Query         psy16018
Match_columns 89
No_of_seqs    77 out of 79
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 18:49:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy16018.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/16018hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3938|consensus              100.0 7.2E-29 1.6E-33  198.3   7.1   84    1-85      1-94  (334)
  2 PF03925 SeqA:  SeqA protein;    83.4    0.68 1.5E-05   35.5   1.5   23   66-88      7-32  (190)
  3 PRK11187 replication initiatio  81.5    0.99 2.2E-05   34.6   1.8   23   66-88      7-32  (182)
  4 PF13443 HTH_26:  Cro/C1-type H  75.8     1.8 3.9E-05   25.2   1.3   20   68-87     41-60  (63)
  5 PF02773 S-AdoMet_synt_C:  S-ad  75.7     2.6 5.6E-05   31.1   2.4   26   64-89     89-114 (138)
  6 cd01807 GDX_N ubiquitin-like d  75.4     3.6 7.8E-05   25.1   2.7   25   59-83     16-40  (74)
  7 PF14552 Tautomerase_2:  Tautom  73.5       2 4.4E-05   28.1   1.3   20   66-85     45-68  (82)
  8 smart00760 Bac_DnaA_C Bacteria  73.1     4.2 9.1E-05   24.4   2.5   22   65-86      1-22  (60)
  9 PF11543 UN_NPL4:  Nuclear pore  72.7     2.5 5.4E-05   27.5   1.6   24   60-83     20-43  (80)
 10 PF00240 ubiquitin:  Ubiquitin   70.9     4.4 9.6E-05   23.8   2.3   26   59-84     11-36  (69)
 11 cd01803 Ubiquitin Ubiquitin. U  70.4     4.9 0.00011   23.8   2.4   26   59-84     16-41  (76)
 12 PF05402 PqqD:  Coenzyme PQQ sy  68.9     5.9 0.00013   23.4   2.5   29   60-88     26-54  (68)
 13 PF08299 Bac_DnaA_C:  Bacterial  66.9     5.4 0.00012   25.0   2.1   22   65-86      1-22  (70)
 14 cd01791 Ubl5 UBL5 ubiquitin-li  66.7     4.8  0.0001   25.5   1.9   26   59-84     17-42  (73)
 15 PF12833 HTH_18:  Helix-turn-he  66.5     7.5 0.00016   23.4   2.7   27   60-86     54-80  (81)
 16 cd01796 DDI1_N DNA damage indu  66.3     6.3 0.00014   24.2   2.3   26   59-84     15-40  (71)
 17 PF08769 Spo0A_C:  Sporulation   65.9     2.6 5.5E-05   28.8   0.6   24   66-89     39-62  (106)
 18 cd01794 DC_UbP_C dendritic cel  65.7     6.9 0.00015   24.3   2.5   26   59-84     14-39  (70)
 19 cd01793 Fubi Fubi ubiquitin-li  65.7     5.8 0.00013   24.2   2.1   26   59-84     14-39  (74)
 20 cd01808 hPLIC_N Ubiquitin-like  65.2     6.9 0.00015   23.7   2.3   25   60-84     16-40  (71)
 21 PF12844 HTH_19:  Helix-turn-he  63.6     5.9 0.00013   23.0   1.8   20   68-87     42-61  (64)
 22 cd01810 ISG15_repeat2 ISG15 ub  63.4     8.7 0.00019   23.5   2.6   26   59-84     14-39  (74)
 23 cd00196 UBQ Ubiquitin-like pro  63.4      10 0.00022   19.0   2.5   25   60-84     14-38  (69)
 24 cd01792 ISG15_repeat1 ISG15 ub  62.9     8.6 0.00019   24.0   2.5   24   60-83     19-42  (80)
 25 cd01804 midnolin_N Ubiquitin-l  62.3     7.5 0.00016   24.4   2.2   25   60-84     18-42  (78)
 26 PF01476 LysM:  LysM domain;  I  61.2     7.4 0.00016   21.0   1.8   19   68-86      7-25  (44)
 27 cd01798 parkin_N amino-termina  60.5     8.9 0.00019   23.0   2.2   25   60-84     15-39  (70)
 28 COG3057 SeqA Negative regulato  60.4     6.3 0.00014   30.3   1.9   23   66-88      7-32  (181)
 29 cd01802 AN1_N ubiquitin-like d  59.4      11 0.00023   25.4   2.6   38   44-83     29-67  (103)
 30 PF07027 DUF1318:  Protein of u  59.2     8.6 0.00019   26.2   2.2   20   67-86     50-69  (95)
 31 PF02071 NSF:  Aromatic-di-Alan  57.3     5.9 0.00013   18.4   0.8   10   68-77      3-12  (12)
 32 PF14338 Mrr_N:  Mrr N-terminal  57.2      10 0.00022   24.3   2.2   23   64-86     20-42  (92)
 33 PF06971 Put_DNA-bind_N:  Putat  56.2     8.8 0.00019   23.4   1.7   20   69-88     30-49  (50)
 34 PF14645 Chibby:  Chibby family  55.9      29 0.00063   24.2   4.4   34   43-76     50-86  (116)
 35 smart00213 UBQ Ubiquitin homol  55.1      15 0.00032   20.6   2.4   26   59-84     15-40  (64)
 36 PHA01976 helix-turn-helix prot  54.2      12 0.00027   21.8   2.1   19   68-86     45-63  (67)
 37 PRK02220 4-oxalocrotonate taut  54.1      10 0.00022   22.1   1.6   18   68-85     23-40  (61)
 38 cd01806 Nedd8 Nebb8-like  ubiq  54.1      16 0.00034   21.6   2.5   24   60-83     17-40  (76)
 39 cd01805 RAD23_N Ubiquitin-like  53.7      13 0.00029   22.3   2.2   25   60-84     17-43  (77)
 40 PRK01964 4-oxalocrotonate taut  53.1      11 0.00023   22.5   1.6   19   67-85     22-40  (64)
 41 PF08281 Sigma70_r4_2:  Sigma-7  51.9      12 0.00026   21.2   1.7   18   69-86     28-45  (54)
 42 PF12085 DUF3562:  Protein of u  51.5      16 0.00034   24.0   2.4   25   64-88      4-28  (66)
 43 cd01812 BAG1_N Ubiquitin-like   51.2      20 0.00042   21.1   2.6   24   60-83     16-39  (71)
 44 KOG3889|consensus               51.1      10 0.00022   31.9   1.8   37   42-79    202-241 (371)
 45 PF13404 HTH_AsnC-type:  AsnC-t  50.5     5.9 0.00013   22.9   0.2   24   65-88     15-38  (42)
 46 PF01337 Barstar:  Barstar (bar  50.5      14 0.00031   23.3   2.0   22   60-81      5-26  (90)
 47 PF13647 Glyco_hydro_80:  Glyco  50.5     8.4 0.00018   31.2   1.2   24   44-68    201-224 (308)
 48 cd01797 NIRF_N amino-terminal   49.5      19 0.00042   22.7   2.5   24   60-83     19-42  (78)
 49 TIGR02899 spore_safA spore coa  48.2      17 0.00036   18.9   1.8   17   70-86      7-23  (44)
 50 COG4229 Predicted enolase-phos  47.2     9.5 0.00021   30.3   1.0   44   41-85    131-181 (229)
 51 PF13560 HTH_31:  Helix-turn-he  46.7      19 0.00041   21.2   2.0   19   67-85     44-62  (64)
 52 PF01402 RHH_1:  Ribbon-helix-h  45.6      25 0.00054   18.9   2.3   22   66-87     10-31  (39)
 53 cd00118 LysM Lysin domain, fou  45.6      21 0.00045   17.5   1.8   17   70-86     11-27  (46)
 54 PF14566 PTPlike_phytase:  Inos  45.4     8.8 0.00019   26.8   0.5   10   42-51    124-133 (149)
 55 COG2411 Uncharacterized conser  45.4      11 0.00024   29.2   1.1   27   58-84     71-98  (188)
 56 TIGR00013 taut 4-oxalocrotonat  44.9      14 0.00031   21.5   1.3   20   66-85     21-40  (63)
 57 cd01809 Scythe_N Ubiquitin-lik  44.0      31 0.00066   20.1   2.7   24   60-83     17-40  (72)
 58 PF01381 HTH_3:  Helix-turn-hel  43.2      14 0.00031   20.6   1.1   16   69-84     40-55  (55)
 59 cd06398 PB1_Joka2 The PB1 doma  43.0      18 0.00038   24.2   1.6   17   65-81     26-42  (91)
 60 PRK09685 DNA-binding transcrip  42.6      29 0.00062   25.4   2.8   29   61-89    274-302 (302)
 61 PTZ00044 ubiquitin; Provisiona  42.5      32  0.0007   20.6   2.6   25   59-83     16-40  (76)
 62 cd05875 Ig6_hNeurofascin_like   41.7      16 0.00034   22.2   1.2   20   45-65      1-20  (77)
 63 cd06406 PB1_P67 A PB1 domain i  41.5      18 0.00039   24.3   1.5   22   64-85     21-42  (80)
 64 cd05140 Barstar_AU1054-like Ba  40.7      25 0.00054   23.1   2.1   22   60-81      5-26  (86)
 65 PF00165 HTH_AraC:  Bacterial r  40.5      39 0.00085   18.4   2.6   24   62-86     19-42  (42)
 66 cd05142 Barstar Barstar is an   39.9      27 0.00058   23.0   2.1   21   61-81      7-27  (87)
 67 PRK06030 hypothetical protein;  39.7      29 0.00063   24.6   2.4   23   64-86     23-45  (124)
 68 PF13350 Y_phosphatase3:  Tyros  38.3      12 0.00025   25.8   0.2   34   44-88    126-160 (164)
 69 PRK10219 DNA-binding transcrip  38.1      39 0.00085   21.4   2.7   26   61-86     80-105 (107)
 70 cd05141 Barstar_evA4336-like B  37.8      31 0.00067   21.9   2.1   21   60-80      5-25  (81)
 71 cd01769 UBL Ubiquitin-like dom  37.0      39 0.00085   19.0   2.3   23   62-84     16-38  (69)
 72 PRK10425 DNase TatD; Provision  36.8      37 0.00081   25.8   2.8   34   54-87    214-247 (258)
 73 PF13419 HAD_2:  Haloacid dehal  36.7      25 0.00054   22.2   1.6   21   65-85    134-154 (176)
 74 cd05749 Ig2_Tyro3_like Second   36.7      23  0.0005   22.2   1.4   19   42-61     13-32  (81)
 75 PF07700 HNOB:  Heme NO binding  36.5      32  0.0007   24.2   2.2   23   66-88     48-70  (171)
 76 PF10545 MADF_DNA_bdg:  Alcohol  36.1      26 0.00057   20.7   1.5   23   65-87     24-48  (85)
 77 PF07836 DmpG_comm:  DmpG-like   35.9      36 0.00078   22.3   2.2   25   63-87     18-42  (66)
 78 cd02984 TRX_PICOT TRX domain,   35.5      33 0.00072   20.6   1.9   29   42-74     69-97  (97)
 79 COG4001 Predicted metal-bindin  34.5      27 0.00059   24.8   1.6   24   66-89     61-84  (102)
 80 cd00489 Barstar_like Barstar i  33.4      39 0.00084   22.0   2.1   21   61-81      6-26  (85)
 81 smart00386 HAT HAT (Half-A-TPR  33.2      39 0.00084   16.0   1.6   19   62-80      2-20  (33)
 82 PF04760 IF2_N:  Translation in  33.0      28 0.00061   20.2   1.3   16   73-88      9-24  (54)
 83 PF11784 DUF3320:  Protein of u  33.0      34 0.00075   20.5   1.7   21   61-81     24-44  (52)
 84 PF10668 Phage_terminase:  Phag  32.7      44 0.00095   21.3   2.2   22   64-85     10-40  (60)
 85 TIGR03859 PQQ_PqqD coenzyme PQ  32.6      45 0.00097   21.2   2.3   28   59-87     39-66  (81)
 86 smart00530 HTH_XRE Helix-turn-  32.6      40 0.00086   16.8   1.7   17   67-83     39-55  (56)
 87 cd00491 4Oxalocrotonate_Tautom  32.6      29 0.00063   19.6   1.3   19   67-85     21-39  (58)
 88 PF13743 Thioredoxin_5:  Thiore  31.7      43 0.00092   23.9   2.2   25   65-89    101-125 (176)
 89 PRK11511 DNA-binding transcrip  31.7      59  0.0013   21.8   2.8   27   61-87     84-110 (127)
 90 smart00257 LysM Lysin motif.    31.7      47   0.001   15.8   1.8   17   70-86     10-26  (44)
 91 smart00342 HTH_ARAC helix_turn  31.5      55  0.0012   18.5   2.3   24   60-83     59-82  (84)
 92 COG2169 Ada Adenosine deaminas  31.4      37  0.0008   26.0   2.0   36   49-84    140-178 (187)
 93 cd01799 Hoil1_N Ubiquitin-like  31.2      59  0.0013   20.5   2.6   25   59-83     18-42  (75)
 94 PF12872 OST-HTH:  OST-HTH/LOTU  30.8      25 0.00055   20.9   0.8   18   62-79     46-63  (74)
 95 PF13542 HTH_Tnp_ISL3:  Helix-t  30.6      43 0.00092   18.7   1.7   19   70-88     30-48  (52)
 96 PF11000 DUF2840:  Protein of u  30.4      35 0.00075   25.7   1.6   29   59-87     87-117 (149)
 97 TIGR02384 RelB_DinJ addiction   28.8      48   0.001   21.6   2.0   24   65-88     12-35  (83)
 98 PF05157 T2SE_Nter:  Type II se  28.7      54  0.0012   20.0   2.1   24   61-84      4-27  (109)
 99 cd01800 SF3a120_C Ubiquitin-li  28.6      73  0.0016   19.5   2.7   24   60-83     14-37  (76)
100 PF14109 GldH_lipo:  GldH lipop  28.4      14 0.00031   25.7  -0.6   23   44-68     67-91  (131)
101 PRK05250 S-adenosylmethionine   27.9      54  0.0012   27.8   2.5   25   65-89    321-345 (384)
102 PF08667 BetR:  BetR domain;  I  27.2      40 0.00088   24.8   1.5   20   65-85     50-69  (147)
103 PRK11449 putative deoxyribonuc  26.8      60  0.0013   24.5   2.4   30   58-87    218-247 (258)
104 PF08383 Maf_N:  Maf N-terminal  26.8      23  0.0005   21.0   0.2   20   69-88     12-32  (35)
105 TIGR02681 phage_pRha phage reg  26.8      37  0.0008   23.2   1.2   20   70-89     16-35  (108)
106 TIGR02607 antidote_HigA addict  26.7      65  0.0014   19.1   2.1   19   68-86     48-66  (78)
107 PF02796 HTH_7:  Helix-turn-hel  26.6      58  0.0013   18.4   1.8   18   71-88     25-42  (45)
108 smart00482 POLAc DNA polymeras  26.4     9.4  0.0002   28.0  -1.9   35   52-86     30-66  (206)
109 PRK13890 conjugal transfer pro  26.3      57  0.0012   22.3   2.1   20   68-87     48-67  (120)
110 cd06409 PB1_MUG70 The MUG70 pr  26.0      48   0.001   22.3   1.6   27   55-81      7-38  (86)
111 TIGR01034 metK S-adenosylmethi  25.9      62  0.0013   27.4   2.5   25   65-89    318-342 (377)
112 cd00569 HTH_Hin_like Helix-tur  25.6      68  0.0015   14.4   1.7   16   70-85     24-39  (42)
113 PF00432 Prenyltrans:  Prenyltr  25.3      32 0.00068   19.3   0.5   31   44-74      8-38  (44)
114 PF13518 HTH_28:  Helix-turn-he  25.2      59  0.0013   17.8   1.7   18   69-86     14-31  (52)
115 PRK12534 RNA polymerase sigma   24.9      51  0.0011   22.5   1.6   21   60-85    151-171 (187)
116 PF05099 TerB:  Tellurite resis  24.9      45 0.00097   21.8   1.3   21   65-85    116-136 (140)
117 COG0600 TauC ABC-type nitrate/  24.6      33 0.00071   26.7   0.7   31   59-89    144-174 (258)
118 smart00595 MADF subfamily of S  24.4      61  0.0013   19.9   1.8   22   66-87     26-47  (89)
119 PF08220 HTH_DeoR:  DeoR-like h  23.9      58  0.0013   19.3   1.5   23   62-88     13-35  (57)
120 PRK12459 S-adenosylmethionine   23.8      72  0.0016   27.1   2.6   26   64-89    324-349 (386)
121 TIGR01691 enolase-ppase 2,3-di  23.8      50  0.0011   24.6   1.5   22   64-85    152-173 (220)
122 cd05895 Ig_Pro_neuregulin-1 Im  23.6      35 0.00076   20.0   0.5   24   45-68      1-24  (76)
123 cd03409 Chelatase_Class_II Cla  23.5      76  0.0017   19.5   2.1   26   51-77      5-30  (101)
124 PF01026 TatD_DNase:  TatD rela  23.5      80  0.0017   23.3   2.5   30   58-87    216-245 (255)
125 PTZ00104 S-adenosylmethionine   23.4      73  0.0016   27.2   2.5   25   65-89    337-361 (398)
126 KOG4812|consensus               23.4      29 0.00063   28.2   0.2   65   10-74     20-84  (262)
127 PF11343 DUF3145:  Protein of u  23.2 1.1E+02  0.0024   23.1   3.3   63   18-89     69-144 (158)
128 cd05876 Ig3_L1-CAM Third immun  23.1      41  0.0009   19.7   0.8   16   45-61      1-16  (71)
129 TIGR02875 spore_0_A sporulatio  23.0      59  0.0013   23.1   1.7   24   66-89    189-212 (262)
130 PRK15044 transcriptional regul  23.0      86  0.0019   25.4   2.8   29   61-89    266-294 (295)
131 cd01815 BMSC_UbP_N Ubiquitin-l  23.0      70  0.0015   21.0   1.9   22   62-83     19-43  (75)
132 PRK09393 ftrA transcriptional   22.9      88  0.0019   23.6   2.7   30   60-89    292-321 (322)
133 PF10683 DBD_Tnp_Hermes:  Herme  22.6      36 0.00078   22.7   0.5   26   61-86     37-64  (68)
134 PRK00745 4-oxalocrotonate taut  22.5      69  0.0015   18.5   1.7   20   66-85     17-40  (62)
135 PRK09940 transcriptional regul  22.3      76  0.0017   24.7   2.3   28   61-88    207-234 (253)
136 TIGR02950 SigM_subfam RNA poly  22.2      70  0.0015   20.8   1.8   22   59-85    118-139 (154)
137 COG3423 Nlp Predicted transcri  21.8      52  0.0011   22.7   1.1   14   72-85     52-65  (82)
138 PF03517 Voldacs:  Regulator of  21.6      58  0.0012   22.6   1.4   20   65-84     91-110 (135)
139 COG1476 Predicted transcriptio  21.6      83  0.0018   20.6   2.0   18   68-85     44-61  (68)
140 smart00421 HTH_LUXR helix_turn  21.5      81  0.0018   16.7   1.7   17   69-85     20-36  (58)
141 PF08598 Sds3:  Sds3-like;  Int  21.3      31 0.00068   24.6   0.0   28   54-89    176-203 (205)
142 PF10542 Vitelline_membr:  Vite  21.1      69  0.0015   19.3   1.4   13   39-51      5-17  (38)
143 COG3384 Aromatic ring-opening   21.0      51  0.0011   26.6   1.1   26   48-74     11-36  (268)
144 cd06170 LuxR_C_like C-terminal  20.9      84  0.0018   16.8   1.7   18   69-86     17-34  (57)
145 COG4031 Predicted metal-bindin  20.9      69  0.0015   25.6   1.8   18   53-76     51-68  (227)
146 PF13936 HTH_38:  Helix-turn-he  20.8      26 0.00057   20.0  -0.4   24   65-88     18-41  (44)
147 PF00085 Thioredoxin:  Thioredo  20.7      97  0.0021   18.2   2.1   31   42-75     72-102 (103)
148 PF14330 DUF4387:  Domain of un  20.7      47   0.001   23.2   0.8   16   71-86     42-57  (99)
149 TIGR01244 conserved hypothetic  20.4      75  0.0016   21.6   1.7   34   44-88     88-121 (135)
150 TIGR01493 HAD-SF-IA-v2 Haloaci  20.3      73  0.0016   21.2   1.6   22   64-85    139-160 (175)
151 PLN02243 S-adenosylmethionine   20.3      95  0.0021   26.4   2.6   25   64-88    328-352 (386)
152 PF10685 KGG:  Stress-induced b  20.2      82  0.0018   16.8   1.5   14   62-75      1-15  (23)
153 cd05874 Ig6_NrCAM Sixth immuno  20.0      69  0.0015   19.4   1.3   18   45-63      1-18  (77)
154 TIGR01068 thioredoxin thioredo  20.0 1.5E+02  0.0033   17.2   2.9   33   41-76     68-100 (101)

