGR   15 (23)
T ss_pred             CccccCHHHHHHHHH
Confidence            6888 8999999885


No 93 
>PF06971 Put_DNA-bind_N:  Putative DNA-binding protein N-terminus;  InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins. These are redox-sensing repressors that appear to be widespread among Gram-positive bacteria []. They modulate transcription in response to changes in cellular NADH/NAD(+) redox state. Rex is predicted to include a pyridine nucleotide-binding domain (Rossmann fold), and residues that might play key structural and nucleotide binding roles are highly conserved.; GO: 0045892 negative regulation of transcription, DNA-dependent, 0051775 response to redox state, 0005737 cytoplasm; PDB: 3IL2_B 3IKT_A 3IKV_B 1XCB_F 2DT5_A 2VT3_A 2VT2_A 3KEO_B 3KET_A 3KEQ_A ....
Probab=22.36  E-value=17  Score=22.04  Aligned_cols=17  Identities=24%  Similarity=0.276  Sum_probs=12.7

Q ss_pred             HHHhhhhhhcCCCCcCC
Q psy16017         69 LYQKIAECYEFPAEENR   85 (85)
Q Consensus        69 LY~kIae~f~i~p~e~~   85 (85)
                      ..+.||+..+|++.+||
T Consensus        30 SS~~La~~~gi~~~qVR   46 (50)
T PF06971_consen   30 SSQELAEALGITPAQVR   46 (50)
T ss_dssp             -HHHHHHHHTS-HHHHH
T ss_pred             CHHHHHHHHCCCHHHhc
Confidence            35678999999998876


No 94 
>smart00482 POLAc DNA polymerase A domain.
Probab=21.90  E-value=14  Score=26.81  Aligned_cols=33  Identities=33%  Similarity=0.468  Sum_probs=25.7

Q ss_pred             ccCC-CceeccCccchHHHHHhhhh-hhcCCCCcC
Q psy16017         52 AHGS-PTGLISGFSNVRELYQKIAE-CYEFPAEEN   84 (85)
Q Consensus        52 AHGS-ptg~I~gFsnvkELY~kIae-~f~i~p~e~   84 (85)
                      ||=| ....++.|.+-.++|..+|. .|+++.+||
T Consensus        30 A~ls~D~~l~~~~~~g~D~h~~~A~~~~g~~~~~v   64 (206)
T smart00482       30 AHLSGDENLLEAFNNGGDIHSKTAAQVFGVPEEEV   64 (206)
T ss_pred             HHHcCCHHHHHHHhcCCCHHHHHHHHHhCCChhhC
Confidence            4443 56778888887899999996 789988775


No 95 
>COG4031 Predicted metal-binding protein [General function prediction only]
Probab=21.63  E-value=63  Score=25.54  Aligned_cols=21  Identities=38%  Similarity=0.817  Sum_probs=16.3

Q ss_pred             eeeecccCCCceeccCccchHHHHHhhhhh
Q psy16017         47 FHCQLAHGSPTGLISGFSNVRELYQKIAEC   76 (85)
Q Consensus        47 Fh~QLAHGSptg~I~gFsnvkELY~kIae~   76 (85)
                      ||.|   |-++|      ++|+||..|||-
T Consensus        48 ~~~~---gDedg------~lRNl~erlae~   68 (227)
T COG4031          48 FSIR---GDEDG------SLRNLYERLAER   68 (227)
T ss_pred             eccc---CCCcc------hHHHHHHHHHHH
Confidence            5554   89988      678899999953


No 96 
>PRK13503 transcriptional activator RhaS; Provisional
Probab=21.04  E-value=37  Score=24.16  Aligned_cols=6  Identities=0%  Similarity=0.373  Sum_probs=2.1

Q ss_pred             hhhcCC
Q psy16017         75 ECYEFP   80 (85)
Q Consensus        75 e~f~i~   80 (85)
                      +.+|++
T Consensus       260 k~~G~T  265 (278)
T PRK13503        260 REFSWS  265 (278)
T ss_pred             HHHCcC
Confidence            333333


No 97 
>PF10545 MADF_DNA_bdg:  Alcohol dehydrogenase transcription factor Myb/SANT-like;  InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats. The MADF domain is found in one or more copies in eukaryotic and viral proteins and is often associated with the BESS domain []. MADF is related to the Myb DNA-binding domain (IPR001005 from INTERPRO). The retroviral oncogene v-myb, and its cellular counterpart c-myb, are nuclear DNA-binding proteins that specifically recognise the sequence YAAC(G/T)G. It is likely that the MADF domain is more closely related to the myb/SANT domain than it is to other HTH domains. Some proteins known to contain a MADF domain are listed below:    Drosophila Adf-1, a transcription factor first identified on the basis of its interaction with the alcohol dehydrogenase promoter but that binds the promoters of a diverse group of genes [].  Drosophila Dorsal-interacting protein 3 (Dip3), which functions both as an activator to bind DNA in a sequence specific manner and a coactivator to stimulate synergistic activation by Dorsal and Twist [].  Drosophila Stonewall (Stwl), a putative transcription factor required for maintenance of female germline stem cells as well as oocyte differentiation.   
Probab=20.99  E-value=33  Score=20.08  Aligned_cols=19  Identities=26%  Similarity=0.382  Sum_probs=14.5