No 1  
>KOG3938|consensus
Probab=99.95  E-value=7.2e-29  Score=198.30  Aligned_cols=84  Identities=43%  Similarity=0.723  Sum_probs=64.0

Q ss_pred             CCCccCCCCCCCCCCCCCCcCCCCcc----------cccCCCCCCCCCCCCCCceeeeeecccCCCceeccCccchHHHH
Q psy16018          1 MPLFTRKPKKDDHLLDNNNVGEHKSK----------IYNGTKSPAPVTEDSKPKLIFHCQLAHGSPTGLISGFSNVRELY   70 (89)
Q Consensus         1 m~l~~kk~~k~~~~~~~~~~~~~~~~----------~~~g~~~~~p~~~~~~p~LvFh~QLAHGSptg~I~gF~nvkELY   70 (89)
                      |||+.++-+|.-.......--+-.|.          +.++.+ ..+.+++.+|+||||||||||||||+|+||+||+|||
T Consensus         1 M~~~~~~~~k~~~~~~~~~a~~~rs~e~~p~~~~~~~s~~~~-s~s~~~~~~p~LvF~~QLAHGSptg~Ie~fsnv~ELY   79 (334)
T KOG3938|consen    1 MPLQGRPSPKSRPRSEGRGAFNARSGETSPLQPGVPISPNEG-SPSIPPAVRPRLVFHCQLAHGSPTGRIEGFSNVRELY   79 (334)
T ss_pred             CCCCCCCCCCCCCccccccccccCCCCCCCCCCCCCCCccCC-CCCCCccCCCceeEeeeeccCCccceecccccHHHHH
Confidence            89998888776665433222111111          112233 2355688999999999999999999999999999999


Q ss_pred             HHhhhhhcCChhhHh
Q psy16018         71 QKIAECYEFPAEEVS   85 (89)
Q Consensus        71 ~kIae~f~i~~~eIl   85 (89)
                      ++||+||+|+++|||
T Consensus        80 ~kIAe~F~Is~~dIl   94 (334)
T KOG3938|consen   80 QKIAEAFDISPDDIL   94 (334)
T ss_pred             HHHHHHhcCCccceE
Confidence            999999999999997


No 2  
>PF03925 SeqA:  SeqA protein;  InterPro: IPR005621 The binding of SeqA protein to hemimethylated GATC sequences is important in the negative modulation of chromosomal initiation at oriC, and in the formation of SeqA foci necessary for Escherichia coli chromosome segregation []. SeqA tetramers are able to aggregate or multimerize in a reversible, concentration-dependent manner []. Apart from its function in the control of DNA replication, SeqA may also be a specific transcription factor []. The C-terminal domain binds DNA, binding to fully methylated and hemimethylated GATC sequences at oriC. The structure of the C-terminal domain consists of seven alpha-helices and three-stranded beta-sheet.; GO: 0003677 DNA binding, 0032297 negative regulation of DNA-dependent DNA replication initiation; PDB: 3FMT_A 1J3E_A 1XRX_D 1IU3_C 1LRR_D.
Probab=83.37  E-value=0.68  Score=35.52  Aligned_cols=23  Identities=26%  Similarity=0.327  Sum_probs=17.4

Q ss_pred             hHHHHHHhh---hhhcCChhhHhhhc
Q psy16018         66 VRELYQKIA---ECYEFPAEEVSEDF   88 (89)
Q Consensus        66 vkELY~kIa---e~f~i~~~eIl~~~   88 (89)
                      ..|||+-||   +.+|=+++||||.+
T Consensus         7 DeELYryIAs~Tq~IGESASdILRRL   32 (190)
T PF03925_consen    7 DEELYRYIASQTQHIGESASDILRRL   32 (190)
T ss_dssp             -HHHHHHHHTT-SSTT--HHHHHHHH
T ss_pred             cHHHHHHHHHhccccCCCHHHHHHHh
Confidence            479999999   66777999999964


No 3  
>PRK11187 replication initiation regulator SeqA; Provisional
Probab=81.47  E-value=0.99  Score=34.56  Aligned_cols=23  Identities=26%  Similarity=0.327  Sum_probs=19.8

Q ss_pred             hHHHHHHhh---hhhcCChhhHhhhc
Q psy16018         66 VRELYQKIA---ECYEFPAEEVSEDF   88 (89)
Q Consensus        66 vkELY~kIa---e~f~i~~~eIl~~~   88 (89)
                      ..|||+-||   +..|=+++||||.+
T Consensus         7 DeELYryIAS~Tq~IGESASDILRRL   32 (182)
T PRK11187          7 DEELYRYIASHTQHIGESASDILRRL   32 (182)
T ss_pred             cHHHHHHHHHccCccCCCHHHHHHHH
Confidence            479999999   67777999999974


No 4  
>PF13443 HTH_26:  Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A.
Probab=75.80  E-value=1.8  Score=25.21  Aligned_cols=20  Identities=30%  Similarity=0.371  Sum_probs=14.8

Q ss_pred             HHHHHhhhhhcCChhhHhhh
Q psy16018         68 ELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl~~   87 (89)
                      +.-.+||++|++++.||++.
T Consensus        41 ~~l~~ia~~l~~~~~el~~~   60 (63)
T PF13443_consen   41 DTLEKIAKALNCSPEELFEY   60 (63)
T ss_dssp             HHHHHHHHHHT--HHHCTEC
T ss_pred             HHHHHHHHHcCCCHHHHhhc
Confidence            34578999999999999863


No 5  
>PF02773 S-AdoMet_synt_C:  S-adenosylmethionine synthetase, C-terminal domain;  InterPro: IPR022630  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the C-terminal domain of S=adenosylmethionine synthetase and is found in association with PF00438 from PFAM and PF02772 from PFAM. S-adenosylmethionine synthetase (MAT, 2.5.1.6 from EC) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP []. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis. In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family. The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex, and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance []; GO: 0004478 methionine adenosyltransferase activity; PDB: 3IML_B 1QM4_B 1O9T_B 1O93_A 1O92_B 1O90_A 1FUG_A 1RG9_D 1XRA_A 1P7L_C ....
Probab=75.66  E-value=2.6  Score=31.14  Aligned_cols=26  Identities=12%  Similarity=0.300  Sum_probs=20.4

Q ss_pred             cchHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         64 SNVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      -+.+||.+-|.++|++.|..|+++|.
T Consensus        89 ~~d~~i~~~I~~~Fdl~P~~II~~L~  114 (138)
T PF02773_consen   89 ISDEEILEIIKENFDLRPAGIIKELD  114 (138)
T ss_dssp             S-HHHHHHHHHHHS--SHHHHHHHCT
T ss_pred             chHHHHHHHHHHHhCCcHHHHHHHhC
Confidence            35689999999999999999999763


No 6  
>cd01807 GDX_N ubiquitin-like domain of GDX. GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain.  The function of GDX is unknown.
Probab=75.37  E-value=3.6  Score=25.12  Aligned_cols=25  Identities=24%  Similarity=0.341  Sum_probs=22.7

Q ss_pred             eccCccchHHHHHHhhhhhcCChhh
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      .|+...+|.+|-+.|++.+++++++
T Consensus        16 ~v~~~~tV~~lK~~i~~~~gi~~~~   40 (74)
T cd01807          16 QVSEKESVSTLKKLVSEHLNVPEEQ   40 (74)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHH
Confidence            4678899999999999999999987


No 7  
>PF14552 Tautomerase_2:  Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C.
Probab=73.51  E-value=2  Score=28.14  Aligned_cols=20  Identities=30%  Similarity=0.464  Sum_probs=13.3

Q ss_pred             hHHHHHHhh----hhhcCChhhHh
Q psy16018         66 VRELYQKIA----ECYEFPAEEVS   85 (89)
Q Consensus        66 vkELY~kIa----e~f~i~~~eIl   85 (89)
                      -++||+.|+    +..+|+|+|||
T Consensus        45 K~~ly~~l~~~L~~~~gi~p~Dv~   68 (82)
T PF14552_consen   45 KKALYRALAERLAEKLGIRPEDVM   68 (82)
T ss_dssp             HHHHHHHHHHHHHHHH---GGGEE
T ss_pred             HHHHHHHHHHHHHHHcCCCHHHEE
Confidence            467888887    56789999986


No 8  
>smart00760 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain. Could be involved in DNA-binding.
Probab=73.09  E-value=4.2  Score=24.38  Aligned_cols=22  Identities=18%  Similarity=0.487  Sum_probs=19.1

Q ss_pred             chHHHHHHhhhhhcCChhhHhh
Q psy16018         65 NVRELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~   86 (89)
                      ++.++-+.+|+.|+|+++||+.
T Consensus         1 ~~~~I~~~Va~~~~i~~~~i~s   22 (60)
T smart00760        1 TIEEIIEAVAEYFGVKPEDLKS   22 (60)
T ss_pred             CHHHHHHHHHHHhCCCHHHHhc
Confidence            4678889999999999999975


No 9  
>PF11543 UN_NPL4:  Nuclear pore localisation protein NPL4;  InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway.  Npl4 has a N-terminal ubiquitin-like domain which has within its structure a beta-grasp fold with a helical insert []. This entry represents the ubiquitin-like domain.; PDB: 2PJH_A 1WF9_A.
Probab=72.74  E-value=2.5  Score=27.47  Aligned_cols=24  Identities=29%  Similarity=0.416  Sum_probs=16.8

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      |+.=+++.+||++|++.++++...
T Consensus        20 ~~~~~t~~~L~~kI~~~l~~~~~~   43 (80)
T PF11543_consen   20 VSPSSTLSDLKEKISEQLSIPDSS   43 (80)
T ss_dssp             E-TTSBHHHHHHHHHHHS---TTT
T ss_pred             cCCcccHHHHHHHHHHHcCCCCcc
Confidence            456678999999999999998654


No 10 
>PF00240 ubiquitin:  Ubiquitin family;  InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade. There are many different E3 ligases, which are responsible for the type of ubiquitin chain formed, the specificity of the target protein, and the regulation of the ubiquitinylation process []. Ubiquitinylation is an important regulatory tool that controls the concentration of key signalling proteins, such as those involved in cell cycle control, as well as removing misfolded, damaged or mutant proteins that could be harmful to the cell. Several ubiquitin-like molecules have been discovered, such as Ufm1 (IPR005375 from INTERPRO), SUMO1 (IPR003653 from INTERPRO), NEDD8, Rad23 (IPR004806 from INTERPRO), Elongin B and Parkin (IPR003977 from INTERPRO), the latter being involved in Parkinson's disease []. Ubiquitin is a protein of 76 amino acid residues, found in all eukaryotic cells and whose sequence is extremely well conserved from protozoan to vertebrates. Ubiquitin acts through its post-translational attachment (ubiquitinylation) to other proteins, where these modifications alter the function, location or trafficking of the protein, or targets it for destruction by the 26S proteasome []. The terminal glycine in the C-terminal 4-residue tail of ubiquitin can form an isopeptide bond with a lysine residue in the target protein, or with a lysine in another ubiquitin molecule to form a ubiquitin chain that attaches itself to a target protein. Ubiquitin has seven lysine residues, any one of which can be used to link ubiquitin molecules together, resulting in different structures that alter the target protein in different ways. It appears that Lys(11)-, Lys(29) and Lys(48)-linked poly-ubiquitin chains target the protein to the proteasome for degradation, while mono-ubiquitinylated and Lys(6)- or Lys(63)-linked poly-ubiquitin chains signal reversible modifications in protein activity, location or trafficking []. For example, Lys(63)-linked poly-ubiquitinylation is known to be involved in DNA damage tolerance, inflammatory response, protein trafficking and signal transduction through kinase activation []. In addition, the length of the ubiquitin chain alters the fate of the target protein. Regulatory proteins such as transcription factors and histones are frequent targets of ubquitinylation [].; GO: 0005515 protein binding; PDB: 2DZI_A 2XEW_E 3NOB_E 2KWU_B 2Y5B_F 3PHD_G 2KWV_B 2KOX_A 2XK5_B 3NHE_B ....
Probab=70.86  E-value=4.4  Score=23.82  Aligned_cols=26  Identities=35%  Similarity=0.335  Sum_probs=23.0

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+...+|.+|-+.|++..++|++++
T Consensus        11 ~v~~~~tV~~lK~~i~~~~~~~~~~~   36 (69)
T PF00240_consen   11 EVDPDDTVADLKQKIAEETGIPPEQQ   36 (69)
T ss_dssp             EEETTSBHHHHHHHHHHHHTSTGGGE
T ss_pred             EECCCCCHHHhhhhcccccccccccc
Confidence            46678899999999999999999875


No 11 
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=70.37  E-value=4.9  Score=23.84  Aligned_cols=26  Identities=12%  Similarity=0.210  Sum_probs=21.6

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .++.-.+|.+|.++|++.+++|++++
T Consensus        16 ~v~~~~tV~~lK~~i~~~~g~~~~~q   41 (76)
T cd01803          16 EVEPSDTIENVKAKIQDKEGIPPDQQ   41 (76)
T ss_pred             EECCcCcHHHHHHHHHHHhCCCHHHe
Confidence            35556789999999999999998764


No 12 
>PF05402 PqqD:  Coenzyme PQQ synthesis protein D (PqqD);  InterPro: IPR008792 This family contains several bacterial coenzyme PQQ synthesis protein D (PqqD) sequences. This protein is required for coenzyme pyrrolo-quinoline-quinone (PQQ) biosynthesis.; PDB: 3G2B_A.
Probab=68.92  E-value=5.9  Score=23.45  Aligned_cols=29  Identities=34%  Similarity=0.551  Sum_probs=20.7

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhHhhhc
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      ++|=.++.|+-+.+++.|+++++++-+|.
T Consensus        26 ~~g~~t~~ei~~~l~~~y~~~~~~~~~dv   54 (68)
T PF05402_consen   26 LDGPRTVEEIVDALAEEYDVDPEEAEEDV   54 (68)
T ss_dssp             --SSS-HHHHHHHHHHHTT--HHHHHHHH
T ss_pred             ccCCCCHHHHHHHHHHHcCCCHHHHHHHH
Confidence            45557899999999999999999887663


No 13 
>PF08299 Bac_DnaA_C:  Bacterial dnaA protein helix-turn-helix;  InterPro: IPR013159 This entry represents the C-terminal domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; GO: 0005524 ATP binding, 0043565 sequence-specific DNA binding, 0006270 DNA-dependent DNA replication initiation, 0006275 regulation of DNA replication; PDB: 2HCB_B 3R8F_C 1L8Q_A 3PVP_B 3PVV_A 1J1V_A.
Probab=66.86  E-value=5.4  Score=24.95  Aligned_cols=22  Identities=14%  Similarity=0.501  Sum_probs=17.0

Q ss_pred             chHHHHHHhhhhhcCChhhHhh
Q psy16018         65 NVRELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~   86 (89)
                      ++.++-+.+|+.|++++.||+.
T Consensus         1 t~~~Ii~~Va~~~~v~~~~i~s   22 (70)
T PF08299_consen    1 TIEDIIEAVAEYFGVSVEDIRS   22 (70)
T ss_dssp             -HHHHHHHHHHHTT--HHHHHS
T ss_pred             CHHHHHHHHHHHHCCCHHHHhC
Confidence            4678889999999999999984


No 14 
>cd01791 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also known as HUB1) is a ubiquitin-like modifier that is both widely expressed and highly phylogenetically conserved.  At the C-terminal end of the ubiquitin-like fold of UBL5 is a di-tyrosine motif followed by a single variable residue instead of the characteristic di-glycine found in all other ubiquitin-like modifiers.  ULB5 interacts with a cyclin-like kinase called CLK4 but not with other cyclin-like kinase family members.
Probab=66.73  E-value=4.8  Score=25.45  Aligned_cols=26  Identities=15%  Similarity=0.068  Sum_probs=21.5

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+.=.+|.+|.++|++.++++++.+
T Consensus        17 ~v~~~~TV~~LK~~I~~~~~~~~~~q   42 (73)
T cd01791          17 KCNPDDTIGDLKKLIAAQTGTRPEKI   42 (73)
T ss_pred             EeCCCCcHHHHHHHHHHHhCCChHHE
Confidence            44555789999999999999999864


No 15 
>PF12833 HTH_18:  Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B ....
Probab=66.48  E-value=7.5  Score=23.37  Aligned_cols=27  Identities=15%  Similarity=0.304  Sum_probs=22.4

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhHhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eIl~   86 (89)
                      .-||+|...++...-+.||++|.|+.+
T Consensus        54 ~~Gf~~~~~f~~~fk~~~g~tP~~~r~   80 (81)
T PF12833_consen   54 ECGFSSQSHFSRAFKRYFGMTPSEYRK   80 (81)
T ss_dssp             HTT-SSHHHHHHHHHHHHSS-HHHHHH
T ss_pred             HcCCCCHHHHHHHHHHHHCcCHHHHHc
Confidence            459999999999999999999999875


No 16 
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain. DDI1_N   DDI1 (DNA damage inducible protein 1) has an amino-terminal ubiquitin-like domain, an retroviral protease-like (RVP-like) domain, and a UBA (ubiquitin-associated) domain.  This CD represents the amino-terminal ubiquitin-like domain of DDI1.
Probab=66.32  E-value=6.3  Score=24.22  Aligned_cols=26  Identities=8%  Similarity=-0.028  Sum_probs=22.4

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+.-.+|.+|-++|++.+++|+++.
T Consensus        15 ~v~~~~TV~~lK~~I~~~~gip~~~q   40 (71)
T cd01796          15 DVDPDLELENFKALCEAESGIPASQQ   40 (71)
T ss_pred             EECCcCCHHHHHHHHHHHhCCCHHHe
Confidence            45667899999999999999999863


No 17 
>PF08769 Spo0A_C:  Sporulation initiation factor Spo0A C terminal;  InterPro: IPR014879 The response regulator Spo0A is comprised of a phophoacceptor domain and a transcription activation domain. This domain corresponds to the transcription activation domain and forms an alpha helical structure comprising of 6 alpha helices. The structure contains a helix-turn-helix and binds DNA [, ]. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0005509 calcium ion binding, 0006355 regulation of transcription, DNA-dependent, 0042173 regulation of sporulation resulting in formation of a cellular spore, 0005737 cytoplasm; PDB: 1FC3_C 1LQ1_D.
Probab=65.92  E-value=2.6  Score=28.85  Aligned_cols=24  Identities=33%  Similarity=0.534  Sum_probs=19.6

Q ss_pred             hHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         66 VRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        66 vkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      .|+||-.||+.|+.+++-|=|+.|
T Consensus        39 tK~LYp~IA~k~~TT~s~VERaIR   62 (106)
T PF08769_consen   39 TKELYPDIAKKYGTTPSRVERAIR   62 (106)
T ss_dssp             TTTHHHHHHHHTTS-HHHHHHHHH
T ss_pred             hhhHHHHHHHHHCCCHHHHHHHHH
Confidence            367999999999999998877654


No 18 
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein. DC_UbP (dendritic cell derived ubiquitin-like protein) is a ubiquitin-like protein from human dendritic cells that is expressed in the mitochondrion. The ubiquitin-like domain of this protein is found at the C-terminus and lacks the canonical gly-gly motif of ubiquitin required for ubiquitinization.  DC_UbP is expressed in tumor cells but not in normal human adult tissue suggesting a role for DC_UbP in tumorogenesis.
Probab=65.74  E-value=6.9  Score=24.31  Aligned_cols=26  Identities=12%  Similarity=0.029  Sum_probs=22.9

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+...+|.+|-++|++.+++|+++.
T Consensus        14 ~v~~~~TV~~lK~~I~~~~gi~~~~q   39 (70)
T cd01794          14 SVSSKDTVGQLKKQLQAAEGVDPCCQ   39 (70)
T ss_pred             EECCcChHHHHHHHHHHHhCCCHHHe
Confidence            56778899999999999999998863


No 19 
>cd01793 Fubi Fubi ubiquitin-like protein. Fubi is a ubiquitin-like protein encoded by the fau gene which has an  N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30.  Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.
Probab=65.72  E-value=5.8  Score=24.25  Aligned_cols=26  Identities=15%  Similarity=0.238  Sum_probs=22.7

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+.-.+|.++-++|++.+++|+++.
T Consensus        14 ~v~~~~tV~~lK~~i~~~~gip~~~q   39 (74)
T cd01793          14 EVTGQETVSDIKAHVAGLEGIDVEDQ   39 (74)
T ss_pred             EECCcCcHHHHHHHHHhhhCCCHHHE
Confidence            45677899999999999999999874


No 20 
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2. hPLIC-1 and hPLIC-2 (human homologs of the yeast ubiquitin-like Dsk2 protein)  are type2 UBL's (ubiquitin-like) proteins that are thought to serve as adaptors that link the ubiquitination machinery to the proteasome.  The hPLIC's have an N-terminal UBL domain that binds the S5a subunit of the proteasome and a C-terminal UBA (ubiquitin-associated) domain that binds a ubiquitylated protein.
Probab=65.21  E-value=6.9  Score=23.67  Aligned_cols=25  Identities=12%  Similarity=0.327  Sum_probs=20.5

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhH
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      |+.=.+|.+|.++|++.++++++++
T Consensus        16 v~~~~TV~~lK~~I~~~~~i~~~~~   40 (71)
T cd01808          16 IAEDASVKDFKEAVSKKFKANQEQL   40 (71)
T ss_pred             ECCCChHHHHHHHHHHHhCCCHHHE
Confidence            4455689999999999999988753


No 21 
>PF12844 HTH_19:  Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B.
Probab=63.56  E-value=5.9  Score=23.03  Aligned_cols=20  Identities=25%  Similarity=0.346  Sum_probs=15.8

Q ss_pred             HHHHHhhhhhcCChhhHhhh
Q psy16018         68 ELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl~~   87 (89)
                      +.-.+||++|++++++++..
T Consensus        42 ~~l~~i~~~~~v~~~~l~~~   61 (64)
T PF12844_consen   42 STLKKIAEALGVSLDELFDG   61 (64)
T ss_dssp             HHHHHHHHHHTS-HHHHCCC
T ss_pred             HHHHHHHHHhCCCHHHHhcc
Confidence            45589999999999998754


No 22 
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains and becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=63.41  E-value=8.7  Score=23.46  Aligned_cols=26  Identities=15%  Similarity=0.151  Sum_probs=22.1

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+.-.+|++|-++|++..+||+++.
T Consensus        14 ~v~~~~tV~~lK~~I~~~~gi~~~~q   39 (74)
T cd01810          14 EVQLTQTVATLKQQVSQRERVQADQF   39 (74)
T ss_pred             EECCcChHHHHHHHHHHHhCCCHHHe
Confidence            45667899999999999999998763


No 23 
>cd00196 UBQ Ubiquitin-like proteins. Ubiquitin homologs; Includes ubiquitin and ubiquitin-like proteins. Ubiquitin-mediated proteolysis is part of the regulated turnover of proteins required for controlling cell cycle progression. Other family members are protein modifiers that perform a wide range of functions. Ubiquitination usually results in a covalent bond between the C-terminus of ubiquitin and the epsilon-amino group of a substrate lysine. The three-step mechanism requires an activating enzyme (E1) that forms a thiol ester with the C-terminal carboxy group, a conjugating enzyme (E2) that transiently carries the activated ubiquitin molecule as a thiol ester, and a ligase (E3) that transfers the activated ubiquitin from the E2 to the substrate lysine residue. In poly-ubiquitination, ubiquitin itself is the substrate.
Probab=63.36  E-value=10  Score=19.02  Aligned_cols=25  Identities=24%  Similarity=0.395  Sum_probs=19.8

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhH
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      +..-.+++++.++|++.+++++.+.
T Consensus        14 ~~~~~tv~~l~~~i~~~~~~~~~~~   38 (69)
T cd00196          14 VPSGTTVADLKEKLAKKLGLPPEQQ   38 (69)
T ss_pred             cCCCCcHHHHHHHHHHHHCcChHHe
Confidence            3346889999999999998777653


No 24 
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2. ISG15 is a ubiquitin-like protein containing two ubiquitin homology domains that becomes conjugated to a variety of proteins when cells are treated with type I interferon or lipopolysaccharide. Although ISG15 has properties similar to those of other ubiquitin-like molecules, it is a unique member of the ubiquitin-like superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system.
Probab=62.89  E-value=8.6  Score=23.98  Aligned_cols=24  Identities=33%  Similarity=0.329  Sum_probs=20.3

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      |+.=.+|.||.++|++.+++++++
T Consensus        19 v~~~~TV~~lK~~I~~~~~i~~~~   42 (80)
T cd01792          19 LRDSMTVSELKQQIAQKIGVPAFQ   42 (80)
T ss_pred             cCCCCcHHHHHHHHHHHhCCCHHH
Confidence            455678999999999999998865


No 25 
>cd01804 midnolin_N Ubiquitin-like domain of midnolin. midnolin_N   Midnolin (midbrain nucleolar protein) is expressed in the nucleolus and is thought to regulate genes involved in neurogenesis.  Midnolin contains an amino-terminal ubiquitin-like domain.
Probab=62.31  E-value=7.5  Score=24.35  Aligned_cols=25  Identities=20%  Similarity=0.349  Sum_probs=20.2

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhH
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      ++.=.+|.||.++|++.+++++++.
T Consensus        18 v~~~~TV~~LK~~I~~~~~~~~~~q   42 (78)
T cd01804          18 VPPDETVEGLKKRISQRLKVPKERL   42 (78)
T ss_pred             ECCcCHHHHHHHHHHHHhCCChHHE
Confidence            3444679999999999999988753


No 26 
>PF01476 LysM:  LysM domain;  InterPro: IPR018392 This domain is about 40 residues long and is found in a variety of enzymes involved in bacterial cell wall degradation []. This domain may have a general peptidoglycan binding function.; GO: 0016998 cell wall macromolecule catabolic process; PDB: 2DJP_A 3ZQD_A 1Y7M_B 4A52_A 2L9Y_A 1E0G_A.
Probab=61.22  E-value=7.4  Score=21.04  Aligned_cols=19  Identities=26%  Similarity=0.405  Sum_probs=14.4

Q ss_pred             HHHHHhhhhhcCChhhHhh
Q psy16018         68 ELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl~   86 (89)
                      |-...||..|+++.++|++
T Consensus         7 Dtl~~IA~~~~~~~~~l~~   25 (44)
T PF01476_consen    7 DTLWSIAKRYGISVDELME   25 (44)
T ss_dssp             --HHHHHHHTTS-HHHHHH
T ss_pred             CcHHHHHhhhhhhHhHHHH
Confidence            4467899999999999986


No 27 
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein. parkin_N  parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.  Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of  26S proteasomes through its Ubl domain.
Probab=60.51  E-value=8.9  Score=23.04  Aligned_cols=25  Identities=12%  Similarity=0.359  Sum_probs=21.8

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhH
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      |+.-.+|+++-+.|++..+++++++
T Consensus        15 v~~~~tV~~lK~~i~~~~gi~~~~q   39 (70)
T cd01798          15 VDPDTDIKQLKEVVAKRQGVPPDQL   39 (70)
T ss_pred             ECCCChHHHHHHHHHHHHCCCHHHe
Confidence            5577899999999999999998864


No 28 
>COG3057 SeqA Negative regulator of replication initiationR [DNA replication, recombination, and repair]
Probab=60.44  E-value=6.3  Score=30.32  Aligned_cols=23  Identities=26%  Similarity=0.296  Sum_probs=18.9

Q ss_pred             hHHHHHHhh---hhhcCChhhHhhhc
Q psy16018         66 VRELYQKIA---ECYEFPAEEVSEDF   88 (89)
Q Consensus        66 vkELY~kIa---e~f~i~~~eIl~~~   88 (89)
                      ..|||+-||   .-.|=+.+||||.+
T Consensus         7 DeeLY~YIAS~T~hIGESASDILRRl   32 (181)
T COG3057           7 DEELYSYIASHTKHIGESASDILRRM   32 (181)
T ss_pred             cHHHHHHHHHhhhhhcccHHHHHHHH
Confidence            579999999   45666999999964


No 29 
>cd01802 AN1_N ubiquitin-like domain of AN1. AN1 (also known as ANUBL1 and RSD-7) is ubiquitin-like protein with a testis-specific expression in rats that has an N-terminal ubiquitin-like domain and a C-terminal zinc-binding domain. Unlike ubiquitin polyproteins and most ubiquitin fusion proteins, the N-terminal ubiquitin-like domain of An1 does not undergo proteolytic processing.  The function of AN1 is unknown.
Probab=59.43  E-value=11  Score=25.38  Aligned_cols=38  Identities=21%  Similarity=0.232  Sum_probs=28.7

Q ss_pred             ceeeeeecccCCCc-eeccCccchHHHHHHhhhhhcCChhh
Q psy16018         44 KLIFHCQLAHGSPT-GLISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        44 ~LvFh~QLAHGSpt-g~I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      .+.+-+.  .|... =.|+...+|.+|-++|++.++||+++
T Consensus        29 ~I~Vk~l--~G~~~~leV~~~~TV~~lK~kI~~~~gip~~~   67 (103)
T cd01802          29 ELFIETL--TGTCFELRVSPFETVISVKAKIQRLEGIPVAQ   67 (103)
T ss_pred             EEEEEcC--CCCEEEEEeCCCCcHHHHHHHHHHHhCCChHH
Confidence            4444443  35433 35889999999999999999999885


No 30 
>PF07027 DUF1318:  Protein of unknown function (DUF1318);  InterPro: IPR008309 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=59.21  E-value=8.6  Score=26.19  Aligned_cols=20  Identities=40%  Similarity=0.567  Sum_probs=17.4

Q ss_pred             HHHHHHhhhhhcCChhhHhh
Q psy16018         67 RELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        67 kELY~kIae~f~i~~~eIl~   86 (89)
                      +.+|+.||+.-++++++|=.
T Consensus        50 ~~~Y~~iA~~ng~t~~~V~~   69 (95)
T PF07027_consen   50 RALYQEIAKKNGITVEQVAA   69 (95)
T ss_pred             HHHHHHHHHHcCCCHHHHHH
Confidence            57999999999999988744


No 31 
>PF02071 NSF:  Aromatic-di-Alanine (AdAR) repeat ;  InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers. SNARE proteins are thought to form a protein bridge, the SNARE complex, between an incoming vesicle and the acceptor compartment. SNARE proteins contribute to the specificity of membrane fusion, implying that the mechanisms by which SNAREs are targeted to subcellular compartments are important for specific docking and fusion of vesicles. This mechanism involves a family of conserved proteins, members of which appear to function at all sites of constitutive and regulated secretion in eukaryotes []. Among them are 2 types of cytosolic protein, NSF (N-ethyl-maleimide-sensitive protein) and the SNAPs (alpha-, beta- and gamma-soluble NSF attachment proteins). The yeast vesicular fusion protein, sec17, a cytoplasmic peripheral membrane protein involved in vesicular transport between the endoplasmic reticulum and the golgi apparatus, shows a high degree of sequence similarity to the alpha-SNAP family.  SNAP-25 and its non-neuronal homologue Syndet/SNAP-23 are synthesized as soluble proteins in the cytosol. Both SNAP-25 and Syndet/SNAP-23 are palmitoylated at cysteine residues clustered in a loop between two N- and C-terminal coils and palmitoylation is essential for membrane binding and plasma membrane targeting. The C-terminal and the N-terminal helices of SNAP-25, are each targeted to the plasma membrane by two distinct cysteine-rich domains and appear to regulate the availability of SNAP to form complexes with SNARE [].; GO: 0006886 intracellular protein transport
Probab=57.31  E-value=5.9  Score=18.36  Aligned_cols=10  Identities=60%  Similarity=1.228  Sum_probs=8.1

Q ss_pred             HHHHHhhhhh
Q psy16018         68 ELYQKIAECY   77 (89)
Q Consensus        68 ELY~kIae~f   77 (89)
                      +-|+++|+||
T Consensus         3 ~~y~~Aa~~y   12 (12)
T PF02071_consen    3 KCYEKAAECY   12 (12)
T ss_pred             HHHHHHHhhC
Confidence            3589999987


No 32 
>PF14338 Mrr_N:  Mrr N-terminal domain
Probab=57.19  E-value=10  Score=24.29  Aligned_cols=23  Identities=30%  Similarity=0.642  Sum_probs=19.7

Q ss_pred             cchHHHHHHhhhhhcCChhhHhh
Q psy16018         64 SNVRELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl~   86 (89)
                      .+.+|+|+.|++.|+++..|.-+
T Consensus        20 ~~~~ei~~~v~~~~~ls~e~~~~   42 (92)
T PF14338_consen   20 ASRKEIYERVAERFGLSDEERNE   42 (92)
T ss_pred             cCHHHHHHHHHHHhCCCHHHHHH
Confidence            57899999999999999887544


No 33 
>PF06971 Put_DNA-bind_N:  Putative DNA-binding protein N-terminus;  InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins. These are redox-sensing repressors that appear to be widespread among Gram-positive bacteria []. They modulate transcription in response to changes in cellular NADH/NAD(+) redox state. Rex is predicted to include a pyridine nucleotide-binding domain (Rossmann fold), and residues that might play key structural and nucleotide binding roles are highly conserved.; GO: 0045892 negative regulation of transcription, DNA-dependent, 0051775 response to redox state, 0005737 cytoplasm; PDB: 3IL2_B 3IKT_A 3IKV_B 1XCB_F 2DT5_A 2VT3_A 2VT2_A 3KEO_B 3KET_A 3KEQ_A ....
Probab=56.17  E-value=8.8  Score=23.44  Aligned_cols=20  Identities=25%  Similarity=0.378  Sum_probs=16.4

Q ss_pred             HHHHhhhhhcCChhhHhhhc
Q psy16018         69 LYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        69 LY~kIae~f~i~~~eIl~~~   88 (89)
                      ..+.||+..++++.+|=+||
T Consensus        30 SS~~La~~~gi~~~qVRKDl   49 (50)
T PF06971_consen   30 SSQELAEALGITPAQVRKDL   49 (50)
T ss_dssp             -HHHHHHHHTS-HHHHHHHH
T ss_pred             CHHHHHHHHCCCHHHhcccC
Confidence            35789999999999999997


No 34 
>PF14645 Chibby:  Chibby family
Probab=55.86  E-value=29  Score=24.25  Aligned_cols=34  Identities=26%  Similarity=0.221  Sum_probs=22.6

Q ss_pred             Cceeee-ee--cccCCCceeccCccchHHHHHHhhhh
Q psy16018         43 PKLIFH-CQ--LAHGSPTGLISGFSNVRELYQKIAEC   76 (89)
Q Consensus        43 p~LvFh-~Q--LAHGSptg~I~gF~nvkELY~kIae~   76 (89)
                      -.|||. -|  -.+|+.++...+..+.++-.+.+-|-
T Consensus        50 ~~l~F~dG~W~~e~~~~~~~~~~~~~l~~~n~~L~EE   86 (116)
T PF14645_consen   50 QTLVFEDGQWTSESGSGTADGEENQRLRKENQQLEEE   86 (116)
T ss_pred             eEEEEECCEEeccCCCcccchhHHHHHHHHHHHHHHH
Confidence            367882 01  34677788888888888777776643


No 35 
>smart00213 UBQ Ubiquitin homologues. Ubiquitin-mediated proteolysis is involved in the regulated turnover of  proteins required for controlling cell cycle progression
Probab=55.10  E-value=15  Score=20.60  Aligned_cols=26  Identities=35%  Similarity=0.372  Sum_probs=21.4

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhH
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+.=.+|.+|-++|++.+++++.++
T Consensus        15 ~v~~~~tv~~lk~~i~~~~~~~~~~~   40 (64)
T smart00213       15 EVKPSDTVSELKEKIAELTGIPVEQQ   40 (64)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHHE
Confidence            45555789999999999999998753


No 36 
>PHA01976 helix-turn-helix protein
Probab=54.21  E-value=12  Score=21.83  Aligned_cols=19  Identities=5%  Similarity=0.127  Sum_probs=15.7

Q ss_pred             HHHHHhhhhhcCChhhHhh
Q psy16018         68 ELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl~   86 (89)
                      +...+||++|++++++++.
T Consensus        45 ~~l~~ia~~l~v~~~~l~~   63 (67)
T PHA01976         45 KTLLRLADALGVTLDWLCG   63 (67)
T ss_pred             HHHHHHHHHHCcCHHHHhc
Confidence            3457999999999998864


No 37 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=54.12  E-value=10  Score=22.06  Aligned_cols=18  Identities=17%  Similarity=0.326  Sum_probs=12.7

Q ss_pred             HHHHHhhhhhcCChhhHh
Q psy16018         68 ELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl   85 (89)
                      ++++.+++++++|+++|.
T Consensus        23 ~it~~l~~~~~~p~~~v~   40 (61)
T PRK02220         23 DVTAAVSKNTGAPAEHIH   40 (61)
T ss_pred             HHHHHHHHHhCcChhhEE
Confidence            344455588999998875


No 38 
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=54.11  E-value=16  Score=21.58  Aligned_cols=24  Identities=17%  Similarity=0.331  Sum_probs=21.1

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      |+.-.+|.+|-++|++.+++|+++
T Consensus        17 v~~~~tv~~lK~~i~~~~g~~~~~   40 (76)
T cd01806          17 IEPTDKVERIKERVEEKEGIPPQQ   40 (76)
T ss_pred             ECCCCCHHHHHHHHhHhhCCChhh
Confidence            566678999999999999999985


No 39 
>cd01805 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belongs to a family of adaptor molecules having affinity for both the proteasome and ubiquitinylated proteins and thought to shuttle these ubiquitinylated proteins to the proteasome for destruction. RAD23 interacts with ubiquitin through its C-terminal ubiquitin-associated domains (UBA) and with the proteasome through its N-terminal ubiquitin-like domain (UBL).
Probab=53.69  E-value=13  Score=22.28  Aligned_cols=25  Identities=32%  Similarity=0.325  Sum_probs=20.6

Q ss_pred             ccCccchHHHHHHhhhhhcC--ChhhH
Q psy16018         60 ISGFSNVRELYQKIAECYEF--PAEEV   84 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i--~~~eI   84 (89)
                      ++.-.+|.+|-+.|++.+++  +++++
T Consensus        17 v~~~~TV~~lK~~i~~~~~i~~~~~~q   43 (77)
T cd01805          17 VDPDDTVAELKEKIEEEKGCDYPPEQQ   43 (77)
T ss_pred             ECCCCcHHHHHHHHHHhhCCCCChhHe
Confidence            45567899999999999998  87754


No 40 
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=53.07  E-value=11  Score=22.47  Aligned_cols=19  Identities=32%  Similarity=0.550  Sum_probs=13.3

Q ss_pred             HHHHHHhhhhhcCChhhHh
Q psy16018         67 RELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        67 kELY~kIae~f~i~~~eIl   85 (89)
                      +++++.+++++++|+++|.
T Consensus        22 ~~it~~l~~~lg~p~~~v~   40 (64)
T PRK01964         22 REVTEAISATLDVPKERVR   40 (64)
T ss_pred             HHHHHHHHHHhCcChhhEE
Confidence            3444455588999999874


No 41 
>PF08281 Sigma70_r4_2:  Sigma-70, region 4;  InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2LFW_A 1OR7_B 2H27_D 2O8X_B.
Probab=51.87  E-value=12  Score=21.18  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=13.6

Q ss_pred             HHHHhhhhhcCChhhHhh
Q psy16018         69 LYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        69 LY~kIae~f~i~~~eIl~   86 (89)
                      -|+.||+.++++++-|-.
T Consensus        28 s~~eIa~~l~~s~~~v~~   45 (54)
T PF08281_consen   28 SYAEIAEILGISESTVKR   45 (54)
T ss_dssp             -HHHHHHHCTS-HHHHHH
T ss_pred             CHHHHHHHHCcCHHHHHH
Confidence            689999999999987743


No 42 
>PF12085 DUF3562:  Protein of unknown function (DUF3562);  InterPro: IPR021945  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 62 to 84 amino acids in length. This protein has two completely conserved residues (A and Y) that may be functionally important. 
Probab=51.53  E-value=16  Score=24.02  Aligned_cols=25  Identities=40%  Similarity=0.468  Sum_probs=21.7

Q ss_pred             cchHHHHHHhhhhhcCChhhHhhhc
Q psy16018         64 SNVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      .|+.|+-++||+.-++|.+++.+-|
T Consensus         4 ~~~~e~i~~iA~~t~~P~e~V~~my   28 (66)
T PF12085_consen    4 DNVDEVIRSIAEETGTPAETVRRMY   28 (66)
T ss_pred             ccHHHHHHHHHHHHCCCHHHHHHHH
Confidence            5899999999999999999887543


No 43 
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=51.22  E-value=20  Score=21.05  Aligned_cols=24  Identities=17%  Similarity=0.202  Sum_probs=20.4

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      ++.=.+|.+|-++|++.+++|+++
T Consensus        16 v~~~~tv~~lK~~i~~~~gi~~~~   39 (71)
T cd01812          16 ISSQATFGDLKKMLAPVTGVEPRD   39 (71)
T ss_pred             ECCCCcHHHHHHHHHHhhCCChHH
Confidence            455578999999999999999875


No 44 
>KOG3889|consensus
Probab=51.11  E-value=10  Score=31.86  Aligned_cols=37  Identities=35%  Similarity=0.628  Sum_probs=29.4