Q ss_pred             chHHHHHhhhhhhc--CCCCc
Q psy16017         65 NVRELYQKIAECYE--FPAEE   83 (85)
Q Consensus        65 nvkELY~kIae~f~--i~p~e   83 (85)
                      ...++|+.||+.++  ++.++
T Consensus        24 ~r~~aw~~Ia~~l~~~~~~~~   44 (85)
T PF10545_consen   24 LREEAWQEIARELGKEFSVDD   44 (85)
T ss_pred             HHHHHHHHHHHHHccchhHHH
Confidence            46789999999888  66544


No 98 
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=20.90  E-value=65  Score=19.33  Aligned_cols=18  Identities=28%  Similarity=0.593  Sum_probs=10.3

Q ss_pred             eeeeeecccCCCceeccCc
Q psy16017         45 LIFHCQLAHGSPTGLISGF   63 (85)
Q Consensus        45 LvFh~QLAHGSptg~I~gF   63 (85)
                      ++|.|+ |.|+|+-.|.=+
T Consensus         1 ~~l~C~-a~G~P~P~i~W~   18 (77)
T cd05874           1 IVIQCE-AKGKPPPSFSWT   18 (77)
T ss_pred             CEEEee-CcccCCCeEEEE
Confidence            356666 566666665433


No 99 
>COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription]
Probab=20.82  E-value=46  Score=20.15  Aligned_cols=24  Identities=13%  Similarity=0.265  Sum_probs=18.6

Q ss_pred             cCccchHHHHHhhhhhhcCCCCcC
Q psy16017         61 SGFSNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        61 ~gFsnvkELY~kIae~f~i~p~e~   84 (85)
                      -||++..-.+...-..++++|.+.
T Consensus        95 ~Gf~~~s~F~~~Fk~~~g~tP~~~  118 (127)
T COG2207          95 LGYSSPSHFSRAFKRLFGVTPSEY  118 (127)
T ss_pred             hCcCCHHHHHHHHHHHhCCChHHH
Confidence            478888777777778888888764


No 100
>TIGR02408 ectoine_ThpD ectoine hydroxylase. Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.
Probab=20.65  E-value=54  Score=24.59  Aligned_cols=17  Identities=29%  Similarity=0.677  Sum_probs=14.1

Q ss_pred             ceeeeeecccCCCceec
Q psy16017         44 KLIFHCQLAHGSPTGLI   60 (85)
Q Consensus        44 ~LvFh~QLAHGSptg~I   60 (85)
                      -|+|||.+-|||..-+-
T Consensus       220 vl~f~~~~~H~S~~N~s  236 (277)
T TIGR02408       220 AVWFDCNTMHGSGSNIT  236 (277)
T ss_pred             EEEEccccccCCCCCCC
Confidence            68999999999976543


No 101
>smart00266 CAD Domains present in proteins implicated in post-mortem DNA fragmentation.
Probab=20.49  E-value=84  Score=20.69  Aligned_cols=21  Identities=24%  Similarity=0.423  Sum_probs=17.7

Q ss_pred             cchHHHHHhhhhhhcCCCCcC
Q psy16017         64 SNVRELYQKIAECYEFPAEEN   84 (85)
Q Consensus        64 snvkELY~kIae~f~i~p~e~   84 (85)
                      +|.+||-.|.++.|.++...+
T Consensus        19 ~sL~eL~~K~~~~l~l~~~~~   39 (74)
T smart00266       19 SSLEELLSKVCDKLALPDSPV   39 (74)
T ss_pred             CCHHHHHHHHHHHhCCCCCCc
Confidence            588999999999999986543


No 102
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional
Probab=20.48  E-value=1.3e+02  Score=21.32  Aligned_cols=37  Identities=19%  Similarity=0.244  Sum_probs=31.8

Q ss_pred             CCceeeeeecccCCCceeccCccchHHHHHhhhhhhcCCC
Q psy16017         42 KPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPA   81 (85)
Q Consensus        42 ~p~LvFh~QLAHGSptg~I~gFsnvkELY~kIae~f~i~p   81 (85)
                      -|.|+|--.   |-..|+|.|+.+-.++.+.|.+..+=+.
T Consensus        92 iPTLl~Fkd---Gk~v~~i~G~~~k~~l~~~I~~~L~~~~  128 (132)
T PRK11509         92 FPATLVFTG---GNYRGVLNGIHPWAELINLMRGLVEPQQ  128 (132)
T ss_pred             CCEEEEEEC---CEEEEEEeCcCCHHHHHHHHHHHhcCcC
Confidence            568999888   9999999999999999999988776543


Done!