Q ss_pred             CCceeeeeeccc---CCCceeccCccchHHHHHHhhhhhcC
Q psy16018         42 KPKLIFHCQLAH---GSPTGLISGFSNVRELYQKIAECYEF   79 (89)
Q Consensus        42 ~p~LvFh~QLAH---GSptg~I~gF~nvkELY~kIae~f~i   79 (89)
                      ..--|||| |.|   |+-|=.|+||.-+.+|-++--|.|+|
T Consensus       202 ~GiQvfHC-l~h~gtGG~t~lVDgfy~ae~l~~~~Pe~fei  241 (371)
T KOG3889|consen  202 PGIQVFHC-LTHAGTGGDTVLVDGFYCAEKLRNESPEDFEI  241 (371)
T ss_pred             CCceEEEe-ecccCCCCceEEEehHHHHHHHHhhChHhhhH
Confidence            34569999 456   44555799999999999999999885


No 45 
>PF13404 HTH_AsnC-type:  AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B ....
Probab=50.52  E-value=5.9  Score=22.91  Aligned_cols=24  Identities=21%  Similarity=0.314  Sum_probs=17.8

Q ss_pred             chHHHHHHhhhhhcCChhhHhhhc
Q psy16018         65 NVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      |.+..|..||+..++++..|.+.+
T Consensus        15 d~r~s~~~la~~lglS~~~v~~Ri   38 (42)
T PF13404_consen   15 DGRRSYAELAEELGLSESTVRRRI   38 (42)
T ss_dssp             -TTS-HHHHHHHHTS-HHHHHHHH
T ss_pred             cCCccHHHHHHHHCcCHHHHHHHH
Confidence            345679999999999999998754


No 46 
>PF01337 Barstar:  Barstar (barnase inhibitor);  InterPro: IPR000468 Barstar is a small single chain protein. Barnase is the extracellular ribonuclease IPR001887 from INTERPRO of Bacillus amyloliquefaciens, and barstar its specific intracellular inhibitor [, ]. Expression of barstar is necessary to counter the lethal effect of expressed active barnase. The structure of the barnase-barstar complex is known [].; PDB: 2CX6_A 1B2U_F 1A19_A 1X1U_F 1B27_E 1X1W_F 1BGS_E 1X1Y_D 1B3S_D 1B2S_D ....
Probab=50.50  E-value=14  Score=23.26  Aligned_cols=22  Identities=23%  Similarity=0.534  Sum_probs=16.5

Q ss_pred             ccCccchHHHHHHhhhhhcCCh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPA   81 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~   81 (89)
                      ..+.++..++|+.+++++++|.
T Consensus         5 g~~i~~~~~~~~~l~~~l~fP~   26 (90)
T PF01337_consen    5 GRKIRDKEDFYDALAEALDFPD   26 (90)
T ss_dssp             CCC-SSHHHHHHHHHHHTT--T
T ss_pred             CCCCCCHHHHHHHHHHHcCCCc
Confidence            3578899999999999999874


No 47 
>PF13647 Glyco_hydro_80:  Glycosyl hydrolase family 80 of chitosanase A
Probab=50.49  E-value=8.4  Score=31.24  Aligned_cols=24  Identities=46%  Similarity=0.695  Sum_probs=20.9

Q ss_pred             ceeeeeecccCCCceeccCccchHH
Q psy16018         44 KLIFHCQLAHGSPTGLISGFSNVRE   68 (89)
Q Consensus        44 ~LvFh~QLAHGSptg~I~gF~nvkE   68 (89)
                      -|-|+.|..-|| .|.|+.|++||.
T Consensus       201 glafqvqvntgs-igsisafssvks  224 (308)
T PF13647_consen  201 GLAFQVQVNTGS-IGSISAFSSVKS  224 (308)
T ss_pred             eEEEEEEecccc-ccceehhhhccc
Confidence            478999999887 699999999974


No 48 
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of  Np95 and NIRF. NIRF_N    This CD represents the amino-terminal ubiquitin-like domain of a family of nuclear proteins that includes Np95 and NIRF (Np95/ICBP90-like RING finger) protein.  Both Np95 and NIRF have a domain architecture consisting of a ubiquitin-like domain, a PHD finger, a YDG/SRA domain, Rb-binding motifs and a RING finger domain. Both Np95 and NIRF are ubiquitin ligases that ubiquitinate PCNP (PEST-containing nuclear proteins). While Np95 is capable of binding histones, NIRF is involved in cell cycle regulation.
Probab=49.52  E-value=19  Score=22.74  Aligned_cols=24  Identities=33%  Similarity=0.490  Sum_probs=20.5

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      ++.-.+|.++-++|++.+++|+++
T Consensus        19 v~~~~TV~~lK~~i~~~~gi~~~~   42 (78)
T cd01797          19 LSRLTKVEELREKIQELFNVEPEC   42 (78)
T ss_pred             cCCcCcHHHHHHHHHHHhCCCHHH
Confidence            345578999999999999999875


No 49 
>TIGR02899 spore_safA spore coat assembly protein SafA. in which one of which is found in most examples of endospore-forming bacteria. Lysin motifs are repeated in many proteins.
Probab=48.19  E-value=17  Score=18.91  Aligned_cols=17  Identities=29%  Similarity=0.343  Sum_probs=13.6

Q ss_pred             HHHhhhhhcCChhhHhh
Q psy16018         70 YQKIAECYEFPAEEVSE   86 (89)
Q Consensus        70 Y~kIae~f~i~~~eIl~   86 (89)
                      ...||+.|+++..+|++
T Consensus         7 l~~IA~~~~~~~~~l~~   23 (44)
T TIGR02899         7 LWKIAKKYGVDFDELIQ   23 (44)
T ss_pred             HHHHHHHHCcCHHHHHH
Confidence            45699999999888865


No 50 
>COG4229 Predicted enolase-phosphatase [Energy production and conversion]
Probab=47.20  E-value=9.5  Score=30.34  Aligned_cols=44  Identities=32%  Similarity=0.457  Sum_probs=32.1

Q ss_pred             CCCceeeeeecccCCCceeccCccch-------HHHHHHhhhhhcCChhhHh
Q psy16018         41 SKPKLIFHCQLAHGSPTGLISGFSNV-------RELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        41 ~~p~LvFh~QLAHGSptg~I~gF~nv-------kELY~kIae~f~i~~~eIl   85 (89)
                      +..+|.|-|--| |-=.+.++||-+.       ...|++||+..+++|.|||
T Consensus       131 ~AQkL~Fghs~a-gdL~~lfsGyfDttiG~KrE~~SY~kIa~~iGl~p~eil  181 (229)
T COG4229         131 KAQKLFFGHSDA-GDLNSLFSGYFDTTIGKKRESQSYAKIAGDIGLPPAEIL  181 (229)
T ss_pred             hhHHHhhccccc-ccHHhhhcceeeccccccccchhHHHHHHhcCCCchheE
Confidence            356788877522 4445566776543       5689999999999999996


No 51 
>PF13560 HTH_31:  Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A.
Probab=46.68  E-value=19  Score=21.22  Aligned_cols=19  Identities=21%  Similarity=0.433  Sum_probs=14.1

Q ss_pred             HHHHHHhhhhhcCChhhHh
Q psy16018         67 RELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        67 kELY~kIae~f~i~~~eIl   85 (89)
                      .+.+.+|+++|+++++++-
T Consensus        44 ~~~l~~l~~~l~~~~~~~~   62 (64)
T PF13560_consen   44 PDTLQRLARALGVPPDERA   62 (64)
T ss_dssp             HHHHHHHHHHTT--HHHHH
T ss_pred             HHHHHHHHHHHCcCHHHHc
Confidence            4588999999999998863


No 52 
>PF01402 RHH_1:  Ribbon-helix-helix protein, copG family;  InterPro: IPR002145 CopG, also known as RepA, is responsible for the regulation of plasmid copy number. It binds to the repAB promoter and controls synthesis of the plasmid replication initiator protein RepB. Many bacterial transcription regulation proteins bind DNA through a 'helix-turn-helix' motif, nevertheless CopG displays a fully defined HTH-motif structure that is involved not in DNA-binding, but in the maintenance of the intrinsic dimeric functional structure and cooperativity [, ].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2BJ3_B 2BJ8_A 2BJ1_A 2BJ9_A 2BJ7_B 1EA4_L 2CPG_C 1B01_B 2BA3_A 2K9I_B ....
Probab=45.62  E-value=25  Score=18.89  Aligned_cols=22  Identities=14%  Similarity=0.147  Sum_probs=18.3

Q ss_pred             hHHHHHHhhhhhcCChhhHhhh
Q psy16018         66 VRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        66 vkELY~kIae~f~i~~~eIl~~   87 (89)
                      ..+..+++|+..+++.+++++.
T Consensus        10 ~~~~l~~~a~~~g~s~s~~ir~   31 (39)
T PF01402_consen   10 LYERLDELAKELGRSRSELIRE   31 (39)
T ss_dssp             HHHHHHHHHHHHTSSHHHHHHH
T ss_pred             HHHHHHHHHHHHCcCHHHHHHH
Confidence            4566778889999999999875


No 53 
>cd00118 LysM Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function.
Probab=45.61  E-value=21  Score=17.48  Aligned_cols=17  Identities=29%  Similarity=0.448  Sum_probs=13.6

Q ss_pred             HHHhhhhhcCChhhHhh
Q psy16018         70 YQKIAECYEFPAEEVSE   86 (89)
Q Consensus        70 Y~kIae~f~i~~~eIl~   86 (89)
                      ...||+.|+++..+|.+
T Consensus        11 ~~~ia~~~~~~~~~~~~   27 (46)
T cd00118          11 LSSIAQRYGISVEELLK   27 (46)
T ss_pred             HHHHHHHHCcCHHHHHH
Confidence            45688889999888865


No 54 
>PF14566 PTPlike_phytase:  Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B ....
Probab=45.43  E-value=8.8  Score=26.79  Aligned_cols=10  Identities=50%  Similarity=0.830  Sum_probs=7.1

Q ss_pred             CCceeeeeec
Q psy16018         42 KPKLIFHCQL   51 (89)
Q Consensus        42 ~p~LvFh~QL   51 (89)
                      ..-|+||||.
T Consensus       124 ~~~l~fhC~~  133 (149)
T PF14566_consen  124 DTWLHFHCQA  133 (149)
T ss_dssp             T-EEEEE-SS
T ss_pred             CCeEEEECCC
Confidence            5689999997


No 55 
>COG2411 Uncharacterized conserved protein [Function unknown]
Probab=45.40  E-value=11  Score=29.22  Aligned_cols=27  Identities=22%  Similarity=0.532  Sum_probs=21.5

Q ss_pred             eeccCccchHHHHHHhhhhhc-CChhhH
Q psy16018         58 GLISGFSNVRELYQKIAECYE-FPAEEV   84 (89)
Q Consensus        58 g~I~gF~nvkELY~kIae~f~-i~~~eI   84 (89)
                      .+.+||.|++||-..+.+.|+ +-++|+
T Consensus        71 Ar~DGF~sreELi~~LkriYg~lr~ed~   98 (188)
T COG2411          71 ARLDGFRSREELIEELKRIYGELRDEDI   98 (188)
T ss_pred             HHhcccccHHHHHHHHHHHcCcCCCCce
Confidence            467899999999999999987 454443


No 56 
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=44.88  E-value=14  Score=21.47  Aligned_cols=20  Identities=15%  Similarity=0.212  Sum_probs=15.8

Q ss_pred             hHHHHHHhhhhhcCChhhHh
Q psy16018         66 VRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        66 vkELY~kIae~f~i~~~eIl   85 (89)
                      ++++++.+++++++++++|.
T Consensus        21 ~~~it~~l~~~lg~~~~~v~   40 (63)
T TIGR00013        21 IEGVTEAMAETLGANLESIV   40 (63)
T ss_pred             HHHHHHHHHHHhCCCcccEE
Confidence            46677778899999988764


No 57 
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein. Scythe protein (also known as Bat3) is an apoptotic regulator that is highly conserved in eukaryotes and contains a ubiquitin-like domain near its N-terminus.  Scythe binds reaper, a potent apoptotic inducer, and Scythe/Reaper are thought to signal apoptosis, in part through regulating the folding and activity of apoptotic signaling molecules.
Probab=44.03  E-value=31  Score=20.10  Aligned_cols=24  Identities=33%  Similarity=0.378  Sum_probs=19.9

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      ++.-.+|.+|-++|++..++++++
T Consensus        17 v~~~~tv~~lK~~i~~~~gi~~~~   40 (72)
T cd01809          17 VEEEITVLDLKEKIAEEVGIPVEQ   40 (72)
T ss_pred             ECCCCcHHHHHHHHHHHHCcCHHH
Confidence            334578999999999999998875


No 58 
>PF01381 HTH_3:  Helix-turn-helix;  InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould).; GO: 0043565 sequence-specific DNA binding; PDB: 2AXU_A 2AWI_D 2AXV_D 2AXZ_C 2AW6_A 3KXA_C 3BS3_A 2CRO_A 1ZUG_A 3CRO_R ....
Probab=43.24  E-value=14  Score=20.63  Aligned_cols=16  Identities=25%  Similarity=0.297  Sum_probs=12.4

Q ss_pred             HHHHhhhhhcCChhhH
Q psy16018         69 LYQKIAECYEFPAEEV   84 (89)
Q Consensus        69 LY~kIae~f~i~~~eI   84 (89)
                      .-.+||++|+++++++
T Consensus        40 ~~~~ia~~l~~~~~~l   55 (55)
T PF01381_consen   40 TLKKIAKALGVSPEYL   55 (55)
T ss_dssp             HHHHHHHHHTSEHHHH
T ss_pred             HHHHHHHHHCCCHHHC
Confidence            4467899999988764


No 59 
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=42.95  E-value=18  Score=24.22  Aligned_cols=17  Identities=24%  Similarity=0.483  Sum_probs=15.5

Q ss_pred             chHHHHHHhhhhhcCCh
Q psy16018         65 NVRELYQKIAECYEFPA   81 (89)
Q Consensus        65 nvkELY~kIae~f~i~~   81 (89)
                      +..+|++||+++|.|++
T Consensus        26 ~~~~L~~kI~~~f~l~~   42 (91)
T cd06398          26 NMDGLREKVEELFSLSP   42 (91)
T ss_pred             CHHHHHHHHHHHhCCCC
Confidence            67899999999999986


No 60 
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional
Probab=42.62  E-value=29  Score=25.41  Aligned_cols=29  Identities=21%  Similarity=0.379  Sum_probs=25.2

Q ss_pred             cCccchHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         61 SGFSNVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      -||+|..-.+...-+.||++|.|.-+.+|
T Consensus       274 ~GF~d~s~Fsr~Fkk~~G~sP~~yR~~~~  302 (302)
T PRK09685        274 WGFSDSSHFSTAFKQRFGVSPGEYRRKFR  302 (302)
T ss_pred             hCCCCHHHHHHHHHHHHCcCHHHHHhhcC
Confidence            68999999999899999999999877665


No 61 
>PTZ00044 ubiquitin; Provisional
Probab=42.49  E-value=32  Score=20.58  Aligned_cols=25  Identities=8%  Similarity=0.024  Sum_probs=21.5

Q ss_pred             eccCccchHHHHHHhhhhhcCChhh
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      .++.-.+|.+|=++|++..++|+++
T Consensus        16 ~v~~~~tv~~lK~~i~~~~gi~~~~   40 (76)
T PTZ00044         16 NFEPDNTVQQVKMALQEKEGIDVKQ   40 (76)
T ss_pred             EECCCCcHHHHHHHHHHHHCCCHHH
Confidence            4566778999999999999999875


No 62 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=41.75  E-value=16  Score=22.23  Aligned_cols=20  Identities=30%  Similarity=0.587  Sum_probs=13.6

Q ss_pred             eeeeeecccCCCceeccCccc
Q psy16018         45 LIFHCQLAHGSPTGLISGFSN   65 (89)
Q Consensus        45 LvFh~QLAHGSptg~I~gF~n   65 (89)
                      ++|+|+ |.|+|+-.|.=+.|
T Consensus         1 ~~l~C~-~~G~P~P~v~W~k~   20 (77)
T cd05875           1 IIIECE-AKGNPVPTFQWTRN   20 (77)
T ss_pred             CEEEEe-ccccCCCEEEEEEC
Confidence            468887 56888777765544


No 63 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=41.45  E-value=18  Score=24.32  Aligned_cols=22  Identities=36%  Similarity=0.510  Sum_probs=19.1

Q ss_pred             cchHHHHHHhhhhhcCChhhHh
Q psy16018         64 SNVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl   85 (89)
                      -+..+|+++|++-+.+++++|.
T Consensus        21 ~~y~~L~~ki~~kLkl~~e~i~   42 (80)
T cd06406          21 LSYATLLQKISSKLELPAEHIT   42 (80)
T ss_pred             CCHHHHHHHHHHHhCCCchhcE
Confidence            3678999999999999988875


No 64 
>cd05140 Barstar_AU1054-like Barstar_AU1054-like contains uncharacterized sequences similar to the uncharacterized, predicted RNAase inhibitor AU1054 found in Burkholderia cenocepacia. This is a subfamily of the Barstar family of RNAase inhibitors. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=40.68  E-value=25  Score=23.14  Aligned_cols=22  Identities=36%  Similarity=0.729  Sum_probs=18.7

Q ss_pred             ccCccchHHHHHHhhhhhcCCh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPA   81 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~   81 (89)
                      .++.++-.++|+.+|++|++|.
T Consensus         5 ~~~i~~~~~l~~~l~~~l~fP~   26 (86)
T cd05140           5 LSDITSERELHELLKECLGFPG   26 (86)
T ss_pred             cccCCCHHHHHHHHHHHcCCch
Confidence            3567888999999999999874


No 65 
>PF00165 HTH_AraC:  Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A.
Probab=40.54  E-value=39  Score=18.45  Aligned_cols=24  Identities=8%  Similarity=0.133  Sum_probs=15.7

Q ss_pred             CccchHHHHHHhhhhhcCChhhHhh
Q psy16018         62 GFSNVRELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        62 gF~nvkELY~kIae~f~i~~~eIl~   86 (89)
                      || |..-+.....+.+|+.|.|.++
T Consensus        19 g~-S~~~f~r~Fk~~~g~tp~~y~~   42 (42)
T PF00165_consen   19 GF-SPSYFSRLFKKETGMTPKQYRR   42 (42)
T ss_dssp             TS--HHHHHHHHHHHTSS-HHHHHH
T ss_pred             CC-CHHHHHHHHHHHHCcCHHHHhC
Confidence            56 6666777777888888877653


No 66 
>cd05142 Barstar Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=39.86  E-value=27  Score=23.01  Aligned_cols=21  Identities=14%  Similarity=0.317  Sum_probs=18.1

Q ss_pred             cCccchHHHHHHhhhhhcCCh
Q psy16018         61 SGFSNVRELYQKIAECYEFPA   81 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~   81 (89)
                      ..+++..++|+.++++|++|.
T Consensus         7 ~~i~~~~~f~~~l~~~~~~p~   27 (87)
T cd05142           7 EEIRSIEDLHQILKKELALPE   27 (87)
T ss_pred             ccCCCHHHHHHHHHHHhCCch
Confidence            467888999999999999874


No 67 
>PRK06030 hypothetical protein; Provisional
Probab=39.68  E-value=29  Score=24.59  Aligned_cols=23  Identities=9%  Similarity=0.200  Sum_probs=20.0

Q ss_pred             cchHHHHHHhhhhhcCChhhHhh
Q psy16018         64 SNVRELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl~   86 (89)
                      .++.++=+.+|+.|+|+++||+-
T Consensus        23 ~t~d~Ii~~Va~~f~I~~~di~s   45 (124)
T PRK06030         23 ELCEAVIDLLALAFGVSGAEIAS   45 (124)
T ss_pred             cCHHHHHHHHHHHhCCCHHHHhC
Confidence            46788889999999999999964


No 68 
>PF13350 Y_phosphatase3:  Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B.
Probab=38.33  E-value=12  Score=25.83  Aligned_cols=34  Identities=26%  Similarity=0.737  Sum_probs=21.5

Q ss_pred             ceeeeeecccCCC-ceeccCccchHHHHHHhhhhhcCChhhHhhhc
Q psy16018         44 KLIFHCQLAHGSP-TGLISGFSNVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        44 ~LvFh~QLAHGSp-tg~I~gF~nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      .++|||-.  |-. ||.+..+         |=.+.|++.++|++||
T Consensus       126 p~l~HC~a--GKDRTG~~~al---------ll~~lGV~~~~I~~DY  160 (164)
T PF13350_consen  126 PVLFHCTA--GKDRTGVVAAL---------LLSLLGVPDEDIIADY  160 (164)
T ss_dssp             -EEEE-SS--SSSHHHHHHHH---------HHHHTT--HHHHHHHH
T ss_pred             cEEEECCC--CCccHHHHHHH---------HHHHcCCCHHHHHHHH
Confidence            78999984  543 5555443         4477889999999997


No 69 
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional
Probab=38.11  E-value=39  Score=21.44  Aligned_cols=26  Identities=4%  Similarity=0.190  Sum_probs=23.0

Q ss_pred             cCccchHHHHHHhhhhhcCChhhHhh
Q psy16018         61 SGFSNVRELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~~eIl~   86 (89)
                      -||+|..-++...-+.||++|.+.-+
T Consensus        80 ~Gf~~~s~f~~~Fk~~~G~tP~~~r~  105 (107)
T PRK10219         80 LGYVSQQTFSRVFRRQFDRTPSDYRH  105 (107)
T ss_pred             HCCCCHHHHHHHHHHHHCcCHHHHHh
Confidence            48999999999999999999998754


No 70 
>cd05141 Barstar_evA4336-like Barstar_evA4336-like contains uncharacterized sequences similar to the uncharacterized, predicted RNAase inhibitor evA4336 found in Azoarcus sp. EvN1. This is a subfamily of the Barstar family of RNAase inhibitors. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs to the same enzyme family as does barnase.
Probab=37.75  E-value=31  Score=21.94  Aligned_cols=21  Identities=29%  Similarity=0.653  Sum_probs=18.1

Q ss_pred             ccCccchHHHHHHhhhhhcCC
Q psy16018         60 ISGFSNVRELYQKIAECYEFP   80 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~   80 (89)
                      .++.++..++|+.+|++|++|
T Consensus         5 g~~i~~~~~~~~~l~~~l~fP   25 (81)
T cd05141           5 LSGIADKAALLDALAAALDFP   25 (81)
T ss_pred             cccCCCHHHHHHHHHHHcCCC
Confidence            356788899999999999987


No 71 
>cd01769 UBL Ubiquitin-like domain of UBL. UBLs function by remodeling the surface of their target proteins, changing their target's half-life, enzymatic activity, protein-protein interactions, subcellular localization or other properties. At least 10 different ubiquitin-like modifications exist in mammals, and attachment of different ubls to a target leads to different biological consequences. Ubl-conjugation cascades are initiated by activating enzymes, which also coordinate the ubls with their downstream pathways.
Probab=36.98  E-value=39  Score=19.01  Aligned_cols=23  Identities=35%  Similarity=0.264  Sum_probs=19.0

Q ss_pred             CccchHHHHHHhhhhhcCChhhH
Q psy16018         62 GFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        62 gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .-.++.+|-+.|++.++++++++
T Consensus        16 ~~~ti~~lK~~i~~~~~~~~~~~   38 (69)
T cd01769          16 PDDTVAELKAKIAAKEGVPPEQQ   38 (69)
T ss_pred             CCChHHHHHHHHHHHHCcChHHE
Confidence            34579999999999999988764


No 72 
>PRK10425 DNase TatD; Provisional
Probab=36.84  E-value=37  Score=25.79  Aligned_cols=34  Identities=15%  Similarity=0.060  Sum_probs=29.0

Q ss_pred             CCCceeccCccchHHHHHHhhhhhcCChhhHhhh
Q psy16018         54 GSPTGLISGFSNVRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        54 GSptg~I~gF~nvkELY~kIae~f~i~~~eIl~~   87 (89)
                      |.+.|+...=.++.+.+++||+..+++.+||.+.
T Consensus       214 ~~~~~~~n~P~~i~~v~~~iA~l~~~~~~~v~~~  247 (258)
T PRK10425        214 PKPASRRNEPAFLPHILQRIAHWRGEDAAWLAAT  247 (258)
T ss_pred             CCCCCCCCCcHHHHHHHHHHHHHHCcCHHHHHHH
Confidence            4556777777899999999999999999998764


No 73 
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=36.72  E-value=25  Score=22.24  Aligned_cols=21  Identities=24%  Similarity=0.381  Sum_probs=17.8

Q ss_pred             chHHHHHHhhhhhcCChhhHh
Q psy16018         65 NVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl   85 (89)
                      .-.++|..+.+.++++|.+++
T Consensus       134 p~~~~~~~~~~~~~~~p~~~~  154 (176)
T PF13419_consen  134 PDPDAYRRALEKLGIPPEEIL  154 (176)
T ss_dssp             TSHHHHHHHHHHHTSSGGGEE
T ss_pred             hHHHHHHHHHHHcCCCcceEE
Confidence            347899999999999998875


No 74 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=36.67  E-value=23  Score=22.21  Aligned_cols=19  Identities=32%  Similarity=0.488  Sum_probs=14.7

Q ss_pred             CCceeeeeecccCCCce-ecc
Q psy16018         42 KPKLIFHCQLAHGSPTG-LIS   61 (89)
Q Consensus        42 ~p~LvFh~QLAHGSptg-~I~   61 (89)
                      .-...|+|+ |+|.|.- .|.
T Consensus        13 G~~v~l~C~-a~G~P~P~~I~   32 (81)
T cd05749          13 NTPFNLTCQ-AVGPPEPVEIL   32 (81)
T ss_pred             CCCEEEEEE-eeeecCCeEEE
Confidence            346899999 9999976 454


No 75 
>PF07700 HNOB:  Heme NO binding;  InterPro: IPR011644 This ligand-binding domain is found in soluble guanylate cyclases. In soluble guanylate cyclases this domain binds heme via a covalent linkage to histidine []. Soluble guanylate cyclases are nitric oxide-responsive signaling proteins.; GO: 0020037 heme binding; PDB: 3TFE_A 2O0C_B 3TFA_A 2O09_B 2O0G_B 3L6J_A 3TFG_B 3TF8_A 3TFF_A 3TF9_B ....
Probab=36.48  E-value=32  Score=24.17  Aligned_cols=23  Identities=30%  Similarity=0.404  Sum_probs=18.1

Q ss_pred             hHHHHHHhhhhhcCChhhHhhhc
Q psy16018         66 VRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        66 vkELY~kIae~f~i~~~eIl~~~   88 (89)
                      +..|-+.+|+.-+++.+||+++|
T Consensus        48 ~~~lv~a~a~~~g~~~~~~l~~f   70 (171)
T PF07700_consen   48 TYKLVEAAAEVTGISVEELLEEF   70 (171)
T ss_dssp             HHHHHHHHHHHHTS-HHHHHHHH
T ss_pred             HHHHHHHHHHHhCCCHHHHHHHH
Confidence            44566778899999999999986


No 76 
>PF10545 MADF_DNA_bdg:  Alcohol dehydrogenase transcription factor Myb/SANT-like;  InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats. The MADF domain is found in one or more copies in eukaryotic and viral proteins and is often associated with the BESS domain []. MADF is related to the Myb DNA-binding domain (IPR001005 from INTERPRO). The retroviral oncogene v-myb, and its cellular counterpart c-myb, are nuclear DNA-binding proteins that specifically recognise the sequence YAAC(G/T)G. It is likely that the MADF domain is more closely related to the myb/SANT domain than it is to other HTH domains. Some proteins known to contain a MADF domain are listed below:    Drosophila Adf-1, a transcription factor first identified on the basis of its interaction with the alcohol dehydrogenase promoter but that binds the promoters of a diverse group of genes [].  Drosophila Dorsal-interacting protein 3 (Dip3), which functions both as an activator to bind DNA in a sequence specific manner and a coactivator to stimulate synergistic activation by Dorsal and Twist [].  Drosophila Stonewall (Stwl), a putative transcription factor required for maintenance of female germline stem cells as well as oocyte differentiation.   
Probab=36.07  E-value=26  Score=20.66  Aligned_cols=23  Identities=22%  Similarity=0.330  Sum_probs=18.6

Q ss_pred             chHHHHHHhhhhhc--CChhhHhhh
Q psy16018         65 NVRELYQKIAECYE--FPAEEVSED   87 (89)
Q Consensus        65 nvkELY~kIae~f~--i~~~eIl~~   87 (89)
                      ...+.|+.||+.++  +++++|.+.
T Consensus        24 ~r~~aw~~Ia~~l~~~~~~~~~~~~   48 (85)
T PF10545_consen   24 LREEAWQEIARELGKEFSVDDCKKR   48 (85)
T ss_pred             HHHHHHHHHHHHHccchhHHHHHHH
Confidence            46789999999999  888877553


No 77 
>PF07836 DmpG_comm:  DmpG-like communication domain;  InterPro: IPR012425 This domain is found towards the C-terminal region of various aldolase enzymes. It consists of five alpha-helices, four of which form an antiparallel helical bundle that plugs the C terminus of the N-terminal TIM barrel domain []. The communication domain is thought to play an important role in the heterodimerisation of the enzyme [].  Members of this entry heterodimerise with members of IPR003361 from INTERPRO to form a bifunctional aldolase-dehydrogenase [].; GO: 0016833 oxo-acid-lyase activity, 0019439 aromatic compound catabolic process; PDB: 1NVM_E.
Probab=35.91  E-value=36  Score=22.28  Aligned_cols=25  Identities=16%  Similarity=0.244  Sum_probs=16.6

Q ss_pred             ccchHHHHHHhhhhhcCChhhHhhh
Q psy16018         63 FSNVRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        63 F~nvkELY~kIae~f~i~~~eIl~~   87 (89)
                      ||+---.-+++|+-|++++-||+..
T Consensus        18 ySsFl~ha~raa~~ygVd~r~il~e   42 (66)
T PF07836_consen   18 YSSFLLHAERAAERYGVDPRDILVE   42 (66)
T ss_dssp             -TTHHHHHHHHHHHHT--HHHHHHH
T ss_pred             hHHHHHHHHHHHHHhCcCHHHHHHH
Confidence            3444455677889999999999865


No 78 
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT contains an N-terminal TRX-like domain, which does not contain the catalytic CXXC motif, followed by one to three glutaredoxin domains. The TRX-like domain is required for interaction with PKC theta. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli.
Probab=35.53  E-value=33  Score=20.57  Aligned_cols=29  Identities=28%  Similarity=0.527  Sum_probs=22.4

Q ss_pred             CCceeeeeecccCCCceeccCccchHHHHHHhh
Q psy16018         42 KPKLIFHCQLAHGSPTGLISGFSNVRELYQKIA   74 (89)
Q Consensus        42 ~p~LvFh~QLAHGSptg~I~gF~nvkELY~kIa   74 (89)
                      -|.++|--+   |...+++.|+ +.++|.++|+
T Consensus        69 ~Pt~~~~~~---g~~~~~~~g~-~~~~l~~~~~   97 (97)
T cd02984          69 VPTFVFFRN---GTIVDRVSGA-DPKELAKKVE   97 (97)
T ss_pred             ccEEEEEEC---CEEEEEEeCC-CHHHHHHhhC
Confidence            566777754   9999999997 6788888764


No 79 
>COG4001 Predicted metal-binding protein [General function prediction only]
Probab=34.54  E-value=27  Score=24.83  Aligned_cols=24  Identities=17%  Similarity=0.443  Sum_probs=20.7

Q ss_pred             hHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         66 VRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        66 vkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      |+.+-++-|++|++...||-|.|+
T Consensus        61 vkkive~garAfgVdee~iRE~~~   84 (102)
T COG4001          61 VKKIVERGARAFGVDEEDIREQMH   84 (102)
T ss_pred             HHHHHHhcchhcCCCHHHHHHHHH
Confidence            677888999999999999988763


No 80 
>cd00489 Barstar_like Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it, thus inhibiting its potentially lethal RNase activity inside the cell.  Barstar also binds and inhibits a ribonuclease called RNase Sa (produced by Streptomyces aureofaciens) which belongs  to the same enzyme family as does barnase.
Probab=33.45  E-value=39  Score=22.02  Aligned_cols=21  Identities=10%  Similarity=0.346  Sum_probs=17.7

Q ss_pred             cCccchHHHHHHhhhhhcCCh
Q psy16018         61 SGFSNVRELYQKIAECYEFPA   81 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~   81 (89)
                      +..++..++|+.+|++|++|.
T Consensus         6 ~~i~~~~~f~~~~~~~l~fp~   26 (85)
T cd00489           6 EDIADWEDFHARLKKKLGFPD   26 (85)
T ss_pred             ccCCCHHHHHHHHHHHhCCcc
Confidence            456788999999999999873


No 81 
>smart00386 HAT HAT (Half-A-TPR) repeats. Present in several RNA-binding proteins. Structurally and sequentially thought to be similar to TPRs.
Probab=33.20  E-value=39  Score=16.02  Aligned_cols=19  Identities=16%  Similarity=0.406  Sum_probs=14.5

Q ss_pred             CccchHHHHHHhhhhhcCC
Q psy16018         62 GFSNVRELYQKIAECYEFP   80 (89)
Q Consensus        62 gF~nvkELY~kIae~f~i~   80 (89)
                      .+..++++|++.-+.+..+
T Consensus         2 ~~~~~r~i~e~~l~~~~~~   20 (33)
T smart00386        2 DIERARKIYERALEKFPKS   20 (33)
T ss_pred             cHHHHHHHHHHHHHHCCCC
Confidence            4667899999988777643


No 82 
>PF04760 IF2_N:  Translation initiation factor IF-2, N-terminal region;  InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2. It is found in two copies in IF-2 alpha isoforms, and in only one copy in the N-terminally truncated beta and gamma isoforms []. Its function is unknown.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1ND9_A.
Probab=33.03  E-value=28  Score=20.24  Aligned_cols=16  Identities=19%  Similarity=0.443  Sum_probs=13.5

Q ss_pred             hhhhhcCChhhHhhhc
Q psy16018         73 IAECYEFPAEEVSEDF   88 (89)
Q Consensus        73 Iae~f~i~~~eIl~~~   88 (89)
                      +|+.+++++.||++.+
T Consensus         9 lAk~l~v~~~~ii~~l   24 (54)
T PF04760_consen    9 LAKELGVPSKEIIKKL   24 (54)
T ss_dssp             HHHHHSSSHHHHHHHH
T ss_pred             HHHHHCcCHHHHHHHH
Confidence            5888899999998865


No 83 
>PF11784 DUF3320:  Protein of unknown function (DUF3320);  InterPro: IPR021754  This family is conserved in Proteobacteria and Chlorobi families. Many members are annotated as being putative DNA helicase-related proteins. 
Probab=33.02  E-value=34  Score=20.50  Aligned_cols=21  Identities=24%  Similarity=0.354  Sum_probs=15.8

Q ss_pred             cCccchHHHHHHhhhhhcCCh
Q psy16018         61 SGFSNVRELYQKIAECYEFPA   81 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~   81 (89)
                      ||==...+|+++|++++|++-
T Consensus        24 EgPI~~~~L~~Ri~~a~G~~R   44 (52)
T PF11784_consen   24 EGPIHEDELARRIARAWGLSR   44 (52)
T ss_pred             cCCccHHHHHHHHHHHcCccc
Confidence            333456789999999999853


No 84 
>PF10668 Phage_terminase:  Phage terminase small subunit;  InterPro: IPR018925  This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].
Probab=32.71  E-value=44  Score=21.28  Aligned_cols=22  Identities=23%  Similarity=0.369  Sum_probs=16.6

Q ss_pred             cchHHHHH---------HhhhhhcCChhhHh
Q psy16018         64 SNVRELYQ---------KIAECYEFPAEEVS   85 (89)
Q Consensus        64 ~nvkELY~---------kIae~f~i~~~eIl   85 (89)
                      ...+|||.         .||+.++++++.|-
T Consensus        10 dkA~e~y~~~~g~i~lkdIA~~Lgvs~~tIr   40 (60)
T PF10668_consen   10 DKAFEIYKESNGKIKLKDIAEKLGVSESTIR   40 (60)
T ss_pred             HHHHHHHHHhCCCccHHHHHHHHCCCHHHHH
Confidence            34456665         59999999998874


No 85 
>TIGR03859 PQQ_PqqD coenzyme PQQ biosynthesis protein PqqD. This model identifies PqqD, a protein involved in the final steps of the biosynthesis of pyrroloquinoline quinone, coenzyme PQQ.
Probab=32.64  E-value=45  Score=21.24  Aligned_cols=28  Identities=32%  Similarity=0.542  Sum_probs=24.1

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhHhhh
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eIl~~   87 (89)
                      .|+|=.||.|+.+.+++.|+. ++++-+|
T Consensus        39 lldg~~tv~eI~~~L~~~Y~~-~e~~~~d   66 (81)
T TIGR03859        39 LCDGKRSLAEIIQELAQRFPA-AEEIEDD   66 (81)
T ss_pred             HccCCCcHHHHHHHHHHHcCC-hhhHHHH
Confidence            578888999999999999999 7777655


No 86 
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins.
Probab=32.60  E-value=40  Score=16.81  Aligned_cols=17  Identities=24%  Similarity=0.325  Sum_probs=12.7

Q ss_pred             HHHHHHhhhhhcCChhh
Q psy16018         67 RELYQKIAECYEFPAEE   83 (89)
Q Consensus        67 kELY~kIae~f~i~~~e   83 (89)
                      .+...+|++.|++++.+
T Consensus        39 ~~~~~~i~~~~~~~~~~   55 (56)
T smart00530       39 LETLKKLAKALGVSLDE   55 (56)
T ss_pred             HHHHHHHHHHhCCChhh
Confidence            34457888999998865


No 87 
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=32.60  E-value=29  Score=19.64  Aligned_cols=19  Identities=11%  Similarity=0.268  Sum_probs=12.9

Q ss_pred             HHHHHHhhhhhcCChhhHh
Q psy16018         67 RELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        67 kELY~kIae~f~i~~~eIl   85 (89)
                      +++++.+++.+++++.+|.
T Consensus        21 ~~i~~~l~~~~g~~~~~v~   39 (58)
T cd00491          21 ERVTEAVSEILGAPEATIV   39 (58)
T ss_pred             HHHHHHHHHHhCcCcccEE
Confidence            4455555688888887764


No 88 
>PF13743 Thioredoxin_5:  Thioredoxin; PDB: 3KZQ_C.
Probab=31.67  E-value=43  Score=23.85  Aligned_cols=25  Identities=32%  Similarity=0.347  Sum_probs=19.6

Q ss_pred             chHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         65 NVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      |..|+...||+-.||+.++.++|++
T Consensus       101 s~~~~l~~iA~~~gLD~~~F~~d~~  125 (176)
T PF13743_consen  101 SDEELLLEIAEELGLDVEMFKEDLH  125 (176)
T ss_dssp             TSHHHHHHHHHHTT--HHHHHHHHT
T ss_pred             CHHHHHHHHHHHhCCCHHHHHHHHh
Confidence            4458899999999999999999874


No 89 
>PRK11511 DNA-binding transcriptional activator MarA; Provisional
Probab=31.66  E-value=59  Score=21.81  Aligned_cols=27  Identities=15%  Similarity=0.390  Sum_probs=23.9

Q ss_pred             cCccchHHHHHHhhhhhcCChhhHhhh
Q psy16018         61 SGFSNVRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~~eIl~~   87 (89)
                      -||++..-++...-+.|+++|.+.-+.
T Consensus        84 ~Gf~s~s~F~r~Fkk~~G~tP~~yR~~  110 (127)
T PRK11511         84 YGFESQQTLTRTFKNYFDVPPHKYRMT  110 (127)
T ss_pred             hCCCCHHHHHHHHHHHHCcCHHHHHHh
Confidence            599999999999999999999987543


No 90 
>smart00257 LysM Lysin motif.
Probab=31.65  E-value=47  Score=15.84  Aligned_cols=17  Identities=24%  Similarity=0.386  Sum_probs=12.2

Q ss_pred             HHHhhhhhcCChhhHhh
Q psy16018         70 YQKIAECYEFPAEEVSE   86 (89)
Q Consensus        70 Y~kIae~f~i~~~eIl~   86 (89)
                      +..||..|++++.++.+
T Consensus        10 ~~~ia~~~~~~~~~~~~   26 (44)
T smart00257       10 LSSIARRYGISVSDLLE   26 (44)
T ss_pred             HHHHHHHhCCCHHHHHH
Confidence            45678888888777653


No 91 
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein.
Probab=31.46  E-value=55  Score=18.48  Aligned_cols=24  Identities=17%  Similarity=0.265  Sum_probs=18.4

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      .-||.|...++....+.+|++|.+
T Consensus        59 ~~g~~s~~~f~r~Fk~~~g~sp~~   82 (84)
T smart00342       59 RVGFSSQSYFSRAFKKLFGVTPSE   82 (84)
T ss_pred             HhCCCChHHHHHHHHHHHCcChhh
Confidence            457777888888888888888776


No 92 
>COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism]
Probab=31.43  E-value=37  Score=26.01  Aligned_cols=36  Identities=17%  Similarity=0.317  Sum_probs=30.8

Q ss_pred             eecccCCCceec---cCccchHHHHHHhhhhhcCChhhH
Q psy16018         49 CQLAHGSPTGLI---SGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        49 ~QLAHGSptg~I---~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .||.||.+.+-+   .||.|.+-.|....+.++.+|.+.
T Consensus       140 ~~L~~g~sv~~a~~daGf~s~s~F~~af~~~~G~~P~~~  178 (187)
T COG2169         140 KQLRMGASVTDAQIDAGFESSSRFYDAFSKILGMTPTKF  178 (187)
T ss_pred             HHHhCCCchhHHHHHhCCCChHHHHHHHHHHcCCChHHH
Confidence            478888866544   699999999999999999999876


No 93 
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N   HOIL-1 (heme-oxidized IRP2 ubiquitin ligase-1) is an E3 ubiquitin-protein ligase that recognizes heme-oxidized IRP2 (iron regulatory protein2) and is thought to affect the turnover of oxidatively damaged proteins.  Hoil-1 has an amino-terminal ubiquitin-like domain as well as an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.
Probab=31.24  E-value=59  Score=20.53  Aligned_cols=25  Identities=24%  Similarity=0.267  Sum_probs=21.0

Q ss_pred             eccCccchHHHHHHhhhhhcCChhh
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      .|+.-.+|.+|-++|.+.++||+++
T Consensus        18 ~v~~~~TV~~lK~kI~~~~gip~~~   42 (75)
T cd01799          18 TVRPDMTVAQLKDKVFLDYGFPPAV   42 (75)
T ss_pred             EECCCCcHHHHHHHHHHHHCcCHHH
Confidence            3455678999999999999999875


No 94 
>PF12872 OST-HTH:  OST-HTH/LOTUS domain; PDB: 2KPM_A 3S93_B 3RCO_A 2KZV_A.
Probab=30.83  E-value=25  Score=20.88  Aligned_cols=18  Identities=33%  Similarity=0.685  Sum_probs=14.1

Q ss_pred             CccchHHHHHHhhhhhcC
Q psy16018         62 GFSNVRELYQKIAECYEF   79 (89)
Q Consensus        62 gF~nvkELY~kIae~f~i   79 (89)
                      ||++..+|-+++.+.|.|
T Consensus        46 G~~~l~~ll~~~~~~~~i   63 (74)
T PF12872_consen   46 GFSSLSELLESLPDVVEI   63 (74)
T ss_dssp             TSSSHHHHHHT-TTTEEE
T ss_pred             CCCcHHHHHHhCCCeEEE
Confidence            899999999887777765


No 95 
>PF13542 HTH_Tnp_ISL3:  Helix-turn-helix domain of transposase family ISL3
Probab=30.61  E-value=43  Score=18.72  Aligned_cols=19  Identities=16%  Similarity=0.230  Sum_probs=15.7

Q ss_pred             HHHhhhhhcCChhhHhhhc
Q psy16018         70 YQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        70 Y~kIae~f~i~~~eIl~~~   88 (89)
                      ++.||+.++++.+-|.+-|
T Consensus        30 ~~~vA~~~~vs~~TV~ri~   48 (52)
T PF13542_consen   30 FKDVARELGVSWSTVRRIF   48 (52)
T ss_pred             HHHHHHHHCCCHHHHHHHH
Confidence            6778999999998887754


No 96 
>PF11000 DUF2840:  Protein of unknown function (DUF2840);  InterPro: IPR021263  This bacterial family of proteins have no known function. 
Probab=30.37  E-value=35  Score=25.67  Aligned_cols=29  Identities=28%  Similarity=0.469  Sum_probs=25.4

Q ss_pred             eccCccchHHHHHHhh--hhhcCChhhHhhh
Q psy16018         59 LISGFSNVRELYQKIA--ECYEFPAEEVSED   87 (89)
Q Consensus        59 ~I~gF~nvkELY~kIa--e~f~i~~~eIl~~   87 (89)
                      +++|+.+|+...+.|-  |+.||+|.|+--|
T Consensus        87 r~~Gw~kV~~VL~~IDaiEalGidp~dvaPd  117 (149)
T PF11000_consen   87 RIEGWPKVERVLQAIDAIEALGIDPADVAPD  117 (149)
T ss_pred             cccCcHHHHHHHHHHhHHHHcCCChhhcChH
Confidence            5799999999999997  9999999987544


No 97 
>TIGR02384 RelB_DinJ addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than Pfam model pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species.
Probab=28.79  E-value=48  Score=21.59  Aligned_cols=24  Identities=8%  Similarity=0.076  Sum_probs=20.2

Q ss_pred             chHHHHHHhhhhhcCChhhHhhhc
Q psy16018         65 NVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      .+|+-...|.+.+||++++.++.|
T Consensus        12 ~lK~~a~~i~~~lGl~~s~ai~~f   35 (83)
T TIGR02384        12 ELKKEAYAVFEELGLTPSTAIRMF   35 (83)
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHH
Confidence            467778888899999999998876


No 98 
>PF05157 T2SE_Nter:  Type II secretion system (T2SS), protein E, N-terminal domain;  InterPro: IPR007831 This domain is found at the N terminus of members of the general secretory system II protein E. Proteins in this subfamily are typically involved in Type IV pilus biogenesis (e.g. Q9X4G8 from SWISSPROT), though some are involved in other processes; for instance aggregation in Myxococcus xanthus (e.g. Q9RF11 from SWISSPROT) [].; GO: 0005524 ATP binding, 0006810 transport; PDB: 2D27_A 2D28_C.
Probab=28.65  E-value=54  Score=20.04  Aligned_cols=24  Identities=21%  Similarity=0.361  Sum_probs=15.6

Q ss_pred             cCccchHHHHHHhhhhhcCChhhH
Q psy16018         61 SGFSNVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~~eI   84 (89)
                      .|+-+-+++++.+|+.++++..++
T Consensus         4 ~g~ise~~l~~~la~~~~l~~~~~   27 (109)
T PF05157_consen    4 LGLISEDQLLEALAEQLGLPFVDL   27 (109)
T ss_dssp             TT-S-HHHHHHHHHHHHT--B--G
T ss_pred             CCCCCHHHHHHHHHHHhCCCeech
Confidence            467788999999999999987654


No 99 
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120. SF3a120_C  Mammalian splicing factor SF3a consists of three subunits of 60, 66, and 120 kDa and functions early during pre-mRNA splicing by converting the U2 snRNP to its active form.  The 120kDa subunit (SF3a120) has a carboxy-terminal ubiquitin-like domain and two SWAP (suppressor-of-white-apricot) domains, referred to collectively as the SURP module, at its amino-terminus.
Probab=28.56  E-value=73  Score=19.52  Aligned_cols=24  Identities=29%  Similarity=0.188  Sum_probs=20.6

Q ss_pred             ccCccchHHHHHHhhhhhcCChhh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEE   83 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~e   83 (89)
                      ++...+|.+|-++|.+..+||++.
T Consensus        14 v~~~~TV~~lK~~i~~~~gip~~~   37 (76)
T cd01800          14 LQLSDPVSVLKVKIHEETGMPAGK   37 (76)
T ss_pred             ECCCCcHHHHHHHHHHHHCCCHHH
Confidence            456678999999999999999875


No 100
>PF14109 GldH_lipo:  GldH lipoprotein
Probab=28.37  E-value=14  Score=25.66  Aligned_cols=23  Identities=30%  Similarity=0.563  Sum_probs=17.3

Q ss_pred             ceeeeeeccc--CCCceeccCccchHH
Q psy16018         44 KLIFHCQLAH--GSPTGLISGFSNVRE   68 (89)
Q Consensus        44 ~LvFh~QLAH--GSptg~I~gF~nvkE   68 (89)
                      +=..+|+||.  |.+.|  +||++++|
T Consensus        67 ~dtl~~~Lad~~G~w~G--~G~~~~~e   91 (131)
T PF14109_consen   67 TDTLECELADPDGKWLG--KGIGDLYE   91 (131)
T ss_pred             eeeEEEEEECCCCcEee--eeEeEeEE
Confidence            4578999999  66666  78887655


No 101
>PRK05250 S-adenosylmethionine synthetase; Validated
Probab=27.88  E-value=54  Score=27.77  Aligned_cols=25  Identities=4%  Similarity=0.224  Sum_probs=22.4

Q ss_pred             chHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         65 NVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      +..+|.+.|.+.|++.|..|+++|.
T Consensus       321 ~~~~i~~~v~~~Fdl~P~~Ii~~L~  345 (384)
T PRK05250        321 SDEKIEEAVREVFDLRPAGIIKMLD  345 (384)
T ss_pred             CHHHHHHHHHHHcCCCHHHHHHHhC
Confidence            4689999999999999999999873


No 102
>PF08667 BetR:  BetR domain;  InterPro: IPR013975 CheY-like phosphoacceptor (or receiver [REC]) domain is a common module in a variety of response regulators of the bacterial signal transduction systems. BetR is one of the many response regulators and is encoded mainly in Burkholderia spp. It is a N-terminal helix-turn-helix domain (HTH) and has been shown to be related to the XRE-type HTH domain (IPR001387 from INTERPRO), it has been suggested that BetR would have dimerization, protein-protein interaction, and activation/relief-of-inhibition properties [].
Probab=27.25  E-value=40  Score=24.79  Aligned_cols=20  Identities=25%  Similarity=0.509  Sum_probs=16.4

Q ss_pred             chHHHHHHhhhhhcCChhhHh
Q psy16018         65 NVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl   85 (89)
                      ++.|+ ++||+.|++++++++
T Consensus        50 tl~EI-~~Ia~~fgvS~d~l~   69 (147)
T PF08667_consen   50 TLEEI-KKIAKHFGVSPDELF   69 (147)
T ss_pred             CHHHH-HHHHHHhCcCHHHHH
Confidence            45555 579999999999998


No 103
>PRK11449 putative deoxyribonuclease YjjV; Provisional
Probab=26.82  E-value=60  Score=24.54  Aligned_cols=30  Identities=20%  Similarity=0.288  Sum_probs=25.9

Q ss_pred             eeccCccchHHHHHHhhhhhcCChhhHhhh
Q psy16018         58 GLISGFSNVRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        58 g~I~gF~nvkELY~kIae~f~i~~~eIl~~   87 (89)
                      |+.....++.+.|++||+..+++++|+.+.
T Consensus       218 ~~~n~p~~~~~~~~~ia~l~~~~~~el~~~  247 (258)
T PRK11449        218 GQPNRPEQAARVFDVLCELRPEPADEIAEV  247 (258)
T ss_pred             CCCCCChHHHHHHHHHHHHHCcCHHHHHHH
Confidence            556779999999999999999999988653


No 104
>PF08383 Maf_N:  Maf N-terminal region;  InterPro: IPR013592 This region is found in various leucine zipper transcription factors of the Maf family. These are implicated in the regulation of insulin gene expression [], in erythroid differentiation [], and in differentiation of the neuroretina []. 
Probab=26.78  E-value=23  Score=20.96  Aligned_cols=20  Identities=20%  Similarity=0.353  Sum_probs=15.7

Q ss_pred             HHHHhh-hhhcCChhhHhhhc
Q psy16018         69 LYQKIA-ECYEFPAEEVSEDF   88 (89)
Q Consensus        69 LY~kIa-e~f~i~~~eIl~~~   88 (89)
                      ++|.+. ++++++|.|.+|.+
T Consensus        12 ~~Qq~~pe~l~LtpEDAvEaL   32 (35)
T PF08383_consen   12 YQQQMNPEALGLTPEDAVEAL   32 (35)
T ss_pred             chhhcChhhcCCCHHHHHHHH
Confidence            456665 99999999998853


No 105
>TIGR02681 phage_pRha phage regulatory protein, rha family. Members of this protein family are found in temperate phage and bacterial prophage regions. Members include the product of the rha gene of the lambdoid phage phi-80, a late operon gene. The presence of this gene interferes with infection of bacterial strains that lack integration host factor (IHF), which regulates the rha gene. It is suggested that pRha is a phage regulatory protein.
Probab=26.77  E-value=37  Score=23.22  Aligned_cols=20  Identities=15%  Similarity=0.262  Sum_probs=17.4

Q ss_pred             HHHhhhhhcCChhhHhhhcC
Q psy16018         70 YQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        70 Y~kIae~f~i~~~eIl~~~~   89 (89)
                      +-.|||.|+-.-.+||||+|
T Consensus        16 S~~IAe~fgK~H~~VlR~Ir   35 (108)
T TIGR02681        16 SLTMAQMFGKRHDNVIRDIK   35 (108)
T ss_pred             HHHHHHHHCcchHHHHHHHH
Confidence            45699999999999999874


No 106
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by Pfam model pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair.
Probab=26.73  E-value=65  Score=19.11  Aligned_cols=19  Identities=11%  Similarity=0.088  Sum_probs=15.4

Q ss_pred             HHHHHhhhhhcCChhhHhh
Q psy16018         68 ELYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl~   86 (89)
                      +...+||++|+++++.+|.
T Consensus        48 ~~~~~l~~~l~v~~~~l~~   66 (78)
T TIGR02607        48 DMALRLAKALGTSPEFWLN   66 (78)
T ss_pred             HHHHHHHHHcCCCHHHHHH
Confidence            3457999999999988775


No 107
>PF02796 HTH_7:  Helix-turn-helix domain of resolvase;  InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms. Two types of site-specific recombination are known to occur:  Recombination between inverted repeats resulting in the reversal of a DNA segment. Recombination between repeat sequences on two DNA molecules resulting in their cointegration, or between repeats on one DNA molecule resulting in the excision of a DNA fragment.  Site-specific recombination is characterised by a strand exchange mechanism that requires no DNA synthesis or high energy cofactor; the phosphodiester bond energy is conserved in a phospho-protein linkage during strand cleavage and re-ligation. Two unrelated families of recombinases are currently known []. The first, called the 'phage integrase' family, groups a number of bacterial phage and yeast plasmid enzymes. The second [], called the 'resolvase' family, groups enzymes which share the following structural characteristics: an N-terminal catalytic and dimerization domain that contains a conserved serine residue involved in the transient covalent attachment to DNA IPR006119 from INTERPRO, and a C-terminal helix-turn-helix DNA-binding domain. ; GO: 0000150 recombinase activity, 0003677 DNA binding, 0006310 DNA recombination; PDB: 1ZR2_A 2GM4_B 1RES_A 1ZR4_A 1RET_A 1GDT_B 2R0Q_C 1JKP_C 1IJW_C 1JJ6_C ....
Probab=26.60  E-value=58  Score=18.44  Aligned_cols=18  Identities=17%  Similarity=0.217  Sum_probs=13.0

Q ss_pred             HHhhhhhcCChhhHhhhc
Q psy16018         71 QKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        71 ~kIae~f~i~~~eIl~~~   88 (89)
                      ..||+.|+|+..-|-+-+
T Consensus        25 ~~IA~~~gvsr~TvyR~l   42 (45)
T PF02796_consen   25 AEIAKQFGVSRSTVYRYL   42 (45)
T ss_dssp             HHHHHHTTS-HHHHHHHH
T ss_pred             HHHHHHHCcCHHHHHHHH
Confidence            468999999988876643


No 108
>smart00482 POLAc DNA polymerase A domain.
Probab=26.42  E-value=9.4  Score=27.95  Aligned_cols=35  Identities=34%  Similarity=0.520  Sum_probs=27.1

Q ss_pred             ccCC-CceeccCccchHHHHHHhhh-hhcCChhhHhh
Q psy16018         52 AHGS-PTGLISGFSNVRELYQKIAE-CYEFPAEEVSE   86 (89)
Q Consensus        52 AHGS-ptg~I~gF~nvkELY~kIae-~f~i~~~eIl~   86 (89)
                      ||=| ....++.|.+-.++|..+|. .|+++.+||-.
T Consensus        30 A~ls~D~~l~~~~~~g~D~h~~~A~~~~g~~~~~v~~   66 (206)
T smart00482       30 AHLSGDENLLEAFNNGGDIHSKTAAQVFGVPEEEVTK   66 (206)
T ss_pred             HHHcCCHHHHHHHhcCCCHHHHHHHHHhCCChhhCCH
Confidence            4433 56778888888899999996 78999888753


No 109
>PRK13890 conjugal transfer protein TrbA; Provisional
Probab=26.33  E-value=57  Score=22.28  Aligned_cols=20  Identities=25%  Similarity=0.368  Sum_probs=16.7

Q ss_pred             HHHHHhhhhhcCChhhHhhh
Q psy16018         68 ELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl~~   87 (89)
                      +.-.+||++|++++++++..
T Consensus        48 ~~l~kIa~aL~v~~~~L~~~   67 (120)
T PRK13890         48 KVMEAIADALETPLPLLLES   67 (120)
T ss_pred             HHHHHHHHHHCCCHHHHhcc
Confidence            45589999999999998854


No 110
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=25.95  E-value=48  Score=22.30  Aligned_cols=27  Identities=22%  Similarity=0.327  Sum_probs=19.7

Q ss_pred             CCceeccCcc-----chHHHHHHhhhhhcCCh
Q psy16018         55 SPTGLISGFS-----NVRELYQKIAECYEFPA   81 (89)
Q Consensus        55 Sptg~I~gF~-----nvkELY~kIae~f~i~~   81 (89)
                      +|-|++.-|+     ++.||.+.||.-|++..
T Consensus         7 ~~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~   38 (86)
T cd06409           7 DPKGRVHRFRLRPSESLEELRTLISQRLGDDD   38 (86)
T ss_pred             CCCCCEEEEEecCCCCHHHHHHHHHHHhCCcc
Confidence            3445554443     67999999999998864


No 111
>TIGR01034 metK S-adenosylmethionine synthetase. Tandem isozymes of this S-adenosylmethionine synthetase in E. coli are designated MetK and MetX.
Probab=25.90  E-value=62  Score=27.40  Aligned_cols=25  Identities=16%  Similarity=0.337  Sum_probs=22.7

Q ss_pred             chHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         65 NVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      +..+|.+.|.+.|++.|..|+++|.
T Consensus       318 ~~~~i~~~v~~~FdlrP~~Ii~~L~  342 (377)
T TIGR01034       318 SEEELLNVVKENFDLRPGGIIEKLD  342 (377)
T ss_pred             CHHHHHHHHHHhcCCCHHHHHHHhC
Confidence            5789999999999999999999874


No 112
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed helical bundle. The principal DNA-protein interface is formed by the third helix, the recognition helix, inserting itself into the major groove of the DNA. A diverse array of HTH domains participate in a variety of functions that depend on their DNA-binding properties. HTH_Hin represents one of the simplest versions of the HTH domains; the characterization of homologous relationships between various sequence-diverse HTH domain families remains difficult. The Hin recombinase induces the site-specific inversion of a chromosomal DNA segment containing a promoter, which controls the alternate expression of two genes by reversibly switching orientation. The Hin recombinase consists of a single polypeptide chain containing a D
Probab=25.61  E-value=68  Score=14.43  Aligned_cols=16  Identities=13%  Similarity=0.077  Sum_probs=10.1

Q ss_pred             HHHhhhhhcCChhhHh
Q psy16018         70 YQKIAECYEFPAEEVS   85 (89)
Q Consensus        70 Y~kIae~f~i~~~eIl   85 (89)
                      +..||+.++++..-|-
T Consensus        24 ~~~ia~~~~is~~tv~   39 (42)
T cd00569          24 VAEIARRLGVSRSTLY   39 (42)
T ss_pred             HHHHHHHHCCCHHHHH
Confidence            4566777777765543


No 113
>PF00432 Prenyltrans:  Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family.;  InterPro: IPR001330 The beta subunit of the farnesyltransferases is responsible for peptide binding. Squalene-hopene cyclase is a bacterial enzyme that catalyzes the cyclization of squalene into hopene, a key step in hopanoid (triterpenoid) metabolism []. Lanosterol synthase (5.4.99.7 from EC) (oxidosqualene-lanosterol cyclase) catalyzes the cyclization of (S)-2,3-epoxysqualene to lanosterol, the initial precursor of cholesterol, steroid hormones and vitamin D in vertebrates and of ergosterol in fungi []. Cycloartenol synthase () (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ....
Probab=25.31  E-value=32  Score=19.28  Aligned_cols=31  Identities=26%  Similarity=0.395  Sum_probs=24.0

Q ss_pred             ceeeeeecccCCCceeccCccchHHHHHHhh
Q psy16018         44 KLIFHCQLAHGSPTGLISGFSNVRELYQKIA   74 (89)
Q Consensus        44 ~LvFh~QLAHGSptg~I~gF~nvkELY~kIa   74 (89)
                      +.+..||..-|+.-++.++...+.--|-.++
T Consensus         8 ~~l~~~Q~~dGGf~~~~~~~~d~~~t~~~~~   38 (44)
T PF00432_consen    8 RFLLSCQNPDGGFGGRPGGESDTCYTYCALA   38 (44)
T ss_dssp             HHHHHTBBTTSSBBSSTTSSBBHHHHHHHHH
T ss_pred             HHHHHHCCCCCCCCCCCCCCCChHHHHHHHH
Confidence            4567899999999999999877766665544


No 114
>PF13518 HTH_28:  Helix-turn-helix domain
Probab=25.24  E-value=59  Score=17.77  Aligned_cols=18  Identities=17%  Similarity=0.194  Sum_probs=13.9

Q ss_pred             HHHHhhhhhcCChhhHhh
Q psy16018         69 LYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        69 LY~kIae~f~i~~~eIl~   86 (89)
                      -+..||+.|+|+...|-+
T Consensus        14 s~~~~a~~~gis~~tv~~   31 (52)
T PF13518_consen   14 SVREIAREFGISRSTVYR   31 (52)
T ss_pred             CHHHHHHHHCCCHhHHHH
Confidence            456799999999887743


No 115
>PRK12534 RNA polymerase sigma factor; Provisional
Probab=24.89  E-value=51  Score=22.50  Aligned_cols=21  Identities=24%  Similarity=0.464  Sum_probs=16.6

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhHh
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eIl   85 (89)
                      ++||     -|+.||+.+|+++.-|-
T Consensus       151 ~~g~-----s~~eIA~~lgis~~~v~  171 (187)
T PRK12534        151 FEGI-----TYEELAARTDTPIGTVK  171 (187)
T ss_pred             HcCC-----CHHHHHHHhCCChhHHH
Confidence            5677     68889999999887663


No 116
>PF05099 TerB:  Tellurite resistance protein TerB;  InterPro: IPR007791 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []. Structurally, the DnaJ protein consists of an N-terminal conserved domain (called 'J' domain) of about 70 amino acids, a glycine-rich region ('G' domain') of about 30 residues, a central domain containing four repeats of a CXXCXGXG motif ('CRR' domain) and a C-terminal region of 120 to 170 residues. Direct interaction between DnaK and djlA is needed for the induction of the wcaABCDE operon which is involved in the synthesis of a colanic acid polysaccharide capsule. The colanic acid capsule may help the bacterium survive conditions outside the host [, ]; PDB: 2H5N_D 2JXU_A.
Probab=24.86  E-value=45  Score=21.82  Aligned_cols=21  Identities=24%  Similarity=0.445  Sum_probs=14.7

Q ss_pred             chHHHHHHhhhhhcCChhhHh
Q psy16018         65 NVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl   85 (89)
                      .-+++..+||+.++|+.+++-
T Consensus       116 ~E~~~l~~ia~~L~i~~~~~~  136 (140)
T PF05099_consen  116 EEQEFLRRIAEALGISEEDFQ  136 (140)
T ss_dssp             CHHHHHHHHHHHCTS-SS---
T ss_pred             HHHHHHHHHHHHcCCCHHHHh
Confidence            456789999999999998764


No 117
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism]
Probab=24.57  E-value=33  Score=26.68  Aligned_cols=31  Identities=10%  Similarity=0.071  Sum_probs=27.6

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      .+.|+.||.+-|-..|+.++.+.-|+++..+
T Consensus       144 t~~Gvr~v~~~~~~~ar~lgas~~~~l~~v~  174 (258)
T COG0600         144 TLDGVRSVDPDLLELARTLGASRWQILRKVI  174 (258)
T ss_pred             HHHHHHhCCHHHHHHHHHcCCCHHHHhHhhc
Confidence            4678999999999999999999999998753


No 118
>smart00595 MADF subfamily of SANT domain.
Probab=24.39  E-value=61  Score=19.86  Aligned_cols=22  Identities=27%  Similarity=0.409  Sum_probs=18.5

Q ss_pred             hHHHHHHhhhhhcCChhhHhhh
Q psy16018         66 VRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        66 vkELY~kIae~f~i~~~eIl~~   87 (89)
                      -+++++.||+.++.+++++...
T Consensus        26 r~~aW~~Ia~~l~~~~~~~~~k   47 (89)
T smart00595       26 KRKAWEEIAEELGLSVEECKKR   47 (89)
T ss_pred             HHHHHHHHHHHHCcCHHHHHHH
Confidence            4679999999999998888654


No 119
>PF08220 HTH_DeoR:  DeoR-like helix-turn-helix domain;  InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism. This family of prokaryotic regulators is named after the Escherichia coli protein DeoR, a repressor of the deo operon, which encodes nucleotide and deoxyribonucleotide catabolic enzymes. DeoR also negatively regulates the expression of nupG and tsx, a nucleoside-specific transport protein and a channel-forming protein, respectively. DeoR-like transcription repressors occur in diverse bacteria as regulators of sugar and nucleoside metabolic systems. The effector molecules for deoR-like regulators are generally phosphorylated intermediates of the relevant metabolic pathway. The DNA-binding deoR-type HTH domain occurs usually in the N-terminal part. The C-terminal part can contain an effector-binding domain and/or an oligomerisation domain. DeoR occurs as an octamer, whilst glpR and agaR are tetramers. Several operators may be bound simultaneously, which could facilitate DNA looping [, ].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular
Probab=23.90  E-value=58  Score=19.34  Aligned_cols=23  Identities=26%  Similarity=0.456  Sum_probs=17.4

Q ss_pred             CccchHHHHHHhhhhhcCChhhHhhhc
Q psy16018         62 GFSNVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        62 gF~nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      |+-+++|    +|+.|++|.+-|-+|+
T Consensus        13 ~~~s~~e----la~~~~VS~~TiRRDl   35 (57)
T PF08220_consen   13 GKVSVKE----LAEEFGVSEMTIRRDL   35 (57)
T ss_pred             CCEEHHH----HHHHHCcCHHHHHHHH
Confidence            4455555    5788999999998886


No 120
>PRK12459 S-adenosylmethionine synthetase; Provisional
Probab=23.79  E-value=72  Score=27.06  Aligned_cols=26  Identities=15%  Similarity=0.323  Sum_probs=23.0

Q ss_pred             cchHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         64 SNVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      -+..+|.+.|.+.|++.|.-|+++|.
T Consensus       324 ~~~~~i~~~i~~~Fdl~P~~Ii~~L~  349 (386)
T PRK12459        324 VSDEELTRAVREHFDLRPAGIIEKLN  349 (386)
T ss_pred             CCHHHHHHHHHHHcCCCHHHHHHHcC
Confidence            35788999999999999999999873


No 121
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. This enzyme is the enolase-phosphatase of methionine salvage, a pathway that regenerates methionine from methylthioadenosine (MTA). Adenosylmethionine (AdoMet) is a donor of different moieties for various processes, including methylation reactions. Use of AdoMet for spermidine biosynthesis, which leads to polyamine biosynthesis, leaves MTA as a by-product that must be cleared. In Bacillus subtilis and related species, this single protein is replaced by separate enzymes with enolase and phosphatase activities.
Probab=23.78  E-value=50  Score=24.64  Aligned_cols=22  Identities=27%  Similarity=0.300  Sum_probs=19.4

Q ss_pred             cchHHHHHHhhhhhcCChhhHh
Q psy16018         64 SNVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl   85 (89)
                      -.-.+.|.+|++.++++|+|++
T Consensus       152 KP~p~~y~~i~~~lgv~p~e~l  173 (220)
T TIGR01691       152 KTEAQSYVKIAGQLGSPPREIL  173 (220)
T ss_pred             CCCHHHHHHHHHHhCcChhHEE
Confidence            5567899999999999999875


No 122
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=23.56  E-value=35  Score=19.98  Aligned_cols=24  Identities=25%  Similarity=0.450  Sum_probs=13.3

Q ss_pred             eeeeeecccCCCceeccCccchHH
Q psy16018         45 LIFHCQLAHGSPTGLISGFSNVRE   68 (89)
Q Consensus        45 LvFh~QLAHGSptg~I~gF~nvkE   68 (89)
                      |+|.|+...+.|.-.|.=|-|-++
T Consensus         1 ~~L~C~a~~~~p~~~~~W~~~g~~   24 (76)
T cd05895           1 LVLRCETVSEYPSLRFKWFKNGKE   24 (76)
T ss_pred             CEEEEecccCCCCCceEEEECCcc
Confidence            567777655556555544444333


No 123
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings. This family includes protoporphyrin IX ferrochelatase (HemH), sirohydrochlorin ferrochelatase (SirB) and the cobaltochelatases, CbiK and CbiX. HemH and SirB are involved in heme and siroheme biosynthesis, respectively, while the cobaltochelatases are associated with cobalamin biosynthesis. Excluded from this family are the ATP-dependent heterotrimeric chelatases (class I) and the multifunctional homodimeric enzymes with dehydrogenase and chelatase activities (class III).
Probab=23.49  E-value=76  Score=19.46  Aligned_cols=26  Identities=23%  Similarity=0.305  Sum_probs=13.1

Q ss_pred             cccCCCceeccCccchHHHHHHhhhhh
Q psy16018         51 LAHGSPTGLISGFSNVRELYQKIAECY   77 (89)
Q Consensus        51 LAHGSptg~I~gF~nvkELY~kIae~f   77 (89)
                      ++|||+... ..-.-+.++.+.+++.+
T Consensus         5 v~HGs~~~s-~~~~~~~~~~~~l~~~~   30 (101)
T cd03409           5 VGHGSPYKD-PYKKDIEAQAHNLAESL   30 (101)
T ss_pred             EECCCCCCc-cHHHHHHHHHHHHHHHC
Confidence            589998651 11123444445554443


No 124
>PF01026 TatD_DNase:  TatD related DNase The Pfam entry finds members not in the Prosite definition.;  InterPro: IPR001130 This family of proteins are related to a large superfamily of metalloenzymes []. TatD, a member of this family has been shown experimentally to be a DNase enzyme []. Allantoinase 3.5.2.5 from EC, N-isopropylammelide isopropyl amidohydrolase 3.5.1 from EC and the SCN1 protein from fission yeast belong to this family.; GO: 0016888 endodeoxyribonuclease activity, producing 5'-phosphomonoesters; PDB: 3E2V_B 1XWY_A 3GUW_D 3RCM_A 1ZZM_A 2XIO_A 1J6O_A 2GZX_A 3IPW_A 2Y1H_A ....
Probab=23.47  E-value=80  Score=23.26  Aligned_cols=30  Identities=27%  Similarity=0.252  Sum_probs=24.8

Q ss_pred             eeccCccchHHHHHHhhhhhcCChhhHhhh
Q psy16018         58 GLISGFSNVRELYQKIAECYEFPAEEVSED   87 (89)
Q Consensus        58 g~I~gF~nvkELY~kIae~f~i~~~eIl~~   87 (89)
                      |+...-.++.+.++.||++.+++.+|+.+-
T Consensus       216 ~~~~~p~~i~~~~~~la~~~~~~~e~~~~~  245 (255)
T PF01026_consen  216 GKPNEPSNIPKVAQALAEIKGISLEELAQI  245 (255)
T ss_dssp             TSE--GGGHHHHHHHHHHHHTSTHHHHHHH
T ss_pred             CCCCChHHHHHHHHHHHHHcCCCHHHHHHH
Confidence            467778899999999999999999998764


No 125
>PTZ00104 S-adenosylmethionine synthase; Provisional
Probab=23.43  E-value=73  Score=27.16  Aligned_cols=25  Identities=4%  Similarity=0.352  Sum_probs=22.4

Q ss_pred             chHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         65 NVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      +..+|.+.|.+.|++.|..|+++|.
T Consensus       337 ~~~~i~~~v~~~Fdl~P~~II~~L~  361 (398)
T PTZ00104        337 DDEDLLEIVQKNFDLRPGDIIKELD  361 (398)
T ss_pred             CHHHHHHHHHHHcCCCHHHHHHHhC
Confidence            5678999999999999999999874


No 126
>KOG4812|consensus
Probab=23.38  E-value=29  Score=28.17  Aligned_cols=65  Identities=9%  Similarity=0.046  Sum_probs=41.0

Q ss_pred             CCCCCCCCCCcCCCCcccccCCCCCCCCCCCCCCceeeeeecccCCCceeccCccchHHHHHHhh
Q psy16018         10 KDDHLLDNNNVGEHKSKIYNGTKSPAPVTEDSKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIA   74 (89)
Q Consensus        10 k~~~~~~~~~~~~~~~~~~~g~~~~~p~~~~~~p~LvFh~QLAHGSptg~I~gF~nvkELY~kIa   74 (89)
                      ..++.+..+--.+|++-+++-...++.....+.|+.+-|.+.-|-+-...-..+..++++|.||-
T Consensus        20 r~t~~~e~ea~~g~~q~d~~~~e~s~l~~~~~~~~~~p~q~~~q~as~~p~~~a~~~p~~~~ki~   84 (262)
T KOG4812|consen   20 RDTQTVEGEAEIGSDQEDSIEDEGSPLAANEPAPRSVPHQLQVQLASGAPGRHAGILPPPYSKIP   84 (262)
T ss_pred             cccCCCccccccCCchhhhhhhccCcccccCCCCccchHHHHHhhccCCchhhcCCCCCcccccc
Confidence            44555555555677776666666554444556667776665555554444457888889998885


No 127
>PF11343 DUF3145:  Protein of unknown function (DUF3145);  InterPro: IPR021491  This family of proteins with unknown function appear to be restricted to Actinobacteria. 
Probab=23.24  E-value=1.1e+02  Score=23.15  Aligned_cols=63  Identities=25%  Similarity=0.360  Sum_probs=38.8

Q ss_pred             CCcCCCCcccccCCCCCCCCCCCCCCce-eeeeec-ccCCCceeccCcc-----------chHHHHHHhhhhhcCChhhH
Q psy16018         18 NNVGEHKSKIYNGTKSPAPVTEDSKPKL-IFHCQL-AHGSPTGLISGFS-----------NVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        18 ~~~~~~~~~~~~g~~~~~p~~~~~~p~L-vFh~QL-AHGSptg~I~gF~-----------nvkELY~kIae~f~i~~~eI   84 (89)
                      -||++.+|-   |.++.-   =+..|.| +||.|. |||.   .+=+-.           +-.+|...|..+.+-+=+|-
T Consensus        69 fEVTEdps~---g~DG~R---~s~tP~LGi~~a~t~a~Gd---vvv~E~rlRa~~~~a~~~~~~l~~el~~~LG~aWD~e  139 (158)
T PF11343_consen   69 FEVTEDPSP---GVDGER---WSHTPDLGIFHAQTDANGD---VVVPEDRLRAAMERARGDGEDLARELDRALGTAWDDE  139 (158)
T ss_pred             EEEEeCCCC---CCCCce---EecCCCCcceeeeecCCCC---EecCHHHHHHHHHHhcCCHHHHHHHHHHHhCCchhhh
Confidence            366777776   554421   2335566 899997 2332   222222           34556667778888888898


Q ss_pred             hhhcC
Q psy16018         85 SEDFR   89 (89)
Q Consensus        85 l~~~~   89 (89)
                      ||-||
T Consensus       140 LEpfR  144 (158)
T PF11343_consen  140 LEPFR  144 (158)
T ss_pred             hcccc
Confidence            88887


No 128
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=23.13  E-value=41  Score=19.69  Aligned_cols=16  Identities=38%  Similarity=0.729  Sum_probs=9.3

Q ss_pred             eeeeeecccCCCceecc
Q psy16018         45 LIFHCQLAHGSPTGLIS   61 (89)
Q Consensus        45 LvFh~QLAHGSptg~I~   61 (89)
                      |+++|+ |+|.|.-.|.
T Consensus         1 ~~L~C~-~~G~P~P~v~   16 (71)
T cd05876           1 LVLECI-AEGLPTPEVH   16 (71)
T ss_pred             CEEEEE-eeEecCCeEE
Confidence            456665 5666665554


No 129
>TIGR02875 spore_0_A sporulation transcription factor Spo0A. Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species.
Probab=23.01  E-value=59  Score=23.10  Aligned_cols=24  Identities=38%  Similarity=0.574  Sum_probs=19.2

Q ss_pred             hHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         66 VRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        66 vkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      -++||-.||+.|+..++-|-+..|
T Consensus       189 tk~lyp~ia~~~~~~~~~ve~~~r  212 (262)
T TIGR02875       189 TKELYPAIAKKYNTTASRVERAIR  212 (262)
T ss_pred             HHHHHHHHHHHcCCChHHHHHHHH
Confidence            366999999999999888776543


No 130
>PRK15044 transcriptional regulator SirC; Provisional
Probab=22.97  E-value=86  Score=25.42  Aligned_cols=29  Identities=3%  Similarity=0.150  Sum_probs=25.4

Q ss_pred             cCccchHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         61 SGFSNVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      -||+|+.-.+...-+.||++|.|..+.++
T Consensus       266 ~GFss~S~FsRaFKk~fG~TPseyRk~~~  294 (295)
T PRK15044        266 CGYDTPSYFIAIFKRHFKITPLSFMRTMN  294 (295)
T ss_pred             hCCCChHHHHHHHHHHHCcCHHHHHHhhc
Confidence            58999999999999999999999887663


No 131
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC_UbP (bone marrow stromal cell-derived ubiquitin-like protein) has an N-terminal ubiquitin-like (UBQ) domain and a C-terminal ubiquitin-associated (UBA) domain, a domain architecture similar to those of the UBIN, Chap1, and ubiquilin proteins.  This CD represents the N-terminal ubiquitin-like domain.
Probab=22.95  E-value=70  Score=21.02  Aligned_cols=22  Identities=36%  Similarity=0.304  Sum_probs=17.6

Q ss_pred             CccchHHHHHHhhhhhc--CC-hhh
Q psy16018         62 GFSNVRELYQKIAECYE--FP-AEE   83 (89)
Q Consensus        62 gF~nvkELY~kIae~f~--i~-~~e   83 (89)
                      |=.+|.+|-++|++.++  ++ +++
T Consensus        19 ~~~TV~~LK~kI~~~~~egi~~~dq   43 (75)
T cd01815          19 GGYQVSTLKQLIAAQLPDSLPDPEL   43 (75)
T ss_pred             ccCcHHHHHHHHHHhhccCCCChHH
Confidence            55789999999999974  75 665


No 132
>PRK09393 ftrA transcriptional activator FtrA; Provisional
Probab=22.92  E-value=88  Score=23.58  Aligned_cols=30  Identities=13%  Similarity=0.189  Sum_probs=23.4

Q ss_pred             ccCccchHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         60 ISGFSNVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        60 I~gF~nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      --||++..-++...-+.|+++|.+.-+.++
T Consensus       292 ~~Gf~~~s~F~r~Fk~~~G~tP~~yr~~~~  321 (322)
T PRK09393        292 RAGFGSEESLRHHFRRRAATSPAAYRKRFG  321 (322)
T ss_pred             HhCCCCHHHHHHHHHHHHCcCHHHHHHHhh
Confidence            358888888888888888888888766553


No 133
>PF10683 DBD_Tnp_Hermes:  Hermes transposase DNA-binding domain  ;  InterPro: IPR018473 This domain confers specific DNA-binding on Hermes transposase [].; PDB: 2BW3_B.
Probab=22.63  E-value=36  Score=22.66  Aligned_cols=26  Identities=19%  Similarity=0.455  Sum_probs=20.0

Q ss_pred             cCccchHHHHHHhhhhhc--CChhhHhh
Q psy16018         61 SGFSNVRELYQKIAECYE--FPAEEVSE   86 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~--i~~~eIl~   86 (89)
                      +||-++-..+=.|+..||  ++.+|+|-
T Consensus        37 sGfk~la~~li~IGA~yG~~V~vd~lLP   64 (68)
T PF10683_consen   37 SGFKKLAQFLINIGATYGENVNVDDLLP   64 (68)
T ss_dssp             HHHHHHHHHHHHHHHHH-S-B-HHHHS-
T ss_pred             ccHHHHHHHHHHHhHHhcccCCHHHcCC
Confidence            478888888889999999  89999984


No 134
>PRK00745 4-oxalocrotonate tautomerase; Provisional
Probab=22.50  E-value=69  Score=18.48  Aligned_cols=20  Identities=35%  Similarity=0.529  Sum_probs=14.1

Q ss_pred             hHHHHHHhh----hhhcCChhhHh
Q psy16018         66 VRELYQKIA----ECYEFPAEEVS   85 (89)
Q Consensus        66 vkELY~kIa----e~f~i~~~eIl   85 (89)
                      .++||+.|.    +.|++++++|.
T Consensus        17 k~~l~~~it~~l~~~~~~p~~~v~   40 (62)
T PRK00745         17 KRKLVEEITRVTVETLGCPPESVD   40 (62)
T ss_pred             HHHHHHHHHHHHHHHcCCChhHEE
Confidence            355666665    77899988874


No 135
>PRK09940 transcriptional regulator YdeO; Provisional
Probab=22.32  E-value=76  Score=24.71  Aligned_cols=28  Identities=11%  Similarity=0.341  Sum_probs=24.7

Q ss_pred             cCccchHHHHHHhhhhhcCChhhHhhhc
Q psy16018         61 SGFSNVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        61 ~gF~nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      -||+|..-.....-+.||++|.+..+.|
T Consensus       207 ~GF~s~S~Fsr~FKr~~G~TPs~yRk~~  234 (253)
T PRK09940        207 CGYASTSYFIYAFRKHFGNSPKRVSKEY  234 (253)
T ss_pred             hCCCCHHHHHHHHHHHHCcCHHHHHHHH
Confidence            4899999999999999999999987765


No 136
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family. This family of RNA polymerase sigma factors is a member of the Sigma-70 subfamily (TIGR02937) and is restricted to certain lineages of the order Bacillales. This family encompasses at least two distinct sigma factors as two proteins are found in each of B. anthracis, B. subtilis subsp. subtilis str. 168, and B. lichiniformis (although these are not apparently the same two in each). One of these is designated as SigM in B. subtilis (Swiss_Prot:  SIGM_BACSU) and is activated by various stressors.
Probab=22.19  E-value=70  Score=20.79  Aligned_cols=22  Identities=27%  Similarity=0.428  Sum_probs=17.5

Q ss_pred             eccCccchHHHHHHhhhhhcCChhhHh
Q psy16018         59 LISGFSNVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        59 ~I~gF~nvkELY~kIae~f~i~~~eIl   85 (89)
                      .++|+     -|+.||+.+|+++.-|-
T Consensus       118 ~~~g~-----s~~eIA~~lgis~~tv~  139 (154)
T TIGR02950       118 EFKEF-----SYKEIAELLNLSLAKVK  139 (154)
T ss_pred             hhccC-----cHHHHHHHHCCCHHHHH
Confidence            35677     68999999999987663


No 137
>COG3423 Nlp Predicted transcriptional regulator [Transcription]
Probab=21.80  E-value=52  Score=22.68  Aligned_cols=14  Identities=36%  Similarity=0.517  Sum_probs=12.3

Q ss_pred             HhhhhhcCChhhHh
Q psy16018         72 KIAECYEFPAEEVS   85 (89)
Q Consensus        72 kIae~f~i~~~eIl   85 (89)
                      -||++.+++|.||-
T Consensus        52 iIA~algv~P~eIW   65 (82)
T COG3423          52 IIADALGVPPEEIW   65 (82)
T ss_pred             HHHHHhCCCHHHhC
Confidence            48999999999984


No 138
>PF03517 Voldacs:  Regulator of volume decrease after cellular swelling;  InterPro: IPR003521 The nucleotide-sensitive chloride conductance regulatory protein (ICln) is found ubiquitously in mammalian (and other) cell types and is postulated to play a critical role in cell volume regulation. Initial studies proposed that ICln was itself a swelling-activated anion channel; however, further studies demonstrated that it is localised primarily to the cell cytoplasm. It has therefore been postulated that activation of cell volume regulation may involve reversible translocation of ICln from the cytoplasm, and its insertion into the plasma membrane. It is not resolved whether the anionic channel involved in cell volume regulation after cell-swelling comprises one or more subunits, and if it does, whether ICln is in fact one of them [].; GO: 0006821 chloride transport, 0006884 cell volume homeostasis; PDB: 1ZYI_A.
Probab=21.62  E-value=58  Score=22.58  Aligned_cols=20  Identities=20%  Similarity=0.559  Sum_probs=12.7

Q ss_pred             chHHHHHHhhhhhcCChhhH
Q psy16018         65 NVRELYQKIAECYEFPAEEV   84 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eI   84 (89)
                      .+.++|+.|++|..+.|+.-
T Consensus        91 ~l~~if~Als~C~~LhPD~~  110 (135)
T PF03517_consen   91 MLDEIFEALSECQELHPDPD  110 (135)
T ss_dssp             -HHHHHHHHHHHHH------
T ss_pred             HHHHHHHHHHHHHHhCCCCc
Confidence            39999999999999977654


No 139
>COG1476 Predicted transcriptional regulators [Transcription]
Probab=21.59  E-value=83  Score=20.55  Aligned_cols=18  Identities=33%  Similarity=0.385  Sum_probs=15.5

Q ss_pred             HHHHHhhhhhcCChhhHh
Q psy16018         68 ELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        68 ELY~kIae~f~i~~~eIl   85 (89)
                      +|=-+||.+|+.+.+||-
T Consensus        44 ~La~kia~~f~~~iedIF   61 (68)
T COG1476          44 ELALKIARVFGKTIEDIF   61 (68)
T ss_pred             HHHHHHHHHhCCCHHHHH
Confidence            467799999999999985


No 140
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon
Probab=21.48  E-value=81  Score=16.65  Aligned_cols=17  Identities=24%  Similarity=0.257  Sum_probs=12.8

Q ss_pred             HHHHhhhhhcCChhhHh
Q psy16018         69 LYQKIAECYEFPAEEVS   85 (89)
Q Consensus        69 LY~kIae~f~i~~~eIl   85 (89)
                      -++.||+.++++..-|-
T Consensus        20 s~~eia~~l~is~~tv~   36 (58)
T smart00421       20 TNKEIAERLGISEKTVK   36 (58)
T ss_pred             CHHHHHHHHCCCHHHHH
Confidence            56788888888877654


No 141
>PF08598 Sds3:  Sds3-like;  InterPro: IPR013907  Repression of gene transcription is mediated by histone deacetylases containing repressor-co-repressor complexes, which are recruited to promoters of target genes via interactions with sequence-specific transcription factors. The co-repressor complex contains a core of at least seven proteins []. This entry represents the conserved region found in Sds3, Dep1 and BRMS1-homologue p40 proteins. ; PDB: 2XUS_A.
Probab=21.32  E-value=31  Score=24.55  Aligned_cols=28  Identities=32%  Similarity=0.635  Sum_probs=0.0

Q ss_pred             CCCceeccCccchHHHHHHhhhhhcCChhhHhhhcC
Q psy16018         54 GSPTGLISGFSNVRELYQKIAECYEFPAEEVSEDFR   89 (89)
Q Consensus        54 GSptg~I~gF~nvkELY~kIae~f~i~~~eIl~~~~   89 (89)
                      +|+.-.| ||.+...       ++.++++||++|+.
T Consensus       176 ~~~~~~~-~~pa~~~-------~~~l~~~eI~eDl~  203 (205)
T PF08598_consen  176 SGPAPYI-GFPAAPN-------VYMLREEEIEEDLE  203 (205)
T ss_dssp             ------------------------------------
T ss_pred             cccCCcc-cchhhhh-------ccCCCHHHHHHHHH
Confidence            4544555 7766666       55599999999974


No 142
>PF10542 Vitelline_membr:  Vitelline membrane cysteine-rich region;  InterPro: IPR013135 In Drosophila melanogaster (Fruit fly) the vitelline membrane (VM) is the first layer of the eggshell produced by the follicular epithelium. It is composed of at least four different proteins. VM proteins are similarly organised with a central highly conserved 38-amino acid domain which is flanked by unrelated regions. Since the surrounding regions have diverged significantly, it is possible that the VM domain is of key importance in VM protein structure [, ]. The VM domain contains three highly conserved cysteines.
Probab=21.13  E-value=69  Score=19.30  Aligned_cols=13  Identities=23%  Similarity=0.521  Sum_probs=9.8

Q ss_pred             CCCCCceeeeeec
Q psy16018         39 EDSKPKLIFHCQL   51 (89)
Q Consensus        39 ~~~~p~LvFh~QL   51 (89)
                      |.+.-..||.||-
T Consensus         5 PpCpknY~FSCqp   17 (38)
T PF10542_consen    5 PPCPKNYVFSCQP   17 (38)
T ss_pred             CCCCcceeEeccc
Confidence            4456689999993


No 143
>COG3384 Aromatic ring-opening dioxygenase, catalytic LigB subunit related    enzyme [Amino acid transport and metabolism]
Probab=21.02  E-value=51  Score=26.64  Aligned_cols=26  Identities=19%  Similarity=0.284  Sum_probs=19.8

Q ss_pred             eeecccCCCceeccCccchHHHHHHhh
Q psy16018         48 HCQLAHGSPTGLISGFSNVRELYQKIA   74 (89)
Q Consensus        48 h~QLAHGSptg~I~gF~nvkELY~kIa   74 (89)
                      --=|+||||+=.++. +...+..+.|+
T Consensus        11 ~LflshgsP~~~~~~-n~~~~~l~~lG   36 (268)
T COG3384          11 ALFLSHGSPMLALED-NAATRGLRELG   36 (268)
T ss_pred             ceeecCCCcccccCc-cHHHHHHHHHH
Confidence            345899999988887 66666777777


No 144
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain.  For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization.  For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental
Probab=20.91  E-value=84  Score=16.82  Aligned_cols=18  Identities=17%  Similarity=0.244  Sum_probs=13.5

Q ss_pred             HHHHhhhhhcCChhhHhh
Q psy16018         69 LYQKIAECYEFPAEEVSE   86 (89)
Q Consensus        69 LY~kIae~f~i~~~eIl~   86 (89)
                      -++.||+.++++..-|-.
T Consensus        17 s~~eia~~l~~s~~tv~~   34 (57)
T cd06170          17 TNKEIADILGISEKTVKT   34 (57)
T ss_pred             CHHHHHHHHCCCHHHHHH
Confidence            467888888888876643


No 145
>COG4031 Predicted metal-binding protein [General function prediction only]
Probab=20.86  E-value=69  Score=25.55  Aligned_cols=18  Identities=39%  Similarity=0.831  Sum_probs=14.7

Q ss_pred             cCCCceeccCccchHHHHHHhhhh
Q psy16018         53 HGSPTGLISGFSNVRELYQKIAEC   76 (89)
Q Consensus        53 HGSptg~I~gF~nvkELY~kIae~   76 (89)
                      .|-++|      ++++||..|||-
T Consensus        51 ~gDedg------~lRNl~erlae~   68 (227)
T COG4031          51 RGDEDG------SLRNLYERLAER   68 (227)
T ss_pred             cCCCcc------hHHHHHHHHHHH
Confidence            499988      678899999953


No 146
>PF13936 HTH_38:  Helix-turn-helix domain; PDB: 2W48_A.
Probab=20.84  E-value=26  Score=19.99  Aligned_cols=24  Identities=17%  Similarity=0.117  Sum_probs=14.7

Q ss_pred             chHHHHHHhhhhhcCChhhHhhhc
Q psy16018         65 NVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        65 nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      +--.-+..||+.++.+++=|-+.+
T Consensus        18 ~~G~s~~~IA~~lg~s~sTV~rel   41 (44)
T PF13936_consen   18 EQGMSIREIAKRLGRSRSTVSREL   41 (44)
T ss_dssp             CS---HHHHHHHTT--HHHHHHHH
T ss_pred             HcCCCHHHHHHHHCcCcHHHHHHH
Confidence            333467889999999998886653


No 147
>PF00085 Thioredoxin:  Thioredoxin;  InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. In the NADPH-dependent protein disulphide reduction, thioredoxin reductase (TR) catalyses the reduction of oxidised thioredoxin (trx) by NADPH using FAD and its redox-active disulphide; reduced thioredoxin then directly reduces the disulphide in the substrate protein [].  Thioredoxin is present in prokaryotes and eukaryotes and the sequence around the redox-active disulphide bond is well conserved. All thioredoxins contain a cis-proline located in a loop preceding beta-strand 4, which makes contact with the active site cysteines, and is important for stability and function []. Thioredoxin belongs to a structural family that includes glutaredoxin, glutathione peroxidase, bacterial protein disulphide isomerase DsbA, and the N-terminal domain of glutathione transferase []. Thioredoxins have a beta-alpha unit preceding the motif common to all these proteins.  A number of eukaryotic proteins contain domains evolutionary related to thioredoxin, most of them are protein disulphide isomerases (PDI). PDI (5.3.4.1 from EC) [, , ] is an endoplasmic reticulum multi-functional enzyme that catalyses the formation and rearrangement of disulphide bonds during protein folding []. All PDI contains two or three (ERp72) copies of the thioredoxin domain, each of which contributes to disulphide isomerase activity, but which are functionally non-equivalent []. Moreover, PDI exhibits chaperone-like activity towards proteins that contain no disulphide bonds, i.e. behaving independently of its disulphide isomerase activity []. The various forms of PDI which are currently known are:   PDI major isozyme; a multifunctional protein that also function as the beta subunit of prolyl 4-hydroxylase (1.14.11.2 from EC), as a component of oligosaccharyl transferase (2.4.1.119 from EC), as thyroxine deiodinase (3.8.1.4 from EC), as glutathione-insulin transhydrogenase (1.8.4.2 from EC) and as a thyroid hormone-binding protein ERp60 (ER-60; 58 Kd microsomal protein). ERp60 was originally thought to be a phosphoinositide-specific phospholipase C isozyme and later to be a protease. ERp72. ERp5.    Bacterial proteins that act as thiol:disulphide interchange proteins that allows disulphide bond formation in some periplasmic proteins also contain a thioredoxin domain. These proteins include:    Escherichia coli DsbA (or PrfA) and its orthologs in Vibrio cholerae (TtcpG) and Haemophilus influenzae (Por). E. coli DsbC (or XpRA) and its orthologues in Erwinia chrysanthemi and H. influenzae. E. coli DsbD (or DipZ) and its H. influenzae orthologue. E. coli DsbE (or CcmG) and orthologues in H. influenzae.  Rhodobacter capsulatus (Rhodopseudomonas capsulata) (HelX), Rhiziobiacae (CycY and TlpA).   This entry represents the thioredoxin domain.; GO: 0045454 cell redox homeostasis; PDB: 3ED3_B 1EP7_A 1EP8_B 1TOF_A 2OE3_B 2OE1_B 2OE0_B 1V98_A 3H79_A 3CXG_A ....
Probab=20.72  E-value=97  Score=18.24  Aligned_cols=31  Identities=26%  Similarity=0.374  Sum_probs=26.1

Q ss_pred             CCceeeeeecccCCCceeccCccchHHHHHHhhh
Q psy16018         42 KPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAE   75 (89)
Q Consensus        42 ~p~LvFh~QLAHGSptg~I~gF~nvkELY~kIae   75 (89)
                      -|.++|...   |....++.|..+..+|.+-|.+
T Consensus        72 ~Pt~~~~~~---g~~~~~~~g~~~~~~l~~~i~~  102 (103)
T PF00085_consen   72 VPTIIFFKN---GKEVKRYNGPRNAESLIEFIEK  102 (103)
T ss_dssp             SSEEEEEET---TEEEEEEESSSSHHHHHHHHHH
T ss_pred             CCEEEEEEC---CcEEEEEECCCCHHHHHHHHHc
Confidence            578888877   8888999999999999887754


No 148
>PF14330 DUF4387:  Domain of unknown function (DUF4387)
Probab=20.71  E-value=47  Score=23.16  Aligned_cols=16  Identities=25%  Similarity=0.445  Sum_probs=12.8

Q ss_pred             HHhhhhhcCChhhHhh
Q psy16018         71 QKIAECYEFPAEEVSE   86 (89)
Q Consensus        71 ~kIae~f~i~~~eIl~   86 (89)
                      +.||+.|++++++|+.
T Consensus        42 ~~ia~Ly~i~~~~I~~   57 (99)
T PF14330_consen   42 ELIARLYGIDPEDIIK   57 (99)
T ss_pred             HHHHHHHCCCHHHEEE
Confidence            3477889999999954


No 149
>TIGR01244 conserved hypothetical protein TIGR01244. No member of this family is characterized. The member from Xylella fastidiosa is a longer protein with an N-terminal region described by this model, followed by a metallo-beta-lactamase family domain and an additional C-terminal region. Members scoring above the trusted cutoff are limited to the proteobacteria.
Probab=20.42  E-value=75  Score=21.64  Aligned_cols=34  Identities=21%  Similarity=0.340  Sum_probs=22.2

Q ss_pred             ceeeeeecccCCCceeccCccchHHHHHHhhhhhcCChhhHhhhc
Q psy16018         44 KLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        44 ~LvFh~QLAHGSptg~I~gF~nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      .++|||-      +|.=.|+     ||.-+.-..+++.++|++..
T Consensus        88 pvL~HC~------sG~Rt~~-----l~al~~~~~g~~~~~i~~~~  121 (135)
T TIGR01244        88 PVLAYCR------SGTRSSL-----LWGFRQAAEGVPVEEIVRRA  121 (135)
T ss_pred             CEEEEcC------CChHHHH-----HHHHHHHHcCCCHHHHHHHH
Confidence            4899995      2332344     66555555678999998753


No 150
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase. The Subfamily IA and IB capping domains are predicted by PSI-PRED to consist of an alpha helical bundle. Subfamily I encompasses such a wide region of sequence space (the sequences are highly divergent) that modelling it with a single alignment is impossible, resulting in an overly broad description which allows in many unrelated sequences. Subfamily IA and IB are separated based on an aparrent phylogenetic bifurcation. Subfamily IA is still too broad to model, but cannot be further subdivided into large chunks based on phylogenetic trees. Of the three motifs defining the HAD superfamily, the third has three variant forms : (1) hhhhsDxxx(x)D, (2) hhhhssxxx(x)D and (3) hhhhDDxxx(x)s where _s_ refers to a small amino acid and _h_ to a hydrophobic one. All three of these variants are found in subfamily IA. Individual models were made based on seeds exhibiting only o
Probab=20.30  E-value=73  Score=21.18  Aligned_cols=22  Identities=14%  Similarity=0.276  Sum_probs=18.1

Q ss_pred             cchHHHHHHhhhhhcCChhhHh
Q psy16018         64 SNVRELYQKIAECYEFPAEEVS   85 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl   85 (89)
                      ---.+.|..+++.++++|+|++
T Consensus       139 KP~p~~f~~~~~~~~~~p~~~l  160 (175)
T TIGR01493       139 KPDPVVYELVFDTVGLPPDRVL  160 (175)
T ss_pred             CCCHHHHHHHHHHHCCCHHHeE
Confidence            3467899999999999998864


No 151
>PLN02243 S-adenosylmethionine synthase
Probab=20.27  E-value=95  Score=26.41  Aligned_cols=25  Identities=12%  Similarity=0.328  Sum_probs=22.7

Q ss_pred             cchHHHHHHhhhhhcCChhhHhhhc
Q psy16018         64 SNVRELYQKIAECYEFPAEEVSEDF   88 (89)
Q Consensus        64 ~nvkELY~kIae~f~i~~~eIl~~~   88 (89)
                      -+..+|-+.|.+.|++.|.-|++.|
T Consensus       328 ~~d~~i~~~v~~~Fdlrp~~Ii~~L  352 (386)
T PLN02243        328 IPDKEILKIVKENFDFRPGMIAINL  352 (386)
T ss_pred             CCHHHHHHHHHHHcCCCHHHHHHhc
Confidence            3678999999999999999999986


No 152
>PF10685 KGG:  Stress-induced bacterial acidophilic repeat motif;  InterPro: IPR019626  This repeat contains a highly conserved, characteristic sequence motif, KGG, that is recognised by plants and lower eukaryotes. Further downstream from this motif is a Walker A, nucleotide binding motif. YciG is expressed as part of a three-gene operon, yciGFE and this operon is induced by stress and is regulated by RpoS, which controls the general stress-response in E coli. YciG was shown to be important for stationary-phase resistance to thermal stress and in particular to acid stress []. 
Probab=20.19  E-value=82  Score=16.77  Aligned_cols=14  Identities=21%  Similarity=0.299  Sum_probs=11.8

Q ss_pred             Cccc-hHHHHHHhhh
Q psy16018         62 GFSN-VRELYQKIAE   75 (89)
Q Consensus        62 gF~n-vkELY~kIae   75 (89)
                      ||.| .+|.+..||.
T Consensus         1 ~Fa~~d~e~~~eig~   15 (23)
T PF10685_consen    1 NFASMDPEKAREIGR   15 (23)
T ss_pred             CccccCHHHHHHHHH
Confidence            6888 8999998885


No 153
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=20.05  E-value=69  Score=19.36  Aligned_cols=18  Identities=28%  Similarity=0.593  Sum_probs=10.5

Q ss_pred             eeeeeecccCCCceeccCc
Q psy16018         45 LIFHCQLAHGSPTGLISGF   63 (89)
Q Consensus        45 LvFh~QLAHGSptg~I~gF   63 (89)
                      ++|.|+ |.|+|+-.|.=+
T Consensus         1 ~~l~C~-a~G~P~P~i~W~   18 (77)
T cd05874           1 IVIQCE-AKGKPPPSFSWT   18 (77)
T ss_pred             CEEEee-CcccCCCeEEEE
Confidence            356666 566666666433


No 154
>TIGR01068 thioredoxin thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model.
Probab=20.04  E-value=1.5e+02  Score=17.21  Aligned_cols=33  Identities=24%  Similarity=0.255  Sum_probs=25.3

Q ss_pred             CCCceeeeeecccCCCceeccCccchHHHHHHhhhh
Q psy16018         41 SKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAEC   76 (89)
Q Consensus        41 ~~p~LvFh~QLAHGSptg~I~gF~nvkELY~kIae~   76 (89)
                      .-|.++|. +  .|....++.|+.+.+++-..|.+.
T Consensus        68 ~~P~~~~~-~--~g~~~~~~~g~~~~~~l~~~l~~~  100 (101)
T TIGR01068        68 SIPTLLLF-K--NGKEVDRSVGALPKAALKQLINKN  100 (101)
T ss_pred             cCCEEEEE-e--CCcEeeeecCCCCHHHHHHHHHhh
Confidence            35678877 3  588888999999988888777653


Done!